Psyllid ID: psy9748

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------136

MCDEFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYRERERGGQKYPWALFPAGYSGPKFRCLGLDREKAEKEMGNGRTLSLSEDEGIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATSTSNPTTSEAGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRVNTLAKNKIKPIVVRLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKLRE

cccccEEEEEEEEEHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEcEEEccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccEEEEEEEEEccccHHHHHHHHEEEEEEcccccccccccccccccEEEEEEEEcccccccccccEEEccccccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHcccccccEEEEEEEEEEEEEEEccccEEHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHcccccEEEEEEccccEEEEEEEHHHHHHHHHHHHHcccccccccEEEEcccccccccccccccccccccccccccccccccccHHHHHHHccccccEEEEccccccccccccccEEcccccccccccccccccccccccccccccEEcccccHHHHHHHHHHcccEEEccccEEEEEEEHHHHHHHHcccccccccHHHHHHHccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEEccccccEEEEEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccHHcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccc

cccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccEEccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcHEEHHHHcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccEEEcccccccEEEEHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccEEcccccccccccccccccccEHHHccccEEEEEEcccccccccccccHccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEccccccEccccEEEEcccccEHccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccHHHHcccccccccEEEEcccccHHHHHHHHHHccccccEEEEcccccEEEEEEEHHHHHHHHHHHHccccccccccEEEEccccccccccccccccccccccccccccEccccccHHHHHHHHHccEEEEEEcccEEEEEEEcHHHHHHHHHcccccccccccccccccccccccccEEcccccHHHHHHHHHHHEEHHHccccEEEEEHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEcccccEEEEEEcHccHHHHHHccccHHHHHHHHHEEEEEccccccEEEEEEccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHcHHHHHHHHHHHHHEEEEEEcHHHHHHHHHHHHHccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccHHHHccccccc

mcdefelagsVAGIIDIGSswmsdlkyglcpeafwlnkeqccwssnetsfedtgncsqgerlkplqqHQQHFYYDILNnyedvnkpggVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMfapyacgsgipeiKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAglslgkegpmVHIASCIGNILSYlfpkygrneAKKREILSAAAAAGVsvafgapiggvlFSLEEVSFFLFFRIFHLEMEgrrrrgrprlrwVDMIHNDIEKevsyyfplktlwrsfpfsiyirsiptkwmcdkfelagsVAGIIDIGSswmsdlkyglcpeafwlnkeqccwssnetsfedtgncsqpkplqqhqqHFHYDILnnyedvnkppgvLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMfapyacgsgipealthphslhsdplsvltqdsmtvqDVETNYRererggqkypwalfpagysgpkfrclglDREKAEKemgngrtlslsedegiidittsgtmnerHLAEQINishgsgfldsdeipgigqyedfhtIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTdkfigccnffecfafsdyvinhnatstsnpttseagpgVYTAVWLLMITLVLKLVLTVFTfgikvpcgRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDalgkqgiydAHIMlnaypfldskeeFASTalasdvmqpkhsdplsvltqdsmtVQDVETLLKetehngfpvvvsresqYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFvqndtqpqplpgappilrldkildmapititdqtpmetvcghtftkqllfpanaKRTLEGLRGDSIVRFvqndtqpqplpgappilrldkildmapititdqtpmeTVVDMYKKRSISVTNGQKEIFLMRFLWDRWETlgnklgipdcmkdVHKAHRVntlaknkikpivvrlsntsvrdkwttasrskqlyKEKIYINEHLTKANQDLLFKAKKlkeangykfvwVRDCKIMIRKNESSRIYVIRNVRDLetymtlvppqlsrslqEVSVFLDFAGYTHVDVLVShtdnhtsndarvnfggqQDIFTFLGkqfegglqLTFKHILSLSSHGMIVVCFYlnsppsvsslvwpkvslsNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDalgkqgiydAHIMlnaypfldskeefastalasdvmqpklre

MCDEFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLemegrrrrgrprlrwVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYrererggqkypwalfpagysgPKFRCLGLDREKAEKEmgngrtlslsedegIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATstsnpttseaGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKEtehngfpvvvsreSQYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFVQndtqpqplpgappiLRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVqndtqpqplpgappiLRLDKILDMAPititdqtpmetVVDMYKKRsisvtngqkEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRvntlaknkikpivvrlsntsvrdkwttasrskqlykeKIYINEHLTKANQDLLFKAKklkeangykfvwvrdckimirknessriyvIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTalasdvmqpklre

MCDEFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILsaaaaagvsvafgaPIGGvlfsleevsfflffRIFHLEMEgrrrrgrprlrWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYRERERGGQKYPWALFPAGYSGPKFRCLGLDREKAEKEMGNGRTLSLSEDEGIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATSTSNPTTSEAGPGVYTAvwllmitlvlklvltvftFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRVNTLAKNKIKPIVVRLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDltllltfltlfGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKLRE

****FELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSN********************QHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHL************LRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSS*********************QHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALT**********************************QKYPWALFPAGYSGPKFRCLGL**********************IIDITT*******HLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNA***********GPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSK********************************DVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFVQN**********PPILRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQ***********PPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRVNTLAKNKIKPIVVRLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDS********************

**DEFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVE********************************************RTLSLSEDEGIIDITTS**************SHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATSTSNPTTSEAGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKR*******************************LDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVH******************RLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASD*MQP****

********GSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWS************SQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWS*********************QQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYRERERGGQKYPWALFPAGYSGPKFRCLGLDREKAEKEMGNGRTLSLSEDEGIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATSTSNPTTSEAGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRVNTLAKNKIKPIVVRLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKLRE

MCDEFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYRERERGGQKYPWALFPAGYSGPKFRCLGLDREKAEKEMGNGRTLSLSEDEGIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATSTSNPTTSEAGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKRTLEGLRGDSIVRFVQNDT*********PILRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQNDTQP*****APPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRVNTLAKNKIKPIVVRLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDV*******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MCDEFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYRERERGGQKYPWALFPAGYSGPKFRCLGLDREKAEKEMGNGRTLSLSEDEGIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPGIGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINHNATSTSNPTTSEAGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSLVVIMFELTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLxxxxxxxxxxxxxxxxxxxxxSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVCGHTFTKQLLFPANAKRTLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVVDMYKKRSISVTNGQKEIFLMRFLWDRWETLGNKLGIPDCMKDVHKAHRVNTLAKNKIKPIVVRLSNTSVRDKWTTASRSKQLYKEKIYINEHLTKANQDLLFKAKKLKEANGYKFVWVRDCKIMIRKNESSRIYVIRNVRDLETYMTLVPPQLSRSLQEVSVFLDFAGYTHVDVLVSHTDNHTSNDARVNFGGQQDIFTFLGKQFEGGLQLTFKHILSLSSHGMIVVCFYLNSPPSVSSLVWPKVSLSNLTAMQTRMVVCTSNDLTLLLTFLTLFGTRDVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVMQPKLRE

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1359	2.2.26 [Sep-21-2011]
Q5RDJ7		801	H(+)/Cl(-) exchange trans	yes	N/A	0.158	0.268	0.536	4e-73
O18894		818	H(+)/Cl(-) exchange trans	no	N/A	0.158	0.262	0.533	5e-73
P51790		818	H(+)/Cl(-) exchange trans	yes	N/A	0.158	0.262	0.533	5e-73
P51791		818	H(+)/Cl(-) exchange trans	yes	N/A	0.158	0.262	0.533	5e-73
P51792		818	H(+)/Cl(-) exchange trans	yes	N/A	0.158	0.262	0.533	5e-73
Q9R279		760	H(+)/Cl(-) exchange trans	yes	N/A	0.158	0.282	0.533	7e-73
P51794		747	H(+)/Cl(-) exchange trans	no	N/A	0.158	0.289	0.541	2e-72
Q61418		747	H(+)/Cl(-) exchange trans	no	N/A	0.158	0.289	0.541	2e-72
P51793		760	H(+)/Cl(-) exchange trans	no	N/A	0.158	0.284	0.538	5e-72
Q99P66		746	H(+)/Cl(-) exchange trans	no	N/A	0.223	0.407	0.483	2e-71

>sp\|Q5RDJ7\|CLCN3_PONAB H(+)/Cl(-) exchange transporter 3 OS=Pongo abelii GN=CLCN3 PE=2 SV=1	Back alignment and function desciption

 Score =  277 bits (709), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/287 (53%), Positives = 181/287 (63%), Gaps = 72/287 (25%)

Query: 8   AGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQ 67
           +G++AG+IDI + WM+DLK G+C  A W N EQCCW SNET+FE+   C           
Sbjct: 139 SGALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCP---------- 188

Query: 68  HQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASL 127
                                   QW TWAE++    EG  +Y + Y+ +I WAL FA L
Sbjct: 189 ------------------------QWKTWAELIIGQAEGPGSYIMNYIMYIFWALSFAFL 224

Query: 128 AAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEGP 187
           A  LV++FAPYACGSGIPEIKTILSGFIIRGYLGKWTL+IK+V ++LAV++GLSLGKEGP
Sbjct: 225 AVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTVTLVLAVASGLSLGKEGP 284

Query: 188 MVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFFL 247
           +VH+A C GNI SYLFPKY  NEAKKRE+LSAA+AAGVSVAFGAPIGGVLFSLEE     
Sbjct: 285 LVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEE----- 339

Query: 248 FFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSF 294
                                            VSYYFPLKTLWRSF
Sbjct: 340 ---------------------------------VSYYFPLKTLWRSF 353

Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the endosome and synaptic vesicle lumen, and may thereby affect vesicle trafficking and exocytosis. May play an important role in neuronal cell function through regulation of membrane excitability by protein kinase C. It could help neuronal cells to establish short-term memory.
Pongo abelii (taxid: 9601)

>sp\|O18894\|CLCN3_RABIT H(+)/Cl(-) exchange transporter 3 OS=Oryctolagus cuniculus GN=CLCN3 PE=2 SV=3	Back alignment and function description

>sp\|P51790\|CLCN3_HUMAN H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens GN=CLCN3 PE=1 SV=2	Back alignment and function description

>sp\|P51791\|CLCN3_MOUSE H(+)/Cl(-) exchange transporter 3 OS=Mus musculus GN=Clcn3 PE=1 SV=2	Back alignment and function description

>sp\|P51792\|CLCN3_RAT H(+)/Cl(-) exchange transporter 3 OS=Rattus norvegicus GN=Clcn3 PE=2 SV=2	Back alignment and function description

>sp\|Q9R279\|CLCN3_CAVPO H(+)/Cl(-) exchange transporter 3 OS=Cavia porcellus GN=CLCN3 PE=2 SV=1	Back alignment and function description

>sp\|P51794\|CLCN4_RAT H(+)/Cl(-) exchange transporter 4 OS=Rattus norvegicus GN=Clcn4 PE=2 SV=1	Back alignment and function description

>sp\|Q61418\|CLCN4_MOUSE H(+)/Cl(-) exchange transporter 4 OS=Mus musculus GN=Clcn4 PE=2 SV=2	Back alignment and function description

>sp\|P51793\|CLCN4_HUMAN H(+)/Cl(-) exchange transporter 4 OS=Homo sapiens GN=CLCN4 PE=1 SV=2	Back alignment and function description

>sp\|Q99P66\|CLCN5_CAVPO H(+)/Cl(-) exchange transporter 5 OS=Cavia porcellus GN=CLCN5 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1359
312373834		1006	hypothetical protein AND_16932 [Anophele	0.158	0.213	0.638	5e-89
158294756		917	AGAP005777-PA [Anopheles gambiae str. PE	0.158	0.234	0.638	2e-88
195126427		880	GI13072 [Drosophila mojavensis] gi\|19391	0.222	0.343	0.601	2e-88
157123916		877	chloride channel protein 3 [Aedes aegypt	0.158	0.245	0.628	3e-87
195378823		877	GJ13821 [Drosophila virilis] gi\|19415533	0.214	0.332	0.612	7e-87
307199100		833	Chloride channel protein 3 [Harpegnathos	0.158	0.258	0.631	8e-87
195019841		884	GH16850 [Drosophila grimshawi] gi\|193898	0.214	0.330	0.605	1e-86
260310527		893	RE11344p [Drosophila melanogaster]	0.214	0.325	0.603	2e-86
320545940		893	chloride channel-c, isoform C [Drosophil	0.214	0.325	0.603	2e-86
21744243		882	LD07266p [Drosophila melanogaster]	0.214	0.329	0.603	3e-86

>gi\|312373834\|gb\|EFR21515.1\| hypothetical protein AND_16932 [Anopheles darlingi]	Back alignment and taxonomy information

 Score =  336 bits (862), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 184/288 (63%), Positives = 200/288 (69%), Gaps = 73/288 (25%)

Query: 7   LAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQ 66
             G VAG+IDIG+SWM+DLK+G+CP+AFWLN+EQCCWSSNETSF D+GNCSQ        
Sbjct: 373 FTGCVAGVIDIGASWMTDLKFGICPQAFWLNREQCCWSSNETSF-DSGNCSQ-------- 423

Query: 67  QHQQHFYYDILNNYEDVNKPGGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFAS 126
                                     W  W+E+  S++EGF AY + Y F+I WA+LFA 
Sbjct: 424 --------------------------WYAWSEIFTSSREGFGAYVISYFFYIMWAMLFAL 457

Query: 127 LAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLIIKSVGIMLAVSAGLSLGKEG 186
           LAA LVRMFAPYACGSGIPEIKTILSGFIIR YLGKWTLIIKSVGIML+VSAGLSLGKEG
Sbjct: 458 LAASLVRMFAPYACGSGIPEIKTILSGFIIRSYLGKWTLIIKSVGIMLSVSAGLSLGKEG 517

Query: 187 PMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFF 246
           PMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEE    
Sbjct: 518 PMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEE---- 573

Query: 247 LFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSF 294
                                             VSYYFPLKTLWRSF
Sbjct: 574 ----------------------------------VSYYFPLKTLWRSF 587

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|158294756\|ref\|XP_001688728.1\| AGAP005777-PA [Anopheles gambiae str. PEST] gi\|158294758\|ref\|XP_315792.4\| AGAP005777-PB [Anopheles gambiae str. PEST] gi\|157015713\|gb\|EDO63734.1\| AGAP005777-PA [Anopheles gambiae str. PEST] gi\|157015714\|gb\|EAA11899.4\| AGAP005777-PB [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|195126427\|ref\|XP_002007672.1\| GI13072 [Drosophila mojavensis] gi\|193919281\|gb\|EDW18148.1\| GI13072 [Drosophila mojavensis]	Back alignment and taxonomy information

>gi\|157123916\|ref\|XP_001653972.1\| chloride channel protein 3 [Aedes aegypti] gi\|108882874\|gb\|EAT47099.1\| AAEL001752-PB [Aedes aegypti]	Back alignment and taxonomy information

>gi\|195378823\|ref\|XP_002048181.1\| GJ13821 [Drosophila virilis] gi\|194155339\|gb\|EDW70523.1\| GJ13821 [Drosophila virilis]	Back alignment and taxonomy information

>gi\|307199100\|gb\|EFN79810.1\| Chloride channel protein 3 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|195019841\|ref\|XP_001985066.1\| GH16850 [Drosophila grimshawi] gi\|193898548\|gb\|EDV97414.1\| GH16850 [Drosophila grimshawi]	Back alignment and taxonomy information

>gi\|260310527\|gb\|ACX36518.1\| RE11344p [Drosophila melanogaster]	Back alignment and taxonomy information

>gi|320545940|ref|NP_730105.3| chloride channel-c, isoform C [Drosophila melanogaster] gi|442632693|ref|NP_001261922.1| chloride channel-c, isoform D [Drosophila melanogaster] gi|318069221|gb|AAF49542.4| chloride channel-c, isoform C [Drosophila melanogaster] gi|378548256|gb|AFC17502.1| FI18633p1 [Drosophila melanogaster] gi|440215869|gb|AGB94615.1| chloride channel-c, isoform D [Drosophila melanogaster]

Back alignment and taxonomy information

>gi\|21744243\|gb\|AAM76180.1\| LD07266p [Drosophila melanogaster]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1359
FB\|FBgn0036566		882	ClC-c "Chloride channel-c" [Dr	0.209	0.323	0.576	8e-153
UNIPROTKB\|F1N9G5		813	CLCN5 "Uncharacterized protein	0.229	0.383	0.445	1.4e-131
UNIPROTKB\|F1PZE9		816	CLCN5 "Uncharacterized protein	0.229	0.382	0.451	2.6e-131
UNIPROTKB\|Q9GKE7		746	CLCN5 "H(+)/Cl(-) exchange tra	0.229	0.418	0.451	1.4e-130
UNIPROTKB\|E1C9F7		818	CLCN3 "Uncharacterized protein	0.229	0.381	0.446	1.5e-130
UNIPROTKB\|B4F6X6		818	clcn3 "Putative uncharacterize	0.229	0.381	0.456	1.7e-130
MGI\|MGI:103555		818	Clcn3 "chloride channel 3" [Mu	0.229	0.381	0.443	3.3e-130
UNIPROTKB\|Q9R279		760	CLCN3 "H(+)/Cl(-) exchange tra	0.229	0.410	0.443	3.3e-130
UNIPROTKB\|P51795		746	CLCN5 "H(+)/Cl(-) exchange tra	0.229	0.418	0.454	3.7e-130
RGD\|621219		818	Clcn3 "chloride channel, volta	0.229	0.381	0.443	4.2e-130

FB\|FBgn0036566 ClC-c "Chloride channel-c" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 742 (266.3 bits), Expect = 8.0e-153, Sum P(4) = 8.0e-153
 Identities = 170/295 (57%), Positives = 194/295 (65%)

Query:   647 NATS-TSNPTTSEAGPGVYTAXXXXXXXXXXXXXXXXXXFGIKVPCGRLYLALFEQNKQG 705
             N TS  S    +E GPGVY++                  FG+KVP G    +L      G
Sbjct:   546 NITSGNSFIEVTEPGPGVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMG 605

Query:   706 TYLSFYFIYFSVSLVVIMFELTGGV---RYIVPLMAAAMASKWHKKLKTLFRLSLVVIMF 762
               +      F+ S   I F  TG       I P + A + +       T   +SLVVIMF
Sbjct:   606 RIVGIGVEQFAYSYPNIWF-FTGECADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMF 664

Query:   763 ELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPFLDSKEEFASTALASDVM 822
             ELTGGVRYIVPLMAAAMASKWVGDALG+QGIYDAHI LN YPFLDSKEEFA T LA+DVM
Sbjct:   665 ELTGGVRYIVPLMAAAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEFAHTTLAADVM 724

Query:   823 QPKHSDPLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANA 882
             QPK ++ L+V+TQDSMTV DVE LLKETEHNG+PVVVSRE+QYLVGFVLRRDLNLAI NA
Sbjct:   725 QPKRNETLNVITQDSMTVDDVENLLKETEHNGYPVVVSRENQYLVGFVLRRDLNLAIGNA 784

Query:   883 KRTLEGLRGDSIVRFVQNDTQPQPLPG-APPILRLDKILDMAPITITDQTPMETV 936
             KR +EG+   SIV F    T  QP+    P  L+L KILDMAPIT+TDQTPMETV
Sbjct:   785 KRLIEGISSSSIVLF----TSSQPIQNLGPQPLKLKKILDMAPITVTDQTPMETV 835

GO:0005254 "chloride channel activity" evidence=ISS

GO:0016020 "membrane" evidence=IEA

GO:0005247 "voltage-gated chloride channel activity" evidence=IEA

GO:0055085 "transmembrane transport" evidence=IEA

GO:0006821 "chloride transport" evidence=IEA

UNIPROTKB\|F1N9G5 CLCN5 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PZE9 CLCN5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9GKE7 CLCN5 "H(+)/Cl(-) exchange transporter 5" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C9F7 CLCN3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|B4F6X6 clcn3 "Putative uncharacterized protein" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

MGI\|MGI:103555 Clcn3 "chloride channel 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9R279 CLCN3 "H(+)/Cl(-) exchange transporter 3" [Cavia porcellus (taxid:10141)]	Back alignment and assigned GO terms

UNIPROTKB\|P51795 CLCN5 "H(+)/Cl(-) exchange transporter 5" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

RGD\|621219 Clcn3 "chloride channel, voltage-sensitive 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1359
cd03684		445	cd03684, ClC_3_like, ClC-3-like chloride channel p	3e-84
cd01036		416	cd01036, ClC_euk, Chloride channel, ClC	4e-53
cd03685		466	cd03685, ClC_6_like, ClC-6-like chloride channel p	2e-41
cd03683		426	cd03683, ClC_1_like, ClC-1-like chloride channel p	4e-39
cd03684		445	cd03684, ClC_3_like, ClC-3-like chloride channel p	2e-37
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	7e-34
cd01031		402	cd01031, EriC, ClC chloride channel EriC	4e-27
COG0038		443	COG0038, EriC, Chloride channel protein EriC [Inor	5e-26
cd00400		383	cd00400, Voltage_gated_ClC, CLC voltage-gated chlo	2e-24
cd03684		445	cd03684, ClC_3_like, ClC-3-like chloride channel p	6e-24
PRK05277		438	PRK05277, PRK05277, chloride channel protein; Prov	3e-23
cd01034		390	cd01034, EriC_like, ClC chloride channel family	3e-17
cd04591		105	cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont	2e-14
cd03685		466	cd03685, ClC_6_like, ClC-6-like chloride channel p	6e-13
cd01036		416	cd01036, ClC_euk, Chloride channel, ClC	3e-11
cd03685		466	cd03685, ClC_6_like, ClC-6-like chloride channel p	3e-11
cd03684		445	cd03684, ClC_3_like, ClC-3-like chloride channel p	1e-09
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	2e-09
cd01036		416	cd01036, ClC_euk, Chloride channel, ClC	2e-08
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	1e-06
cd01036		416	cd01036, ClC_euk, Chloride channel, ClC	2e-06
COG0038		443	COG0038, EriC, Chloride channel protein EriC [Inor	2e-06
cd01033		388	cd01033, ClC_like, Putative ClC chloride channel	2e-06
cd04610		107	cd04610, CBS_pair_ParBc_assoc, This cd contains tw	2e-05
pfam03258		214	pfam03258, Baculo_FP, Baculovirus FP protein	2e-05
cd01031		402	cd01031, EriC, ClC chloride channel EriC	4e-05
cd00400		383	cd00400, Voltage_gated_ClC, CLC voltage-gated chlo	4e-05
PRK01862		574	PRK01862, PRK01862, putative voltage-gated ClC-typ	4e-05
cd03683		426	cd03683, ClC_1_like, ClC-1-like chloride channel p	7e-05
pfam00654		345	pfam00654, Voltage_CLC, Voltage gated chloride cha	8e-05
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synt	1e-04
cd03683		426	cd03683, ClC_1_like, ClC-1-like chloride channel p	4e-04
cd02205		113	cd02205, CBS_pair, The CBS domain, named after hum	5e-04
COG0038		443	COG0038, EriC, Chloride channel protein EriC [Inor	6e-04
cd03682		378	cd03682, ClC_sycA_like, ClC sycA-like chloride cha	6e-04
cd01033		388	cd01033, ClC_like, Putative ClC chloride channel	7e-04
PRK01610		418	PRK01610, PRK01610, putative voltage-gated ClC-typ	8e-04
pfam00571		57	pfam00571, CBS, CBS domain	0.001
cd00400		383	cd00400, Voltage_gated_ClC, CLC voltage-gated chlo	0.003
COG4109		432	COG4109, COG4109, Predicted transcriptional regula	0.003
cd04591		105	cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont	0.004

>gnl\|CDD\|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins	Back alignment and domain information

 Score =  282 bits (725), Expect = 3e-84
 Identities = 119/198 (60%), Positives = 139/198 (70%), Gaps = 42/198 (21%)

Query: 97  AEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFII 156
           A  +   KEG+      Y+ ++  ALLFA +A  LV++ APYA GSGIPEIKTILSGFII
Sbjct: 15  ASWLSDLKEGY----CNYIIYVLLALLFAFIAVLLVKVVAPYAAGSGIPEIKTILSGFII 70

Query: 157 RGYLGKWTLIIKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREI 216
           RG+LGKWTL+IKSVG++LAV++GLSLGKEGP+VHIA+C+GNI+S LFPKY RNEAK+REI
Sbjct: 71  RGFLGKWTLLIKSVGLVLAVASGLSLGKEGPLVHIATCVGNIISRLFPKYRRNEAKRREI 130

Query: 217 LSAAAAAGVSVAFGAPIGGVLFSLEEVSFFLFFRIFHLEMEGRRRRGRPRLRWVDMIHND 276
           LSAAAAAGV+VAFGAPIGGVLFSLE                                   
Sbjct: 131 LSAAAAAGVAVAFGAPIGGVLFSLE----------------------------------- 155

Query: 277 IEKEVSYYFPLKTLWRSF 294
              EVSYYFPLKTLWRSF
Sbjct: 156 ---EVSYYFPLKTLWRSF 170

This CD includes ClC-3, ClC-4, ClC-5 and ClC-Y1. ClC-3 was initially cloned from rat kidney. Expression of ClC-3 produces outwardly-rectifying Cl currents that are inhibited by protein kinase C activation. It has been suggested that ClC-3 may be a ubiquitous swelling-activated Cl channel that has very similar characteristics to those of native volume-regulated Cl currents. The function of ClC-4 is unclear. Studies of human ClC-4 have revealed that it gives rise to Cl currents that rapidly activate at positive voltages, and are sensitive to extracellular pH, with currents decreasing when pH falls below 6.5. ClC-4 is broadly distributed, especially in brain and heart. ClC-5 is predominantly expressed in the kidney, but can be found in the brain and liver. Mutations in the ClC-5 gene cause certain hereditary diseases, including Dent's disease, an X-chromosome linked syndrome characterised by proteinuria, hypercalciuria, and kidney stones (nephrolithiasis), leading to progressive renal failure. These proteins belong to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. This domain is found in the eukaryotic halogen ion (Cl- and I-) channel proteins, that perform a variety of functions including cell volume regulation, the membrane potential stabilization, transepithelial chloride transport and charge compensation necessary for the acidification of intracellular organelles. Length = 445

>gnl\|CDD\|238507 cd01036, ClC_euk, Chloride channel, ClC	Back alignment and domain information

>gnl\|CDD\|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|238504 cd01031, EriC, ClC chloride channel EriC	Back alignment and domain information

>gnl\|CDD\|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel	Back alignment and domain information

>gnl\|CDD\|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|235385 PRK05277, PRK05277, chloride channel protein; Provisional	Back alignment and domain information

>gnl\|CDD\|238506 cd01034, EriC_like, ClC chloride channel family	Back alignment and domain information

>gnl\|CDD\|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>gnl\|CDD\|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|238507 cd01036, ClC_euk, Chloride channel, ClC	Back alignment and domain information

>gnl\|CDD\|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|238507 cd01036, ClC_euk, Chloride channel, ClC	Back alignment and domain information

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|238507 cd01036, ClC_euk, Chloride channel, ClC	Back alignment and domain information

>gnl\|CDD\|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|238505 cd01033, ClC_like, Putative ClC chloride channel	Back alignment and domain information

>gnl\|CDD\|239983 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>gnl\|CDD\|217459 pfam03258, Baculo_FP, Baculovirus FP protein	Back alignment and domain information

>gnl\|CDD\|238504 cd01031, EriC, ClC chloride channel EriC	Back alignment and domain information

>gnl\|CDD\|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel	Back alignment and domain information

>gnl\|CDD\|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>gnl\|CDD\|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel	Back alignment and domain information

>gnl\|CDD\|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|239654 cd03682, ClC_sycA_like, ClC sycA-like chloride channel proteins	Back alignment and domain information

>gnl\|CDD\|238505 cd01033, ClC_like, Putative ClC chloride channel	Back alignment and domain information

>gnl\|CDD\|234963 PRK01610, PRK01610, putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>gnl\|CDD\|201313 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel	Back alignment and domain information

>gnl\|CDD\|226594 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>gnl\|CDD\|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1359
KOG0475\|consensus		696		100.0
KOG0474\|consensus		762		100.0
KOG0476\|consensus		931		100.0
PRK01862		574	putative voltage-gated ClC-type chloride channel C	100.0
cd03684		445	ClC_3_like ClC-3-like chloride channel proteins. T	100.0
KOG0475\|consensus		696		100.0
cd01036		416	ClC_euk Chloride channel, ClC. These domains are f	100.0
cd03685		466	ClC_6_like ClC-6-like chloride channel proteins. T	100.0
cd03683		426	ClC_1_like ClC-1-like chloride channel proteins. T	100.0
cd01031		402	EriC ClC chloride channel EriC. This domain is fou	100.0
PRK01610		418	putative voltage-gated ClC-type chloride channel C	100.0
COG0038		443	EriC Chloride channel protein EriC [Inorganic ion	100.0
PF00654		355	Voltage_CLC: Voltage gated chloride channel Mutati	100.0
cd01034		390	EriC_like ClC chloride channel family. These prote	100.0
PRK05277		438	chloride channel protein; Provisional	100.0
cd01033		388	ClC_like Putative ClC chloride channel. Clc protei	100.0
cd00400		383	Voltage_gated_ClC CLC voltage-gated chloride chann	100.0
cd03682		378	ClC_sycA_like ClC sycA-like chloride channel prote	100.0
KOG0476\|consensus		931		100.0
PRK03655		414	putative ion channel protein; Provisional	100.0
KOG0474\|consensus		762		99.96
cd03684		445	ClC_3_like ClC-3-like chloride channel proteins. T	99.91
cd03685		466	ClC_6_like ClC-6-like chloride channel proteins. T	99.87
cd01036		416	ClC_euk Chloride channel, ClC. These domains are f	99.87
cd03683		426	ClC_1_like ClC-1-like chloride channel proteins. T	99.82
cd01031		402	EriC ClC chloride channel EriC. This domain is fou	99.79
PRK05277		438	chloride channel protein; Provisional	99.75
PRK01862		574	putative voltage-gated ClC-type chloride channel C	99.71
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	99.7
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	99.68
PRK11573		413	hypothetical protein; Provisional	99.64
COG1253		429	TlyC Hemolysins and related proteins containing CB	99.59
cd00400		383	Voltage_gated_ClC CLC voltage-gated chloride chann	99.56
PRK01610		418	putative voltage-gated ClC-type chloride channel C	99.54
PF00654		355	Voltage_CLC: Voltage gated chloride channel Mutati	99.5
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	99.46
COG0038		443	EriC Chloride channel protein EriC [Inorganic ion	99.44
cd03682		378	ClC_sycA_like ClC sycA-like chloride channel prote	99.36
COG2524		294	Predicted transcriptional regulator, contains C-te	99.33
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inor	99.32
COG4109		432	Predicted transcriptional regulator containing CBS	99.31
COG3448		382	CBS-domain-containing membrane protein [Signal tra	99.28
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	99.24
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	99.22
COG3620		187	Predicted transcriptional regulator with C-termina	99.17
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	99.1
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	99.09
cd01034		390	EriC_like ClC chloride channel family. These prote	99.08
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	99.05
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	99.05
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	99.05
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	99.04
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	99.04
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	99.04
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	99.03
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	99.0
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	99.0
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	98.99
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	98.99
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	98.98
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	98.98
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	98.97
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	98.95
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	98.95
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	98.95
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	98.94
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	98.94
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	98.93
PLN02274		505	inosine-5'-monophosphate dehydrogenase	98.92
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	98.92
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	98.91
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	98.91
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	98.91
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	98.91
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	98.9
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	98.9
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	98.9
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	98.9
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	98.89
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	98.89
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	98.89
cd01033		388	ClC_like Putative ClC chloride channel. Clc protei	98.88
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	98.87
PRK14869		546	putative manganese-dependent inorganic pyrophospha	98.87
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	98.87
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	98.86
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	98.86
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	98.86
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	98.85
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	98.85
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	98.85
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	98.85
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	98.85
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	98.83
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	98.83
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	98.82
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	98.82
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	98.82
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	98.82
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	98.81
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	98.81
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	98.81
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	98.81
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	98.81
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	98.81
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	98.81
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	98.8
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	98.8
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	98.8
COG2905		610	Predicted signal-transduction protein containing c	98.8
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	98.79
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	98.79
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	98.79
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	98.75
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	98.74
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	98.73
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	98.73
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	98.7
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	98.7
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	98.67
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	98.64
COG3448		382	CBS-domain-containing membrane protein [Signal tra	98.64
COG0517		117	FOG: CBS domain [General function prediction only]	98.61
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	98.61
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	98.56
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	98.17
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	98.08
COG2524		294	Predicted transcriptional regulator, contains C-te	98.06
PF00571		57	CBS: CBS domain CBS domain web page. Mutations in	97.95
COG2905		610	Predicted signal-transduction protein containing c	97.88
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS,	97.87
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	97.83
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tande	97.77
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	97.77
COG3620		187	Predicted transcriptional regulator with C-termina	97.74
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS,	97.72
PRK03655		414	putative ion channel protein; Provisional	97.7
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisiona	97.67
KOG1764\|consensus		381		97.59
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	97.58
TIGR01137		454	cysta_beta cystathionine beta-synthase. Members of	97.57
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two	97.56
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem rep	97.54
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS,	97.52
KOG2550\|consensus		503		97.51
TIGR00393		268	kpsF KpsF/GutQ family protein. This model describe	97.51
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS,	97.5
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS,	97.48
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two	97.48
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem re	97.47
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS,	97.46
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem re	97.45
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS,	97.45
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains tw	97.44
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS,	97.43
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two t	97.42
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS,	97.42
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS,	97.39
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS,	97.37
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains	97.36
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem re	97.36
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS,	97.36
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem re	97.34
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS,	97.34
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem rep	97.33
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	97.33
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tand	97.33
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS,	97.33
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS,	97.3
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS,	97.29
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS,	97.29
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains	97.28
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains	97.28
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem rep	97.27
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS,	97.27
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan	97.26
cd02205		113	CBS_pair The CBS domain, named after human CBS, is	97.21
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS,	97.21
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains	97.18
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	97.18
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS,	97.17
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	97.17
cd04801		114	CBS_pair_M50_like This cd contains two tandem repe	97.16
COG0517		117	FOG: CBS domain [General function prediction only]	97.16
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS,	97.15
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS,	97.13
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS,	97.06
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS,	97.05
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem r	97.05
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two	97.03
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	97.03
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tand	97.02
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two	97.02
PF03258		214	Baculo_FP: Baculovirus FP protein; InterPro: IPR00	97.01
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem r	97.0
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS,	96.99
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tand	96.98
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS,	96.96
TIGR00400		449	mgtE Mg2+ transporter (mgtE). This family of proka	96.94
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS,	96.94
TIGR03520		408	GldE gliding motility-associated protein GldE. Mem	96.86
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem	96.82
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	96.8
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS,	96.75
PRK15094		292	magnesium/cobalt efflux protein CorC; Provisional	96.71
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two t	96.7
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem r	96.67
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	96.65
PRK14869		546	putative manganese-dependent inorganic pyrophospha	96.64
cd04606		109	CBS_pair_Mg_transporter This cd contains two tande	96.62
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats	96.59
COG4109		432	Predicted transcriptional regulator containing CBS	96.58
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS,	96.56
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem r	96.56
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two t	96.55
PLN02274		505	inosine-5'-monophosphate dehydrogenase	96.53
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	96.5
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem	96.48
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repea	96.4
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS,	96.16
KOG1764\|consensus		381		96.1
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domai	95.84
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	95.53
smart00116		49	CBS Domain in cystathionine beta-synthase and othe	94.84
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	94.72
PRK11573		413	hypothetical protein; Provisional	93.81
COG1253		429	TlyC Hemolysins and related proteins containing CB	92.15
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	91.1
KOG2550\|consensus		503		89.87
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	88.53
PF02994		370	Transposase_22: L1 transposable element; InterPro:	88.27
KOG2118\|consensus		498		87.91
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inor	82.68
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	80.76

>KOG0475\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.9e-119  Score=1051.41  Aligned_cols=626  Identities=48%  Similarity=0.775  Sum_probs=561.8

Q ss_pred             hhheeeeeehhhHHhhhcccccccccccccccccccCCCCCCCcCCCCCCCccccCcccccccchhhhhhcccccccCCC
Q psy9748           7 LAGSVAGIIDIGSSWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQGERLKPLQQHQQHFYYDILNNYEDVNKP   86 (1359)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   86 (1359)
                      .+|..|+++|+.++|  |+|+|+|+.+||+|+++||.     .+++++.|+                             
T Consensus        64 ~ag~la~~~di~~~w--D~k~G~C~~~~~~n~~~CC~-----t~~~~~~c~-----------------------------  107 (696)
T KOG0475|consen   64 AAGFLAGLADILTSW--DLKEGYCTPNFWLNHEFCCS-----TFTEDDVCK-----------------------------  107 (696)
T ss_pred             HHHHhhHHHHhhcch--hhccCcccchhhhhhhhhee-----eeecCccch-----------------------------
Confidence            578899999999999  99999999999999999993     355677898                             


Q ss_pred             CcccccHHHHHHHhhhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCChHHHHHHHhccccccccCchhhh
Q psy9748          87 GGVLLQWLTWAEVMGSNKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEIKTILSGFIIRGYLGKWTLI  166 (1359)
Q Consensus        87 ~~~~~~W~~ws~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~a~~l~~~~~p~a~GsGIpeik~~l~g~~~~~~l~~~tl~  166 (1359)
                           +|..|.+.++......+.+.++|++|+.|++.|+.+++.+++.++|+|+||||||||++++|+.+++|++.||++
T Consensus       108 -----~~~~w~~~~~~~~~w~~~~~~~~l~y~~~al~fa~la~~lv~~~AP~A~gSGIpEIK~ilSGf~~~~~lg~~tl~  182 (696)
T KOG0475|consen  108 -----EWFFWCEHLGLDFSWTGHYIVSYLIYVLWALLFAFLAVSLVKVVAPYACGSGIPEIKTILSGFIIRGFLGKWTLL  182 (696)
T ss_pred             -----hhhhhHHHhccccCCCCcchHHHHHHHHHHHHHHHHHHHHhhheehhhhcCCCccceeeeccchhhhhhhHHHHh
Confidence                 699999988777666566779999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCCCCcchHHHHHHHHHHHHhhhcccCCCChhhHHHHHHhhHhhhhhhhcCCCccceeeeeeecccc
Q psy9748         167 IKSVGIMLAVSAGLSLGKEGPMVHIASCIGNILSYLFPKYGRNEAKKREILSAAAAAGVSVAFGAPIGGVLFSLEEVSFF  246 (1359)
Q Consensus       167 ~K~i~~~lav~sGls~GkEGP~vhiga~ig~~l~~~~~~~~~~~~~~r~ll~agaaAGvaa~FgaPigGvlFalE~l~~~  246 (1359)
                      +|+++++++++||+|+|||||+||+|+||||+++++|++|++|+.++||+++|++|||||++||||||||||++|+    
T Consensus       183 iKsVal~lsvaSGLSlGKEGP~VHiA~c~g~~~s~~f~~~~~~e~~~reilsAaaAaGvavaFgAPIGGVlFslEe----  258 (696)
T KOG0475|consen  183 IKSVALCLSVASGLSLGKEGPSVHIATCIGNIFSKIFPKYRLNEAKKREILSAAAAAGVAVAFGAPIGGVLFSLEE----  258 (696)
T ss_pred             hhhhhheeeeccccccCCCCCceeeeechhhhHhhhhhhhccchhHHHHHHHHHhhccchhhcCCccceeeeehhh----
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999    


Q ss_pred             cceeehhhhhhhhhhccccccccccccccccccccccccccccccccccccccccccccchhhhhHhhhhhhHhhhhhcc
Q psy9748         247 LFFRIFHLEMEGRRRRGRPRLRWVDMIHNDIEKEVSYYFPLKTLWRSFPFSIYIRSIPTKWMCDKFELAGSVAGIIDIGS  326 (1359)
Q Consensus       247 ~~~~~~~~~~~~~~~~Ar~~~r~~~G~~~~f~~~~s~~~~~~~~w~~f~~~i~~~~~~~~w~~~~~~~~~~iA~~i~i~~  326 (1359)
                                                        .+++||++++|++|+|                   ++.|+.++   
T Consensus       259 ----------------------------------v~~~fp~ktlw~sff~-------------------aLsAv~~L---  282 (696)
T KOG0475|consen  259 ----------------------------------VSYYFPLKTLWRSFFC-------------------ALSAVTAL---  282 (696)
T ss_pred             ----------------------------------hhhcCCccchHHHHHH-------------------HHHHHHHH---
Confidence                                              4688999999999999                   89999998   


Q ss_pred             ccccccccccCCcccccccccccCCCCCCcccCCCCCCCCCcccccccceeeccccccccCCCCCcccccchhhhhhhcc
Q psy9748         327 SWMSDLKYGLCPEAFWLNKEQCCWSSNETSFEDTGNCSQPKPLQQHQQHFHYDILNNYEDVNKPPGVLLQWLTWAEVMGS  406 (1359)
Q Consensus       327 ~wl~dlk~G~c~~~~~~~~~~cc~~~~~~~~~~~~~~~~~~~~~~~~~~f~v~~~~~~~~~~~~~~~~~~W~~w~~~~~~  406 (1359)
                            +                      .+|||++.        +.++|+|       +|+.|      |         
T Consensus       283 ------~----------------------~i~pf~~~--------~~vLf~V-------~Y~~~------W---------  304 (696)
T KOG0475|consen  283 ------R----------------------SINPFGNS--------RLVLFYV-------DYDRP------W---------  304 (696)
T ss_pred             ------e----------------------eecccCCC--------ceEEEEE-------eccCC------c---------
Confidence                  6                      68999988        8999999       89998      9         


Q ss_pred             CccccccchhHHHHHHHHHHHHHHHHHHHHHHhhhhhcccCCCccccCCCCCCCCCccccccccccchhhhhhhhhhccC
Q psy9748         407 NKEGFMAYTLEYVFFIAWALLFASLAAGLVRMFAPYACGSGIPEALTHPHSLHSDPLSVLTQDSMTVQDVETNYRERERG  486 (1359)
Q Consensus       407 ~~~~~~~~~~e~i~fil~gv~~~gl~g~l~~~~~~~~~g~Gi~eik~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~  486 (1359)
                             ++.|+++|+++|+ |||+.|.++.+.|.++                                  +++||....
T Consensus       305 -------~~~EL~pFi~LGi-fgGl~G~~~ir~n~~~----------------------------------~~~rK~~~l  342 (696)
T KOG0475|consen  305 -------SLFELLPFILLGI-FGGLWGAFFIRLNIRF----------------------------------CRFRKSSKL  342 (696)
T ss_pred             -------ccccchHHHHHHH-hhhHHHHHHHHHHHHH----------------------------------Hhccchhhc
Confidence                   9999999999999 9999999988877655                                  888888743


Q ss_pred             CCCCCccccCCCCCCCcccccccchhhhhhhcCCCcccccccccceeEEEeecccccchhhhhhhcccCCCcccCCCCCc
Q psy9748         487 GQKYPWALFPAGYSGPKFRCLGLDREKAEKEMGNGRTLSLSEDEGIIDITTSGTMNERHLAEQINISHGSGFLDSDEIPG  566 (1359)
Q Consensus       487 ~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~e~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~  566 (1359)
                       .+||+                                    +|  +++++++|+                         
T Consensus       343 -g~~pv------------------------------------~e--v~~vt~iTa-------------------------  358 (696)
T KOG0475|consen  343 -GKFPV------------------------------------LE--VVFVTLVTA-------------------------  358 (696)
T ss_pred             -cCCcc------------------------------------hh--HHHHHHHHH-------------------------
Confidence             55554                                    46  888888888                         


Q ss_pred             ccccccccchhhhhhhhhccccchhhhcccchhhHHhhhccccccchhhhhhhccccccccccccCCCcccccccccccc
Q psy9748         567 IGQYEDFHTIDWQRDLARDRMRHRYIVKRKQNSIIDLIKGAHDAWSGWLCVLLVGLVTDKFIGCCNFFECFAFSDYVINH  646 (1359)
Q Consensus       567 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~~~~~~~c~~~~~~~l~~~~~~~  646 (1359)
                      +++|                 +|||++. ++.+++++                  ||++     |++.++..+|+.    
T Consensus       359 iIs~-----------------~np~~r~-~~~e~i~~------------------Lf~~-----C~~~~s~~l~~~----  393 (696)
T KOG0475|consen  359 IISL-----------------FNPETRF-NMSELITI------------------LFNK-----CSPSSSTSLPET----  393 (696)
T ss_pred             HHHh-----------------cCHHHHh-hHHHHHHH------------------HHhh-----cCCcccccCccc----
Confidence            8888                 9999999 78888888                  9999     988766554432    


Q ss_pred             CCCCCCCCCCCCCCCchhHHHHHHHHHHHHHHHHHHhhcCCcccceeehHHHHHHHHHhHHHHHHhHHhhhhh-hhhhhh
Q psy9748         647 NATSTSNPTTSEAGPGVYTAVWLLMITLVLKLVLTVFTFGIKVPCGRLYLALFEQNKQGTYLSFYFIYFSVSL-VVIMFE  725 (1359)
Q Consensus       647 ~~~~~~~~~~~~~~~~~~~~~~~L~~~~v~K~~lt~~T~G~g~pgGif~PSL~iGA~~Gr~~g~~~~~~~~~~-~~~~~~  725 (1359)
                                     .+|.+.++|++++++|+++|++|||+++|+|+|+|||++||++||++|.+....+++- |.++  
T Consensus       394 ---------------~~~~~~~~L~~a~i~k~~~t~ftfGakvP~GifvPSmaiGA~aGr~vG~~~e~l~~~~~~~~f--  456 (696)
T KOG0475|consen  394 ---------------TVYSAAILLLLALILKIALTIFTFGAKVPAGIFVPSLAIGAIAGRAVGIIVEQLAQNPDFNLF--  456 (696)
T ss_pred             ---------------chHHHHHHHHHHHHHHHHHHHhhhhccCccceecchHHHHHHHHHHHHHHHHHHhcCCCcccc--
Confidence                           2578899999999999999999999999999999999999999999998776654321 2221  


Q ss_pred             ccCCccccCHHHHHHHHhhccccceechhHHHHHHHHHhcCCcchHHHHhHHHHHHHHHHhhccCCCcchhhhhccCCCC
Q psy9748         726 LTGGVRYIVPLMAAAMASKWHKKLKTLFRLSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIMLNAYPF  805 (1359)
Q Consensus       726 c~~~~~~i~pg~yAaaa~~a~l~gvtr~pls~vvi~~ElTG~~~~ilP~miav~is~~v~~~~~~~sIYd~~I~lng~Pf  805 (1359)
                         +..|++||+||+.|++|.|+|+||+|+|+|||||||||+++|++|+|+|+++||||+|.+++.+|||++|++|||||
T Consensus       457 ---g~~ci~Pg~Ya~vGaAA~LsGvtrltvtlVVImFELTG~l~~IlPlm~av~~SkwI~d~~gk~gIyda~I~~ng~P~  533 (696)
T KOG0475|consen  457 ---GLSCATPGAYALVGAAATLSGVTRLTVTLVVIMFELTGALNYILPLMLAVMISKWIGDGLGKTGIYDAHIELNGYPF  533 (696)
T ss_pred             ---chhhcCchHHHHHHHHHHhcCcceeeEEEEEEeeeccCcceeHHHHHHHHHHHHHHHhccccchHHHHHHHhcCCCC
Confidence               56899999999777777799999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhhhcccccccccccccCCC-CeEEEeCCCCCHHHHHHHHHhcCCCeEEEEEeCCCCeEEEEEEhHHHHHHHHhhhh
Q psy9748         806 LDSKEEFASTALASDVMQPKHSD-PLSVLTQDSMTVQDVETLLKETEHNGFPVVVSRESQYLVGFVLRRDLNLAIANAKR  884 (1359)
Q Consensus       806 Ld~k~e~l~~~~V~DVMt~~~~~-pLvviv~~~~TV~el~~lL~~~~~sgfPVVds~~d~~LVG~Isr~DLl~aL~~~~~  884 (1359)
                      ++.|++.. +....++|.+.+.+ ++.++.+.++|++|++.+|++++++|||||-++++++++|+|.|+||..++.++++
T Consensus       534 l~~k~e~~-~t~~~~v~~p~~~~~~L~~i~~~s~tl~~le~~~~~t~~sgfpvvl~~~sq~lvGfv~rr~l~~~i~~ar~  612 (696)
T KOG0475|consen  534 LDSKSEFS-STLAIPVMEPCRSESCLIVITQDSMTLEDLESLMEDTDFSGFPVVLSEDSQRLVGFVLRRNLFLAILNARK  612 (696)
T ss_pred             cccccccc-cchhhhhhchhcCchhheeccccceeHHHHHHHHhhcccCCceEEEccccceeEEEEchHHHHHHHhhhcc
Confidence            99988877 77789999998765 68888889999999999999999999999999899999999999999999998887


Q ss_pred             hccCCCCccceecccCCCCCCCCCCCCcccccccccccCCeEecCCCCHHHHHHHhhc----ceeEEEcCCCcEEEEEeH
Q psy9748         885 TLEGLRGDSIVRFVQNDTQPQPLPGAPPILRLDKILDMAPITITDQTPMETVCGHTFT----KQLLFPANAKRTLEGLRG  960 (1359)
Q Consensus       885 ~~~~~~~~s~v~F~~~~~~p~~~~~~~~~idL~~iMd~sPiTV~~~tpLeeVle~mFr----R~LpVVdegGrLvGIITr  960 (1359)
                      .++....++. +|.  +..|....+.++.++++++|+.+|++|.+++|++.+++ |||    |++.|+++| ++.|+||+
T Consensus       613 ~q~~~~~~~~-~f~--~~~~~~~~~~~~~~~lk~il~~tp~tv~d~tp~~~v~~-~F~~lg~~~~~v~~~G-~l~Giitk  687 (696)
T KOG0475|consen  613 IQSFIVTTSI-YFN--DPSPSAVAGIPSRLDLKDILDMTPFTVTDLTPMETVVD-LFRKLGLRQILVTKNG-ILLGIITK  687 (696)
T ss_pred             ccccceeccc-ccC--CCCccccCCCCCCcCceeeccCCcccccccCcHHHHHH-HHHhhCceEEEEccCC-eeEeeeeh
Confidence            7665554444 665  33444455667889999999999999999999999999 999    778888777 99999999


Q ss_pred             HHHHHHHh
Q psy9748         961 DSIVRFVQ  968 (1359)
Q Consensus       961 kDILr~l~  968 (1359)
                      ||++++.+
T Consensus       688 kd~l~~~r  695 (696)
T KOG0475|consen  688 KDCLRHTR  695 (696)
T ss_pred             HHHHHhhc
Confidence            99999864

>KOG0474\|consensus	Back alignment and domain information

>KOG0476\|consensus	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>cd03684 ClC_3_like ClC-3-like chloride channel proteins	Back alignment and domain information

>KOG0475\|consensus	Back alignment and domain information

>cd01036 ClC_euk Chloride channel, ClC	Back alignment and domain information

>cd03685 ClC_6_like ClC-6-like chloride channel proteins	Back alignment and domain information

>cd03683 ClC_1_like ClC-1-like chloride channel proteins	Back alignment and domain information

>cd01031 EriC ClC chloride channel EriC	Back alignment and domain information

>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease	Back alignment and domain information

>cd01034 EriC_like ClC chloride channel family	Back alignment and domain information

>PRK05277 chloride channel protein; Provisional	Back alignment and domain information

>cd01033 ClC_like Putative ClC chloride channel	Back alignment and domain information

>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel	Back alignment and domain information

>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins	Back alignment and domain information

>KOG0476\|consensus	Back alignment and domain information

>PRK03655 putative ion channel protein; Provisional	Back alignment and domain information

>KOG0474\|consensus	Back alignment and domain information

>cd03684 ClC_3_like ClC-3-like chloride channel proteins	Back alignment and domain information

>cd03685 ClC_6_like ClC-6-like chloride channel proteins	Back alignment and domain information

>cd01036 ClC_euk Chloride channel, ClC	Back alignment and domain information

>cd03683 ClC_1_like ClC-1-like chloride channel proteins	Back alignment and domain information

>cd01031 EriC ClC chloride channel EriC	Back alignment and domain information

>PRK05277 chloride channel protein; Provisional	Back alignment and domain information

>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel	Back alignment and domain information

>PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional	Back alignment and domain information

>PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd01034 EriC_like ClC chloride channel family	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd01033 ClC_like Putative ClC chloride channel	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>PF00571 CBS: CBS domain CBS domain web page	Back alignment and domain information

>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK10892 D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK03655 putative ion channel protein; Provisional	Back alignment and domain information

>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>KOG1764\|consensus	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>TIGR01137 cysta_beta cystathionine beta-synthase	Back alignment and domain information

>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>KOG2550\|consensus	Back alignment and domain information

>TIGR00393 kpsF KpsF/GutQ family protein	Back alignment and domain information

>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea	Back alignment and domain information

>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism	Back alignment and domain information

>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>COG0517 FOG: CBS domain [General function prediction only]	Back alignment and domain information

>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>PF03258 Baculo_FP: Baculovirus FP protein; InterPro: IPR004941 The function of the FP protein is not known	Back alignment and domain information

>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR00400 mgtE Mg2+ transporter (mgtE)	Back alignment and domain information

>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>TIGR03520 GldE gliding motility-associated protein GldE	Back alignment and domain information

>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>PRK15094 magnesium/cobalt efflux protein CorC; Provisional	Back alignment and domain information

>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria	Back alignment and domain information

>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>KOG1764\|consensus	Back alignment and domain information

>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>smart00116 CBS Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11573 hypothetical protein; Provisional	Back alignment and domain information

>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2550\|consensus	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition	Back alignment and domain information

>KOG2118\|consensus	Back alignment and domain information

>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1359
2j9l_A		185	Cytoplasmic Domain Of The Human Chloride Transporte		9e-32
2j9l_A		185	Cytoplasmic Domain Of The Human Chloride Transporte		4e-04
3org_A		632	Crystal Structure Of A Eukaryotic Clc Transporter L		2e-06
3org_A		632	Crystal Structure Of A Eukaryotic Clc Transporter L		2e-04
1kpl_A		473	Crystal Structure Of The Clc Chloride Channel From		3e-05

>pdb|2J9L|A Chain A, Cytoplasmic Domain Of The Human Chloride Transporter Clc-5 In Complex With Atp Length = 185