Psyllid ID: psy9769

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------

MESAAEGIEGRSCLLLRYASQNSLDESSQKQVQNNGTREKPPYRNVHHTSKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGEVNKLTLVRTPRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRAGLVFLHEKVYAVGGFNGSLRVYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDGRILGCVKEITDWGLIIELPNFLSASVHITEISDVYSDLLEKYSNGTIEEIPELSNLFSIGDLVVAKILECVTNNLGQKQIKASLNPHHVNEMYINTTLETGLVLPACVHSKEDHGYLLDVGVKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRSANRLSPSQVSLLNLVPGMKVIANICQQLPHGWKAKLKNTQFKAFISPEAMSTAYNAKYLTNKRVDLDCSVLYVCPRHFHVYLSCNEALLERQTGRPEFSVCISIVKKTIFEDSSVSGTEAVNQNCSRPSFKREKSSRNAELSTIGVGGYDGISRQCLSSVEMYSPERNTWEPVKDMLYKRSGAGVGVLDNILYAVGGHDGPLVRKSVEAYDPETQTWSGVPDMALCRRNAVLESVASTAEVNLGDEVSCVVKGISVRGVIAQVGYYKLKATCENEYVEGNKADIKVGDEVQAKNSIEVAFKSLYRIAQPLTSVKHTKPGRLVWGVLKEKMPGGVRVEFDGDISGVFPTSAMSQATRTLVYTRFVIDTVIVCQILKYEDGELLLTEADEKLHKFSY

cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEEccEEEEcEEEEEccccHHHHHHccccccccccEEEEccccHHHHHHHHccEEccEEEEcccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEccccccccEEEEEEcccccEEEcccccccccEEEEEEEcccEEEEccccccEEEEEcccccEEcccccHHccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEccccccccccEEEEEEccEEEEEEccccEEEEEcccccEEEEcccccccccEEEEEEccEEEEEccccccccEEEEccccccEEEEccccccccccEEEEEEccEEEEccccccccccEEEcccccccEEccccccccccccEEEEEcccccccccccccEEcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEHHHccccccccccccccccccccHHHHHHccccccccccccccccHHHHHHHHcccccccccHHHHccccccccccEEEEEEEEEEEEccccccEEEEEcccccccccccccccccccEEEEEccccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEccccccccccEEEEEEcccccEEEccccccccccEEEEEEccEEEEEEccccccEEccccccccccEEEEEccccccccccEEcccccccccccEEEEEccEEEEEccEEEcccccEEEEEEcccccEEEcccccccEEEEEEccEEEEEEccccccccEEEEEEEEEEEcEEEEEEEEEEccccEEccHHHHHHccccc

cccHHHHcccccccHEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccEccHHHHHHHcccHHHHHHHcccHHHHccEEEEccccHHHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccEEEEccEEEEEEcccccccccEEEEEcccccccEEEcccccccccEEEEEEccEEEEEEcccccEEEEcccccccEEccccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEEccccccccEEEEEEccEEEEEEccccEEEEccccccEEEEccccccccccEEEEEccEEEEEEccccccccccccccccccccccccccccEEEccccccccEEEEEEccccccccccccEEEEEEEEEEccccccEcHHHHHcccHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHcHHcccHHHHHccccccHccHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHEHcEEEEcccccccccccccccccEEEEEEccEEEEEEccccccccEEEEEEEcccccccEEccccccEEEEEEcccccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEccccccccccccccccccEEEEEccccccEEEEccccccccccEEEEEEcccEEEEEEccccccccccEEEEEccccccEEEccccccccEEEEEEcccccccccccccHcEEEEEEEEEEEEEEEEEEEEEcccccEEEEHHHHHHccccc

mesaaegiEGRSCLLLRYAsqnsldessqkqvqnngtrekppyrnvhhtsKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERivlkgvdpNALKLLIDYVYSCEIYVTEENVQMLlpaanllqltDVRDACCDflqcqlhptnclgiraFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLissdklmvsnEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEEtvfkndirCKDYLIEALKYHILVKKGevnkltlvrtprtkprqplrvpkvmlvvggqapkairsvecydfkTERWQSVAEMPTRRCRAGLVFLHEKVYAvggfngslrvydpstnewssappmearRSTLGVAVLNSLIYAVggfdgssglnsaevydpstekwnmiapmstrrssvgvgvlngclyaenldGRILGCVKEITDWgliielpnflsasvHITEISDVYSDLLEkysngtieeipelsnlfsIGDLVVAKILECVTNNlgqkqikaslnphhvneMYINTTLETGLvlpacvhskedhgylldvgvKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRsanrlspsqvsllnlvPGMKVIANICQqlphgwkaklkntqfkafispeamstAYNAKyltnkrvdldcsvlyvcprhfHVYLSCNEALLerqtgrpefsVCISIVKKTIfedssvsgteavnqncsrpsfkrekssrnaelstigvggydgisrqclssvemysperntwepvkdmlykrsgagvgvLDNILYavgghdgplvrksveaydpetqtwsgvpdmaLCRRNAVLESVAStaevnlgdevsCVVKGISVRGVIAQVGYYKLKATceneyvegnkadikvgdevqaKNSIEVAFKSLYRIaqpltsvkhtkpgrlvwgvlkekmpggvrvefdgdisgvfptsamsqaTRTLVYTRFVIDTVIVCQILKYEDGELLLTEADEKLHKFSY

mesaaegiegrSCLLLRYASQnsldessqkqvqnngtrekppyrnvHHTSKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEeetvfkndirCKDYLIEALKYHIlvkkgevnkltlvrtprtkprqplrvpkvmlvvggqapkairsvecydFKTERwqsvaemptRRCRAGLVFLHEKVYAVGGFNGSLRVYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGgfdgssglNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDGRILGCVKEITDWGLIIELPNFLSASVHITEISDVYSDLLEKYSNGTIEEIPELSNLFSIGDLVVAKILECVTNNLGQKQIKASLNPHHVNEMYINTTLETGLVLPACVHSKEDHGYLLDVGVKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRSANRLSPSQVSLLNLVPGMKVIANICQQLPHGWKAKLKNTQFKAFISPEAMSTAYNAKYLTNKRVDLDCSVLYVCPRHFHVYLSCNEALLERQTGRPEFSVCISIVKKTifedssvsgteavnqncsrpsfkrekssrnaelstigvggydgISRQCLSSVEMYSPERNTWEPVKDMLYKRSGAGVGVLDNILYAVGGHDGPLVRKSVEAYDPETqtwsgvpdmALCRRNAVLESVAstaevnlgdevscVVKGISVRGVIAQVGYYKLKATCENEYVEGNKADIKVGDEVQAKNSIEVAFKSLYRiaqpltsvkhtkpgrlvWGVLKEKMPGGVRVEFDGDISGVFPTSAMSQATRTLVYTRFVIDTVIVCQILKYEDGELLLTeadeklhkfsy

************CLLLR**********************************AFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGEVNKLTLVRTP******PLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRAGLVFLHEKVYAVGGFNGSLRVYD*****************TLGVAVLNSLIYAVGGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDGRILGCVKEITDWGLIIELPNFLSASVHITEISDVYSDLLEKYSNGTIEEIPELSNLFSIGDLVVAKILECVTNNLGQKQIKASLNPHHVNEMYINTTLETGLVLPACVHSKEDHGYLLDVGVKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRSANRLSPSQVSLLNLVPGMKVIANICQQLPHGWKAKLKNTQFKAFISPEAMSTAYNAKYLTNKRVDLDCSVLYVCPRHFHVYLSCNEALLERQTGRPEFSVCISIVKKTIFE*******************************TIGVGGYDGISRQCLSSVEMYSPERNTWEPVKDMLYKRSGAGVGVLDNILYAVGGHDGPLVRKSVEAYDPETQTWSGVPDMALCRRNAVLESVASTAEVNLGDEVSCVVKGISVRGVIAQVGYYKLKATCENEYVEGNKADIKVGDEVQAKNSIEVAFKSLYRIAQPLTSVKHTKPGRLVWGVLKEKMPGGVRVEFDGDISGVFPTSAMSQATRTLVYTRFVIDTVIVCQILKYEDGELLLT***********

*********************************************VHHTSKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKK*******LV**PRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRAGLVFLHEKVYAVGGFNGSLRVYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDGRILGCVKEITDWGLIIELPNFLSASVHITEISDVYSDLLEKYSNGTIEEIPELSNLFSIGDLVVAKILECVTNNLGQKQIKASLNPHHVNEMYINTTLETGLVLPACVHSKEDHGYLLDVGVKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRSA**LSPSQVSLLNLVPGMKVIANICQQLPHGWKAKLKNTQFKAFISPEAMSTAYNAKYLTNKRVDLDCSVLYVCPRHFHVYLSCNEALLERQTGRPEFSVCISIVKKTIFEDSSVSGTEAVNQNCSRPSFKREKSSRNAELSTIGVGGYDGISRQCLSSVEMYSPERNTWEPVKDMLYKRSGAGVGVLDNILYAVGGHDGPLVRKSVEAYDPETQTWSGVPDMALCRRNAVLESVASTAEVNLGDEVSCVVKGISVRGVIAQVGYYKLKATCENEYVEGNKADIKVGDEVQAKNSIEVAFKSLYRIAQPLTSVKHTKPGRLVWGVLKEKMPGGVRVEFDGDISGVFPTSAMSQATRTLVYTRFVIDTVIVCQILKYEDGELLLTEADE*LH****

********EGRSCLLLRYASQN****************EKPPYRNVHHTSKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGEVNKLTLVRTPRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRAGLVFLHEKVYAVGGFNGSLRVYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDGRILGCVKEITDWGLIIELPNFLSASVHITEISDVYSDLLEKYSNGTIEEIPELSNLFSIGDLVVAKILECVTNNLGQKQIKASLNPHHVNEMYINTTLETGLVLPACVHSKEDHGYLLDVGVKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRSANRLSPSQVSLLNLVPGMKVIANICQQLPHGWKAKLKNTQFKAFISPEAMSTAYNAKYLTNKRVDLDCSVLYVCPRHFHVYLSCNEALLERQTGRPEFSVCISIVKKTIFEDS**************************ELSTIGVGGYDGISRQCLSSVEMYSPERNTWEPVKDMLYKRSGAGVGVLDNILYAVGGHDGPLVRKSVEAYDPETQTWSGVPDMALCRRNAVLESVASTAEVNLGDEVSCVVKGISVRGVIAQVGYYKLKATCENEYVEGNKADIKVGDEVQAKNSIEVAFKSLYRIAQPLTSVKHTKPGRLVWGVLKEKMPGGVRVEFDGDISGVFPTSAMSQATRTLVYTRFVIDTVIVCQILKYEDGELLLTEADEKLHKFSY

************CL***************************PYRNVHHTSKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGEVNKLTLVRTPRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRAGLVFLHEKVYAVGGFNGSLRVYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDGRILGCVKEITDWGLIIELPNFLSASVHITEISDVYSDLLEKYSNGTIEEIPELSNLFSIGDLVVAKILECVTNNLGQKQIKASLNPHHVNEMYINTTLETGLVLPACVHSKEDHGYLLDVGVKNTRAFIKYDSVILGQIVTCMISKIKVAASMSILEVTLDEELIRSANRLSPSQVSLLNLVPGMKVIANICQQLPHGWKAKLKNTQFKAFISPEAMSTAYNAKYLTNKRVDLDCSVLYVCPRHFHVYLSCNEALLERQTGRPEFSVCISIVKKTIFEDSSVSGTEAVNQNCSRPSFKREKSSRNAELSTIGVGGYDGISRQCLSSVEMYSPERNTWEPVKDMLYKRSGAGVGVLDNILYAVGGHDGPLVRKSVEAYDPETQTWSGVPDMALCRRNAVLESVASTAEVNLGDEVSCVVKGISVRGVIAQVGYYKLKATCENEYVEGNKADIKVGDEVQAKNSIEVAFKSLYRIAQPLTSVKHTKPGRLVWGVLKEKMPGGVRVEFDGDISGVFPTSAMSQATRTLVYTRFVIDTVIVCQILKYEDGELLLTEADEKLHKFS*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1026	2.2.26 [Sep-21-2011]
Q70JS2		1499	Ring canal kelch homolog	N/A	N/A	0.463	0.317	0.643	0.0
Q04652		1477	Ring canal kelch protein	yes	N/A	0.448	0.311	0.598	1e-167
F1MBP6		587	Kelch-like protein 3 OS=B	yes	N/A	0.438	0.766	0.587	1e-155
Q9UH77		587	Kelch-like protein 3 OS=H	yes	N/A	0.438	0.766	0.587	1e-155
E0CZ16		587	Kelch-like protein 3 OS=M	yes	N/A	0.417	0.729	0.610	1e-154
Q5REP9		587	Kelch-like protein 3 OS=P	yes	N/A	0.438	0.766	0.587	1e-154
F1LZ52		588	Kelch-like protein 3 OS=R	yes	N/A	0.417	0.727	0.609	1e-153
O95198		593	Kelch-like protein 2 OS=H	no	N/A	0.433	0.750	0.578	1e-149
Q8JZP3		593	Kelch-like protein 2 OS=M	no	N/A	0.432	0.748	0.577	1e-148
E7F6F9		601	Kelch-like protein 3 OS=D	yes	N/A	0.432	0.738	0.569	1e-147

>sp\|Q70JS2\|KELC_ANOST Ring canal kelch homolog OS=Anopheles stephensi GN=kel PE=2 SV=2	Back alignment and function desciption

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/496 (64%), Positives = 395/496 (79%), Gaps = 20/496 (4%)

Query: 3   SAAEG-IEGRSCLLLRYASQNSLDESSQKQVQNNGTREKP--PYRNVHHTSKAFETMNIM 59
           SAAEG +E  SC+L+RYASQNSLDESSQKQ+  +  +EK    YRN  HT ++FE MN+M
Sbjct: 34  SAAEGTMERGSCILVRYASQNSLDESSQKQLPRSNGKEKTTGAYRNNIHTQRSFEAMNMM 93

Query: 60  RKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLL 119
           R+QNLLCDV L+A+G+E+ AHKMVLA+CSPYF+AMF  FEES+Q+RI L+GVDP AL+LL
Sbjct: 94  REQNLLCDVVLVAEGIEIPAHKMVLASCSPYFYAMFTGFEESRQDRITLQGVDPRALQLL 153

Query: 120 IDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSC 179
           I+YVY   + VTE+NVQ+LL AANLLQLTDVRDACCD+LQ QL P+NCLGIR FAD+H C
Sbjct: 154 IEYVYRAVVEVTEDNVQILLTAANLLQLTDVRDACCDYLQTQLDPSNCLGIRDFADIHGC 213

Query: 180 LDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYD 239
           +DLL+ AE YIE HF+E+V+ +EFL+L+ +QV  LI SD+L V  EEKV+ECVI W+ YD
Sbjct: 214 IDLLNYAETYIEQHFSEVVQFDEFLNLTSDQVAHLIKSDRLSVPTEEKVYECVITWIQYD 273

Query: 240 LESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGEV 299
           +  RQ H+AELME+VRLPLLS+DYL+Q VE+E + K D++CKDY+IEALKYH+L  KGE 
Sbjct: 274 VNGRQHHLAELMEHVRLPLLSQDYLVQYVEKEQLMKGDLQCKDYIIEALKYHLL--KGE- 330

Query: 300 NKLTLVRTPRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRA 359
            + T  +TPRT PRQP+ +PKV+LV+GGQAPKAIRSVECYD + E+W  VAEMPTRRCRA
Sbjct: 331 -QKTCFKTPRTIPRQPVGLPKVLLVIGGQAPKAIRSVECYDLREEKWYQVAEMPTRRCRA 389

Query: 360 GLVFLHEKVYAVGGFNGSLR-----VYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVG 414
           GL  L +KVYAVGGFNGSLR     VYDP  ++W+++  MEARRSTLGVAVLN+ IYAVG
Sbjct: 390 GLAVLGDKVYAVGGFNGSLRVKTVDVYDPVLDQWTTSHNMEARRSTLGVAVLNNCIYAVG 449

Query: 415 GFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYA-ENLDGRILGCVKEI 473
           GFDGS+GL+SAE++DP  ++W +IA MSTRRSSVGVGV+NG LYA    DG    C+  +
Sbjct: 450 GFDGSTGLSSAEMFDPKRQEWRLIASMSTRRSSVGVGVVNGLLYAVGGYDGASRQCLASV 509

Query: 474 ------TD-WGLIIEL 482
                 TD W  I E+
Sbjct: 510 ERYNPSTDTWTQIAEM 525

May play a role in organizing the actin cytoskeleton.
Anopheles stephensi (taxid: 30069)

>sp\|Q04652\|KELC_DROME Ring canal kelch protein OS=Drosophila melanogaster GN=kel PE=1 SV=4	Back alignment and function description

>sp\|F1MBP6\|KLHL3_BOVIN Kelch-like protein 3 OS=Bos taurus GN=KLHL3 PE=3 SV=3	Back alignment and function description

>sp\|Q9UH77\|KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens GN=KLHL3 PE=1 SV=2	Back alignment and function description

>sp\|E0CZ16\|KLHL3_MOUSE Kelch-like protein 3 OS=Mus musculus GN=Klhl3 PE=1 SV=2	Back alignment and function description

>sp\|Q5REP9\|KLHL3_PONAB Kelch-like protein 3 OS=Pongo abelii GN=KLHL3 PE=2 SV=1	Back alignment and function description

>sp\|F1LZ52\|KLHL3_RAT Kelch-like protein 3 OS=Rattus norvegicus GN=Klhl3 PE=2 SV=2	Back alignment and function description

>sp\|O95198\|KLHL2_HUMAN Kelch-like protein 2 OS=Homo sapiens GN=KLHL2 PE=1 SV=2	Back alignment and function description

>sp\|Q8JZP3\|KLHL2_MOUSE Kelch-like protein 2 OS=Mus musculus GN=Klhl2 PE=2 SV=1	Back alignment and function description

>sp\|E7F6F9\|KLHL3_DANRE Kelch-like protein 3 OS=Danio rerio GN=klhl3 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1026
91088037		791	PREDICTED: similar to zinc finger protei	0.446	0.579	0.709	0.0
270011882		606	hypothetical protein TcasGA2_TC005972 [T	0.446	0.755	0.709	0.0
383851109		621	PREDICTED: ring canal kelch homolog [Meg	0.452	0.747	0.699	0.0
328786566		621	PREDICTED: ring canal kelch homolog [Api	0.446	0.737	0.705	0.0
380017634		621	PREDICTED: ring canal kelch homolog [Api	0.446	0.737	0.705	0.0
350405535		621	PREDICTED: ring canal kelch homolog [Bom	0.446	0.737	0.701	0.0
340720329		621	PREDICTED: ring canal kelch homolog [Bom	0.446	0.737	0.701	0.0
307191291		622	Ring canal kelch-like protein [Camponotu	0.446	0.736	0.699	0.0
307199015		622	Ring canal kelch-like protein [Harpegnat	0.446	0.736	0.692	0.0
182628296		1499	RecName: Full=Ring canal kelch homolog;	0.463	0.317	0.643	0.0

>gi\|91088037\|ref\|XP_974425.1\| PREDICTED: similar to zinc finger protein, putative [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/468 (70%), Positives = 394/468 (84%), Gaps = 10/468 (2%)

Query: 12  SCLLLRYASQNSLDESSQKQVQNNGTREKPPYRNVHHTSKAFETMNIMRKQNLLCDVKLI 71
           SCLLLR  SQNSLDESSQKQ+  +G ++KPPYRN HHT +AF+ MN++RKQ LLCDV L+
Sbjct: 16  SCLLLRCDSQNSLDESSQKQLPRSGGKDKPPYRNYHHTQRAFDAMNLLRKQRLLCDVILV 75

Query: 72  ADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYVYSCEIYVT 131
           AD VE+ AHKMVLAACSPYF+AMF SFEESKQ+RIVL+ VD  AL++L++YVY+ E+ VT
Sbjct: 76  ADTVEIPAHKMVLAACSPYFYAMFTSFEESKQDRIVLQEVDHQALQILVEYVYTSEVQVT 135

Query: 132 EENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIE 191
           E+NVQ+LLPAANLLQLTDVRDACC+FLQ QLHPTNCLGIRAFADLH CL+LL+ AE+YIE
Sbjct: 136 EDNVQVLLPAANLLQLTDVRDACCEFLQVQLHPTNCLGIRAFADLHGCLELLAHAESYIE 195

Query: 192 LHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELM 251
            HF E+VECEEFL+LSH+QV  LI SD+L V +EE+VFECVIAWV +DL++R KH+A LM
Sbjct: 196 QHFIEVVECEEFLTLSHQQVSKLICSDRLTVPSEEQVFECVIAWVQHDLDARHKHLASLM 255

Query: 252 EYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGEVNKLTLVRTPRTK 311
           E+VRLPL+S++YL+QRVEEE + K D++CKDY+IEALKYH+L  KG+ NK T  RTPRTK
Sbjct: 256 EHVRLPLMSQEYLMQRVEEEPLLKADLQCKDYIIEALKYHLL--KGD-NKTTF-RTPRTK 311

Query: 312 PRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCRAGLVFLHEKVYAV 371
           PRQP+ +PKV+LVVGGQAPKAIRSVECYDFK E+W  VAEMPTRRCRAGL  LH KVYAV
Sbjct: 312 PRQPVGLPKVLLVVGGQAPKAIRSVECYDFKEEKWYQVAEMPTRRCRAGLAVLHGKVYAV 371

Query: 372 GGFNGSLR-----VYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGGFDGSSGLNSAE 426
           GGFNGSLR     VYD + ++W++   MEARRSTLGVAVL + IYAVGGFDGS+GLN+AE
Sbjct: 372 GGFNGSLRVRTVDVYDAALDQWNTCDHMEARRSTLGVAVLGNCIYAVGGFDGSTGLNTAE 431

Query: 427 VYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYA-ENLDGRILGCVKEI 473
           +YDP+T KW  IAPMSTRRSSVGVGVL G LYA    DG    C+  +
Sbjct: 432 MYDPTTAKWRSIAPMSTRRSSVGVGVLYGILYAVGGYDGASRQCLSSV 479

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270011882\|gb\|EFA08330.1\| hypothetical protein TcasGA2_TC005972 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|383851109\|ref\|XP_003701082.1\| PREDICTED: ring canal kelch homolog [Megachile rotundata]	Back alignment and taxonomy information

>gi\|328786566\|ref\|XP_393674.3\| PREDICTED: ring canal kelch homolog [Apis mellifera]	Back alignment and taxonomy information

>gi\|380017634\|ref\|XP_003692755.1\| PREDICTED: ring canal kelch homolog [Apis florea]	Back alignment and taxonomy information

>gi\|350405535\|ref\|XP_003487466.1\| PREDICTED: ring canal kelch homolog [Bombus impatiens]	Back alignment and taxonomy information

>gi\|340720329\|ref\|XP_003398593.1\| PREDICTED: ring canal kelch homolog [Bombus terrestris]	Back alignment and taxonomy information

>gi\|307191291\|gb\|EFN74938.1\| Ring canal kelch-like protein [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|307199015\|gb\|EFN79739.1\| Ring canal kelch-like protein [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|182628296\|sp\|Q70JS2.2\|KELC_ANOST RecName: Full=Ring canal kelch homolog; AltName: Full=Kelch-like protein 1; Contains: RecName: Full=Kelch short protein gi\|34787161\|emb\|CAE12056.1\| putative kelch-like protein 2 [Anopheles stephensi]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1026
FB\|FBgn0001301		1477	kel "kelch" [Drosophila melano	0.449	0.312	0.600	6.1e-185
UNIPROTKB\|F1MBP6		587	KLHL3 "Kelch-like protein 3" [	0.437	0.764	0.592	2.5e-173
UNIPROTKB\|F1NXJ5		582	KLHL3 "Uncharacterized protein	0.438	0.773	0.588	2.5e-173
UNIPROTKB\|F1RH95		582	KLHL3 "Uncharacterized protein	0.432	0.762	0.596	8.6e-173
UNIPROTKB\|Q9UH77		587	KLHL3 "Kelch-like protein 3" [	0.437	0.764	0.592	1.4e-172
UNIPROTKB\|F1PVX0		588	KLHL3 "Uncharacterized protein	0.438	0.765	0.592	2.9e-172
UNIPROTKB\|Q5REP9		587	KLHL3 "Kelch-like protein 3" [	0.437	0.764	0.592	6e-172
UNIPROTKB\|O95198		593	KLHL2 "Kelch-like protein 2" [	0.424	0.735	0.592	9.8e-172
MGI\|MGI:1924363		593	Klhl2 "kelch-like 2, Mayven" [	0.423	0.733	0.591	5.4e-171
RGD\|1565218		588	Klhl3 "kelch-like family membe	0.417	0.727	0.609	6.9e-171

FB\|FBgn0001301 kel "kelch" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1464 (520.4 bits), Expect = 6.1e-185, Sum P(3) = 6.1e-185
 Identities = 289/481 (60%), Positives = 368/481 (76%)

Query:     4 AAEG--IEGRSCLLLRYASQNSLDESSQKQVQNNGTREKPP---YRNVHHTSKAFETMNI 58
             AAEG  +E  SCLL RYASQNSLDESSQK VQ    +E+     Y N  HT+++F+ MN 
Sbjct:    91 AAEGSGLERGSCLL-RYASQNSLDESSQKHVQRPNGKERGTVGQYSNEQHTARSFDAMNE 149

Query:    59 MRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKL 118
             MRKQ  LCDV L+AD VE+ AH+MVLA+CSPYF+AMF SFEES+Q RI L+ VD  AL+L
Sbjct:   150 MRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTSFEESRQARITLQSVDARALEL 209

Query:   119 LIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHS 178
             LIDYVY+  + V E+NVQ+LL AANLLQLTDVRDACCDFLQ QL  +NCLGIR FAD+H+
Sbjct:   210 LIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHA 269

Query:   179 CLDLLSTAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNY 238
             C++LL+ AE YIE HF E+++ +EFL+LSHEQV+ LI +D++ V NEE+V+ECVIAW+ Y
Sbjct:   270 CVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRISVPNEERVYECVIAWLRY 329

Query:   239 DLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKNDIRCKDYLIEALKYHILVKKGE 298
             D+  R++  + LME+VRLP LS++Y+ QRV++E + + +I CK+ +IEAL YH+L     
Sbjct:   330 DVPMREQFTSLLMEHVRLPFLSKEYITQRVDKEILLEGNIVCKNLIIEALTYHLLP---- 385

Query:   299 VNKLTLVRTPRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRRCR 358
                 T  ++ RT PR+P+ +PK++LV+GGQAPKAIRSVE YD + E+W   AEMP RRCR
Sbjct:   386 ----TETKSARTVPRKPVGMPKILLVIGGQAPKAIRSVEWYDLREEKWYQAAEMPNRRCR 441

Query:   359 AGLVFLHEKVYAVGGFNGSLRV-----YDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAV 413
             +GL  L +KVYAVGGFNGSLRV     YDP+T++W++   MEARRSTLGVAVLN  IYAV
Sbjct:   442 SGLSVLGDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVLNGCIYAV 501

Query:   414 GGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAEN-LDGRILGCVKE 472
             GGFDG++GL+SAE+YDP T+ W  IA MSTRRSSVGVGV++G LYA    DG    C+  
Sbjct:   502 GGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLLYAVGGYDGFTRQCLSS 561

Query:   473 I 473
             +
Sbjct:   562 V 562

GO:0048477 "oogenesis" evidence=IMP

GO:0007297 "ovarian follicle cell migration" evidence=IMP

GO:0007301 "female germline ring canal formation" evidence=NAS;IMP;IDA

GO:0035324 "female germline ring canal" evidence=IDA

GO:0007300 "ovarian nurse cell to oocyte transport" evidence=IMP

GO:0035183 "female germline ring canal inner rim" evidence=TAS

GO:0045172 "germline ring canal" evidence=NAS;IDA;TAS

GO:0003779 "actin binding" evidence=ISS;NAS;IDA

GO:0005938 "cell cortex" evidence=NAS

GO:0007303 "cytoplasmic transport, nurse cell to oocyte" evidence=NAS

GO:0030717 "karyosome formation" evidence=IMP

GO:0030723 "ovarian fusome organization" evidence=IMP

GO:0030036 "actin cytoskeleton organization" evidence=IMP

GO:0007349 "cellularization" evidence=IMP

UNIPROTKB\|F1MBP6 KLHL3 "Kelch-like protein 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NXJ5 KLHL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RH95 KLHL3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9UH77 KLHL3 "Kelch-like protein 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PVX0 KLHL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5REP9 KLHL3 "Kelch-like protein 3" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

UNIPROTKB\|O95198 KLHL2 "Kelch-like protein 2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1924363 Klhl2 "kelch-like 2, Mayven" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1565218 Klhl3 "kelch-like family member 3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q5REP9	KLHL3_PONAB	No assigned EC number	0.5874	0.4385	0.7666	yes	N/A
E7F6F9	KLHL3_DANRE	No assigned EC number	0.5695	0.4327	0.7387	yes	N/A
F1MBP6	KLHL3_BOVIN	No assigned EC number	0.5874	0.4385	0.7666	yes	N/A
E0CZ16	KLHL3_MOUSE	No assigned EC number	0.6104	0.4171	0.7291	yes	N/A
F1LZ52	KLHL3_RAT	No assigned EC number	0.6090	0.4171	0.7278	yes	N/A
Q9UH77	KLHL3_HUMAN	No assigned EC number	0.5874	0.4385	0.7666	yes	N/A
Q04652	KELC_DROME	No assigned EC number	0.5983	0.4483	0.3114	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		1026
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	1e-44
pfam07707		101	pfam07707, BACK, BTB And C-terminal Kelch	3e-40
smart00875		101	smart00875, BACK, BTB And C-terminal Kelch	8e-36
pfam00651		101	pfam00651, BTB, BTB/POZ domain	1e-30
smart00225		97	smart00225, BTB, Broad-Complex, Tramtrack and Bric	8e-26
cd05693		100	cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs	4e-21
smart00612		47	smart00612, Kelch, Kelch domain	9e-17
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	4e-13
pfam01344		46	pfam01344, Kelch_1, Kelch motif	7e-13
PHA02713		557	PHA02713, PHA02713, hypothetical protein; Provisio	8e-13
smart00612		47	smart00612, Kelch, Kelch domain	1e-12
pfam01344		46	pfam01344, Kelch_1, Kelch motif	1e-12
cd05694		74	cd05694, S1_Rrp5_repeat_hs2_sc2, S1_Rrp5_repeat_hs	1e-12
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	9e-12
smart00612		47	smart00612, Kelch, Kelch domain	2e-11
PHA02790		480	PHA02790, PHA02790, Kelch-like protein; Provisiona	1e-10
smart00612		47	smart00612, Kelch, Kelch domain	3e-09
pfam01344		46	pfam01344, Kelch_1, Kelch motif	3e-09
smart00612		47	smart00612, Kelch, Kelch domain	3e-08
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	2e-07
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	3e-07
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	2e-06
pfam01344		46	pfam01344, Kelch_1, Kelch motif	7e-06
PHA02713		557	PHA02713, PHA02713, hypothetical protein; Provisio	8e-06
pfam13964		50	pfam13964, Kelch_6, Kelch motif	8e-06
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	1e-05
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	2e-05
TIGR03548		323	TIGR03548, mutarot_permut, cyclically-permuted mut	2e-05
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	3e-05
smart00316		72	smart00316, S1, Ribosomal protein S1-like RNA-bind	4e-05
pfam13964		50	pfam13964, Kelch_6, Kelch motif	9e-05
PHA02713		557	PHA02713, PHA02713, hypothetical protein; Provisio	1e-04
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	1e-04
PRK06299		565	PRK06299, rpsA, 30S ribosomal protein S1; Reviewed	1e-04
COG0539		541	COG0539, RpsA, Ribosomal protein S1 [Translation,	1e-04
pfam01344		46	pfam01344, Kelch_1, Kelch motif	2e-04
COG0539		541	COG0539, RpsA, Ribosomal protein S1 [Translation,	3e-04
cd00164		65	cd00164, S1_like, S1_like: Ribosomal protein S1-li	3e-04
PRK14131		376	PRK14131, PRK14131, N-acetylneuraminic acid mutaro	4e-04
pfam07646		48	pfam07646, Kelch_2, Kelch motif	5e-04
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	6e-04
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	6e-04
cd05708		77	cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12:	0.001
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	0.002
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	0.002
smart00316		72	smart00316, S1, Ribosomal protein S1-like RNA-bind	0.002

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

 Score =  169 bits (431), Expect = 1e-44
 Identities = 98/409 (23%), Positives = 174/409 (42%), Gaps = 39/409 (9%)

Query: 66  CDVKLI--ADGVEVAAHKMVLAACSPYFHAMFISFEESKQERIVLKGVDPNALKLLIDYV 123
           CD  +I    G  +  HK++L++ S YF          K+  I L   D ++   +I Y+
Sbjct: 10  CDESIIIVNGGGIIKVHKIILSSSSEYF-KKMFK-NNFKENEINLNI-DYDSFNEVIKYI 66

Query: 124 YSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLL 183
           Y+ +I +T  NV+ +L  AN L +  + + C +++   +   NC+ I  F+  + C  L 
Sbjct: 67  YTGKINITSNNVKDILSIANYLIIDFLINLCINYIIKIIDDNNCIDIYRFSFFYGCKKLY 126

Query: 184 STAENYIELHFAEIVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESR 243
           S A NYI  +   I    +F+ LS  +++ ++S DKL VS+E+ V E +I W+     ++
Sbjct: 127 SAAYNYIRNNIELIYNDPDFIYLSKNELIKILSDDKLNVSSEDVVLEIIIKWLTSKKNNK 186

Query: 244 QKHVAELMEYVRLPLLSEDYLI-------QRVEEETVFKNDIRCKDYLIEALKYHILVKK 296
            K +  +++ +R+  LSE+ +        +  +++ VF                 I  KK
Sbjct: 187 YKDICLILKVLRITFLSEEGIKKLKRWKLRIKKKKIVFNKRCIK----------IIYSKK 236

Query: 297 GEVNKLTLVRTPRTKPRQPLRVPKVMLVVGGQAPKAIRSVECYDFKTERWQSVAEMPTRR 356
             +NK+    +               + +         +            ++ ++    
Sbjct: 237 YNLNKILPRSSTFGSI----------IYIHITMSIFTYNYITNYSPLSEINTIIDIHYVY 286

Query: 357 CRAGLVFLHEKVYAVGGFNGSLRV------YDPSTNEWSSAPPMEARRSTLGVAVLNSLI 410
           C  G V L+  +Y +GG N +         YD  T  W+  P +   R   GV V N+ I
Sbjct: 287 C-FGSVVLNNVIYFIGGMNKNNLSVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFNNRI 345

Query: 411 YAVGGFDGSSGLNSAEVYDPSTEKWNMIAPMSTRRSSVGVGVLNGCLYA 459
           Y +GG   S  LN+ E + P   KW    P+   R +  V  +N  +Y 
Sbjct: 346 YVIGGIYNSISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYV 394

Length = 534

>gnl\|CDD\|149006 pfam07707, BACK, BTB And C-terminal Kelch	Back alignment and domain information

>gnl\|CDD\|197943 smart00875, BACK, BTB And C-terminal Kelch	Back alignment and domain information

>gnl\|CDD\|216043 pfam00651, BTB, BTB/POZ domain	Back alignment and domain information

>gnl\|CDD\|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac	Back alignment and domain information

>gnl\|CDD\|240198 cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>gnl\|CDD\|128874 smart00612, Kelch, Kelch domain	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|165086 PHA02713, PHA02713, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|128874 smart00612, Kelch, Kelch domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|240199 cd05694, S1_Rrp5_repeat_hs2_sc2, S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|128874 smart00612, Kelch, Kelch domain	Back alignment and domain information

>gnl\|CDD\|165153 PHA02790, PHA02790, Kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|128874 smart00612, Kelch, Kelch domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|128874 smart00612, Kelch, Kelch domain	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|165086 PHA02713, PHA02713, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|165086 PHA02713, PHA02713, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>gnl\|CDD\|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

>gnl\|CDD\|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

>gnl\|CDD\|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1026
KOG4441\|consensus		571		100.0
PHA02713		557	hypothetical protein; Provisional	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
PHA02790		480	Kelch-like protein; Provisional	100.0
COG0539		541	RpsA Ribosomal protein S1 [Translation, ribosomal	100.0
COG0539		541	RpsA Ribosomal protein S1 [Translation, ribosomal	100.0
PRK12269		863	bifunctional cytidylate kinase/ribosomal protein S	100.0
PRK13806		491	rpsA 30S ribosomal protein S1; Provisional	100.0
TIGR00717		516	rpsA ribosomal protein S1. This model provides tru	100.0
PRK06299		565	rpsA 30S ribosomal protein S1; Reviewed	100.0
PRK12269		863	bifunctional cytidylate kinase/ribosomal protein S	100.0
PRK06299		565	rpsA 30S ribosomal protein S1; Reviewed	100.0
KOG4441\|consensus		571		100.0
PRK07899		486	rpsA 30S ribosomal protein S1; Reviewed	100.0
TIGR00717		516	rpsA ribosomal protein S1. This model provides tru	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
PRK06676		390	rpsA 30S ribosomal protein S1; Reviewed	100.0
KOG1070\|consensus		1710		100.0
PHA03098		534	kelch-like protein; Provisional	99.97
PRK00087		647	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	99.97
PLN02153		341	epithiospecifier protein	99.97
PLN02193		470	nitrile-specifier protein	99.97
KOG4350\|consensus		620		99.97
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	99.96
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	99.96
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	99.96
PRK13806		491	rpsA 30S ribosomal protein S1; Provisional	99.96
PLN02193		470	nitrile-specifier protein	99.96
PHA02790		480	Kelch-like protein; Provisional	99.95
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	99.95
KOG4693\|consensus		392		99.94
PLN02153		341	epithiospecifier protein	99.94
PRK07899		486	rpsA 30S ribosomal protein S1; Reviewed	99.93
PRK07400		318	30S ribosomal protein S1; Reviewed	99.93
KOG4693\|consensus		392		99.92
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	99.91
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	99.91
PRK06676		390	rpsA 30S ribosomal protein S1; Reviewed	99.89
KOG2075\|consensus		521		99.89
PRK07400		318	30S ribosomal protein S1; Reviewed	99.89
PRK00087		647	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	99.87
KOG1230\|consensus		521		99.85
KOG0379\|consensus		482		99.85
KOG1070\|consensus		1710		99.84
KOG4152\|consensus		830		99.81
KOG4682\|consensus		488		99.78
KOG0379\|consensus		482		99.77
KOG4152\|consensus		830		99.77
KOG4591\|consensus		280		99.75
KOG1230\|consensus		521		99.73
PF00651		111	BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (	99.7
COG1098		129	VacB Predicted RNA binding protein (contains ribos	99.6
PF07707		103	BACK: BTB And C-terminal Kelch; InterPro: IPR01170	99.55
cd05705		74	S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a	99.55
smart00225		90	BTB Broad-Complex, Tramtrack and Bric a brac. Doma	99.5
cd05703		73	S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R	99.47
cd04461		83	S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp	99.43
cd05694		74	S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp	99.43
KOG0783\|consensus		1267		99.43
cd05704		72	S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a	99.42
cd05696		71	S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t	99.42
smart00875		101	BACK BTB And C-terminal Kelch. The BACK domain is	99.4
cd05698		70	S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp	99.38
cd05707		68	S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a	99.38
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.38
cd05697		69	S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t	99.37
cd05695		66	S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t	99.35
cd05690		69	S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p	99.34
PF00575		74	S1: S1 RNA binding domain; InterPro: IPR003029 Rib	99.32
cd05706		73	S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a	99.31
PTZ00248		319	eukaryotic translation initiation factor 2 subunit	99.28
cd05686		73	S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom	99.27
PTZ00248		319	eukaryotic translation initiation factor 2 subunit	99.27
PRK08582		139	hypothetical protein; Provisional	99.25
cd05689		72	S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p	99.25
cd05691		73	S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p	99.24
PRK07252		120	hypothetical protein; Provisional	99.22
cd05693		100	S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp	99.2
cd04452		76	S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr	99.2
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.2
cd05687		70	S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib	99.18
cd05708		77	S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a	99.16
cd05685		68	S1_Tex S1_Tex: The C-terminal S1 domain of a trans	99.16
cd05702		70	S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R	99.15
cd05684		79	S1_DHX8_helicase S1_DHX8_helicase: The N-terminal	99.13
cd05692		69	S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p	99.12
PF13964		50	Kelch_6: Kelch motif	99.11
cd04465		67	S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib	99.1
PRK08059		123	general stress protein 13; Validated	99.09
PRK05807		136	hypothetical protein; Provisional	99.09
cd05688		68	S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p	99.07
cd04453		88	S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik	99.05
cd04472		68	S1_PNPase S1_PNPase: Polynucleotide phosphorylase	99.03
PHA02945		88	interferon resistance protein; Provisional	98.99
cd05789		86	S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain.	98.98
smart00316		72	S1 Ribosomal protein S1-like RNA-binding domain.	98.98
TIGR02696		719	pppGpp_PNP guanosine pentaphosphate synthetase I/p	98.95
cd05694		74	S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp	98.92
cd04471		83	S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai	98.92
PF13964		50	Kelch_6: Kelch motif	98.92
cd04454		82	S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-	98.92
KOG2437\|consensus		723		98.88
PLN00207		891	polyribonucleotide nucleotidyltransferase; Provisi	98.87
cd04473		77	S1_RecJ_like S1_RecJ_like: The S1 domain of the ar	98.87
cd00164		65	S1_like S1_like: Ribosomal protein S1-like RNA-bin	98.86
PRK03987		262	translation initiation factor IF-2 subunit alpha;	98.84
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.84
KOG2437\|consensus		723		98.83
COG1093		269	SUI2 Translation initiation factor 2, alpha subuni	98.83
cd04455		67	S1_NusA S1_NusA: N-utilizing substance A protein (	98.75
COG2183		780	Tex Transcriptional accessory protein [Transcripti	98.71
PRK11824		693	polynucleotide phosphorylase/polyadenylase; Provis	98.71
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.71
cd05695		66	S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t	98.69
cd05705		74	S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a	98.68
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.67
PRK09521		189	exosome complex RNA-binding protein Csl4; Provisio	98.66
TIGR03591		684	polynuc_phos polyribonucleotide nucleotidyltransfe	98.64
cd05703		73	S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R	98.6
PF00575		74	S1: S1 RNA binding domain; InterPro: IPR003029 Rib	98.58
smart00612		47	Kelch Kelch domain.	98.58
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.57
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.56
COG1098		129	VacB Predicted RNA binding protein (contains ribos	98.52
COG1185		692	Pnp Polyribonucleotide nucleotidyltransferase (pol	98.49
cd04460		99	S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain.	98.48
cd05693		100	S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp	98.48
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.47
cd05791		92	S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain.	98.46
cd05697		69	S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t	98.45
cd04461		83	S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp	98.43
cd04465		67	S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib	98.43
cd05698		70	S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp	98.42
PRK04163		235	exosome complex RNA-binding protein Rrp4; Provisio	98.4
cd05696		71	S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t	98.39
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.38
cd05706		73	S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a	98.37
smart00612		47	Kelch Kelch domain.	98.34
cd05707		68	S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a	98.32
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.32
KOG1067\|consensus		760		98.3
PRK09202		470	nusA transcription elongation factor NusA; Validat	98.27
PHA02945		88	interferon resistance protein; Provisional	98.25
KOG0783\|consensus		1267		98.23
COG2996		287	Predicted RNA-bindining protein (contains S1 and H	98.22
cd05704		72	S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a	98.22
PLN02772		398	guanylate kinase	98.22
TIGR02063		709	RNase_R ribonuclease R. This family consists of an	98.16
TIGR01953		341	NusA transcription termination factor NusA. This m	98.16
cd05687		70	S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib	98.14
TIGR00448		179	rpoE DNA-directed RNA polymerase (rpoE), archaeal	98.12
KOG0511\|consensus		516		98.11
cd05691		73	S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p	98.1
PRK07252		120	hypothetical protein; Provisional	98.09
cd04452		76	S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr	98.05
PF13854		42	Kelch_5: Kelch motif	98.05
PRK11642		813	exoribonuclease R; Provisional	98.05
COG1093		269	SUI2 Translation initiation factor 2, alpha subuni	98.03
cd05708		77	S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a	98.03
PLN02772		398	guanylate kinase	98.01
TIGR00358		654	3_prime_RNase VacB and RNase II family 3'-5' exori	97.99
cd04455		67	S1_NusA S1_NusA: N-utilizing substance A protein (	97.98
COG1095		183	RPB7 DNA-directed RNA polymerase, subunit E' [Tran	97.98
cd05690		69	S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p	97.95
PRK08582		139	hypothetical protein; Provisional	97.95
PHA02858		86	EIF2a-like PKR inhibitor; Provisional	97.91
PRK12327		362	nusA transcription elongation factor NusA; Provisi	97.9
smart00316		72	S1 Ribosomal protein S1-like RNA-binding domain.	97.88
cd05686		73	S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom	97.87
PRK08563		187	DNA-directed RNA polymerase subunit E'; Provisiona	97.87
PRK08059		123	general stress protein 13; Validated	97.83
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	97.82
cd05789		86	S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain.	97.81
cd05692		69	S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p	97.8
PRK05807		136	hypothetical protein; Provisional	97.8
cd05688		68	S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p	97.78
cd05699		72	S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t	97.76
PRK09202		470	nusA transcription elongation factor NusA; Validat	97.75
cd05689		72	S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p	97.74
cd05685		68	S1_Tex S1_Tex: The C-terminal S1 domain of a trans	97.72
cd04454		82	S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-	97.7
KOG2838\|consensus		401		97.7
PF13854		42	Kelch_5: Kelch motif	97.69
KOG2838\|consensus		401		97.69
COG2996		287	Predicted RNA-bindining protein (contains S1 and H	97.63
cd04462		88	S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly	97.58
PF10447		82	EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I	97.57
PRK03987		262	translation initiation factor IF-2 subunit alpha;	97.53
cd04472		68	S1_PNPase S1_PNPase: Polynucleotide phosphorylase	97.53
cd05702		70	S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R	97.49
cd05684		79	S1_DHX8_helicase S1_DHX8_helicase: The N-terminal	97.47
KOG2716\|consensus		230		97.45
PLN00207		891	polyribonucleotide nucleotidyltransferase; Provisi	97.45
PF02214		94	BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi	97.37
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	97.33
PRK12328		374	nusA transcription elongation factor NusA; Provisi	97.32
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	97.25
cd04453		88	S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik	97.25
cd00164		65	S1_like S1_like: Ribosomal protein S1-like RNA-bin	97.24
COG1096		188	Predicted RNA-binding protein (consists of S1 doma	97.24
cd04471		83	S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai	97.22
cd04473		77	S1_RecJ_like S1_RecJ_like: The S1 domain of the ar	97.19
PF03089		337	RAG2: Recombination activating protein 2; InterPro	97.17
TIGR00757		414	RNaseEG ribonuclease, Rne/Rng family. The C-termin	97.12
KOG2916\|consensus		304		97.12
PRK05054		644	exoribonuclease II; Provisional	97.12
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	97.05
PRK09521		189	exosome complex RNA-binding protein Csl4; Provisio	97.03
TIGR02696		719	pppGpp_PNP guanosine pentaphosphate synthetase I/p	97.02
KOG1856\|consensus		1299		96.96
cd05699		72	S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t	96.95
PTZ00162		176	DNA-directed RNA polymerase II subunit 7; Provisio	96.9
COG2183		780	Tex Transcriptional accessory protein [Transcripti	96.9
TIGR00448		179	rpoE DNA-directed RNA polymerase (rpoE), archaeal	96.89
KOG3473\|consensus		112		96.87
PRK12329		449	nusA transcription elongation factor NusA; Provisi	96.84
PF11822		317	DUF3342: Domain of unknown function (DUF3342); Int	96.77
PRK11824		693	polynucleotide phosphorylase/polyadenylase; Provis	96.7
cd05790		86	S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai	96.62
TIGR01953		341	NusA transcription termination factor NusA. This m	96.54
TIGR02062		639	RNase_B exoribonuclease II. This family consists o	96.52
COG1097		239	RRP4 RNA-binding protein Rrp4 and related proteins	96.52
KOG3409\|consensus		193		96.51
KOG1987\|consensus		297		96.51
COG1107		715	Archaea-specific RecJ-like exonuclease, contains D	96.47
PRK12327		362	nusA transcription elongation factor NusA; Provisi	96.4
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	96.39
cd04460		99	S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain.	96.37
PRK04163		235	exosome complex RNA-binding protein Rrp4; Provisio	96.1
COG0557		706	VacB Exoribonuclease R [Transcription]	96.04
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	95.99
smart00512		104	Skp1 Found in Skp1 protein family. Family of Skp1	95.98
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	95.97
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	95.89
PF13509		61	S1_2: S1 domain; PDB: 3GO5_A.	95.78
PRK08563		187	DNA-directed RNA polymerase subunit E'; Provisiona	95.73
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	95.67
TIGR03591		684	polynuc_phos polyribonucleotide nucleotidyltransfe	95.55
COG1095		183	RPB7 DNA-directed RNA polymerase, subunit E' [Tran	95.46
PF03089		337	RAG2: Recombination activating protein 2; InterPro	95.44
KOG1067\|consensus		760		95.35
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	94.72
PRK12328		374	nusA transcription elongation factor NusA; Provisi	94.6
KOG2714\|consensus		465		94.53
PRK11642		813	exoribonuclease R; Provisional	94.46
cd05791		92	S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain.	94.32
COG1185		692	Pnp Polyribonucleotide nucleotidyltransferase (pol	94.3
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	94.3
KOG1724\|consensus		162		94.1
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	94.1
PF03931		62	Skp1_POZ: Skp1 family, tetramerisation domain; Int	94.02
PF12768		281	Rax2: Cortical protein marker for cell polarity	93.85
PRK12329		449	nusA transcription elongation factor NusA; Provisi	93.81
TIGR02063		709	RNase_R ribonuclease R. This family consists of an	93.58
TIGR00358		654	3_prime_RNase VacB and RNase II family 3'-5' exori	93.21
COG1107		715	Archaea-specific RecJ-like exonuclease, contains D	93.19
KOG1665\|consensus		302		93.11
PHA02858		86	EIF2a-like PKR inhibitor; Provisional	93.05
cd04462		88	S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly	92.6
PF12768		281	Rax2: Cortical protein marker for cell polarity	92.5
PRK10811		1068	rne ribonuclease E; Reviewed	92.49
PRK13684		334	Ycf48-like protein; Provisional	91.83
PRK11712		489	ribonuclease G; Provisional	91.23
PF08292		122	RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I	91.21
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	91.2
PF13509		61	S1_2: S1 domain; PDB: 3GO5_A.	90.86
COG1096		188	Predicted RNA-binding protein (consists of S1 doma	90.76
KOG2715\|consensus		210		90.72
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	90.66
PTZ00162		176	DNA-directed RNA polymerase II subunit 7; Provisio	90.62
COG5201		158	SKP1 SCF ubiquitin ligase, SKP1 component [Posttra	90.29
KOG2055\|consensus		514		90.26
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	90.12
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	89.76
KOG0511\|consensus		516		89.38
PF07707		103	BACK: BTB And C-terminal Kelch; InterPro: IPR01170	89.14
KOG0310\|consensus		487		88.91
KOG1036\|consensus		323		88.87
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	87.8
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	87.21
cd05790		86	S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai	87.05
KOG3298\|consensus		170		86.79
PF10447		82	EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I	86.54
KOG1332\|consensus		299		86.13
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	85.83
PRK05054		644	exoribonuclease II; Provisional	85.54
COG1097		239	RRP4 RNA-binding protein Rrp4 and related proteins	85.52
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	85.37
PRK11028		330	6-phosphogluconolactonase; Provisional	85.12
KOG2055\|consensus		514		84.56
PTZ00421		493	coronin; Provisional	84.39
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	84.35
PF01466		78	Skp1: Skp1 family, dimerisation domain; InterPro:	84.11
KOG1856\|consensus		1299		83.96
KOG0316\|consensus		307		83.89
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	83.87
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	82.88
KOG2916\|consensus		304		82.65
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	81.95
PLN00033		398	photosystem II stability/assembly factor; Provisio	81.66
KOG0649\|consensus		325		81.64
PRK12442		87	translation initiation factor IF-1; Reviewed	81.41
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	80.73
KOG1036\|consensus		323		80.43
PRK04792		448	tolB translocation protein TolB; Provisional	80.35

>KOG4441\|consensus	Back alignment and domain information

Probab=100.00  E-value=3.2e-82  Score=739.65  Aligned_cols=442  Identities=49%  Similarity=0.877  Sum_probs=416.8

Q ss_pred             CCCCCccccCchHHHHHHHHHHHhcCCCccEEEEECCEEEEEEhhhhhccChhhHhhhc-CCccCcccEEEecCCCHHHH
Q psy9769          38 REKPPYRNVHHTSKAFETMNIMRKQNLLCDVKLIADGVEVAAHKMVLAACSPYFHAMFI-SFEESKQERIVLKGVDPNAL  116 (1026)
Q Consensus        38 ~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~i~v~~~~~~~Hr~vL~~~S~yF~~mf~-~~~e~~~~~i~l~~~~~~~f  116 (1026)
                      .....+.+..|+..+++.|+.|+..+.+|||++.+++++|+|||.|||++|+||++||+ +++|+.+.+|.+.++++.++
T Consensus         9 ~~~~~~~~~~h~~~~l~~l~~lr~~~~lcDv~L~v~~~~~~aHR~VLAa~S~YFraMFt~~l~e~~~~~i~l~~v~~~~l   88 (571)
T KOG4441|consen    9 NSTSEFTDPSHSKFLLQGLNELREEGLLCDVTLLVGDREFPAHRVVLAACSPYFRAMFTSGLKESKQKEINLEGVDPETL   88 (571)
T ss_pred             ccccccccHHHHHHHHHHHHHHHHhCCCceEEEEECCeeechHHHHHHhccHHHHHHhcCCcccccceEEEEecCCHHHH
Confidence            44457889999999999999999999999999999999999999999999999999999 99999999999999999999


Q ss_pred             HHHhhheecceeeechhhHHHHHHHHHhcCchhHHhHHHHhhhcccCCcchhhHHHhhhhcCchhHHHHHHhhhhhhhhh
Q psy9769         117 KLLIDYVYSCEIYVTEENVQMLLPAANLLQLTDVRDACCDFLQCQLHPTNCLGIRAFADLHSCLDLLSTAENYIELHFAE  196 (1026)
Q Consensus       117 ~~~l~~~Ytg~~~i~~~~v~~ll~~A~~l~l~~L~~~c~~~l~~~l~~~n~~~~~~~a~~~~~~~L~~~~~~~i~~~~~~  196 (1026)
                      +.+++|+||+++.|+.+|+.+||.+|++||++.+.++|.+||..+++++||+.+..+|+.|++.+|.+.+..|+.+||.+
T Consensus        89 ~~ll~y~Yt~~i~i~~~nVq~ll~aA~~lQi~~v~~~C~~fL~~~l~~~Nclgi~~~a~~~~~~~L~~~a~~~i~~~F~~  168 (571)
T KOG4441|consen   89 ELLLDYAYTGKLEISEDNVQELLEAASLLQIPEVVDACCEFLESQLDPSNCLGIRRFAELHSCTELLEVADEYILQHFAE  168 (571)
T ss_pred             HHHHHHhhcceEEechHhHHHHHHHHHHhhhHHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eecccccccCCHhhHhceeccccccccchhhHHHHHHHHHhcChhHHHHHHHHHHhhcccCCCCHHHHHhhccccceecc
Q psy9769         197 IVECEEFLSLSHEQVLGLISSDKLMVSNEEKVFECVIAWVNYDLESRQKHVAELMEYVRLPLLSEDYLIQRVEEETVFKN  276 (1026)
Q Consensus       197 l~~~~~f~~L~~~~l~~ll~~~~l~v~~E~~v~~av~~Wi~~~~~~r~~~~~~ll~~vr~~~l~~~~l~~~~~~~~l~~~  276 (1026)
                      +.++++|+.||.+.|..+|+++.|++.+|.+||+++++|++++.+.|..++++++++||+++|++.+|.+.+...++++.
T Consensus       169 v~~~eefl~L~~~~l~~ll~~d~l~v~~E~~vf~a~~~Wv~~d~~~R~~~~~~ll~~vr~~ll~~~~l~~~v~~~~~~~~  248 (571)
T KOG4441|consen  169 VSKTEEFLLLSLEELIGLLSSDDLNVDSEEEVFEAAMRWVKHDFEEREEHLPALLEAVRLPLLPPQFLVEIVESEPLIKR  248 (571)
T ss_pred             HhccHHhhCCCHHHHHhhccccCCCcCCHHHHHHHHHHHHhcCHhhHHHHHHHHHHhcCccCCCHHHHHHHHhhhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccchhhHHHHhheeeeeeccccceeeeeccCCCCCCCCccCCcEEEEEcCCCC--CCCcEEEEEECCCCcEEEcCCCCc
Q psy9769         277 DIRCKDYLIEALKYHILVKKGEVNKLTLVRTPRTKPRQPLRVPKVMLVVGGQAP--KAIRSVECYDFKTERWQSVAEMPT  354 (1026)
Q Consensus       277 ~~~~~~~i~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~GG~~~--~~~~~~~~yd~~~~~W~~~~~~p~  354 (1026)
                      ...|.+++.+|+.||+.   +..+  ..++.|++++|.  ...+.||++||..+  ...+.+++|||.++.|..+++||.
T Consensus       249 ~~~c~~~l~ea~~~~~~---~~~~--~~~~~~~t~~r~--~~~~~l~~vGG~~~~~~~~~~ve~yd~~~~~w~~~a~m~~  321 (571)
T KOG4441|consen  249 DSACRDLLDEAKKYHLL---PQRR--PVMQSPRTRPRR--SVSGKLVAVGGYNRQGQSLRSVECYDPKTNEWSSLAPMPS  321 (571)
T ss_pred             CHHHHHHHHHHHHHhhC---cccC--ccccCCCcccCc--CCCCeEEEECCCCCCCcccceeEEecCCcCcEeecCCCCc
Confidence            99999999999999987   2222  125677887775  45689999999874  678999999999999999999999


Q ss_pred             cccceeeEEECCEEEEEeccC-C-----CeEEEeCCCCeEEeCCCCcCCcceeEEEEECCEEEEEeccCCCCCCCEEEEE
Q psy9769         355 RRCRAGLVFLHEKVYAVGGFN-G-----SLRVYDPSTNEWSSAPPMEARRSTLGVAVLNSLIYAVGGFDGSSGLNSAEVY  428 (1026)
Q Consensus       355 ~r~~~~~~~~~~~iyv~GG~~-~-----~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~v~~y  428 (1026)
                      +|..+++++++|.||++||++ +     ++++||+.+++|+.+++|+.+|..+++++++|.||++||.++...++++|+|
T Consensus       322 ~r~~~~~~~~~~~lYv~GG~~~~~~~l~~ve~YD~~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l~svE~Y  401 (571)
T KOG4441|consen  322 PRCRVGVAVLNGKLYVVGGYDSGSDRLSSVERYDPRTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKSLNSVECY  401 (571)
T ss_pred             ccccccEEEECCEEEEEccccCCCcccceEEEecCCCCceeccCCccCccccceeEEECCEEEEEeccccccccccEEEe
Confidence            999999999999999999998 3     6899999999999999999999999999999999999999999999999999


Q ss_pred             ECCCCcEEEccCCCCCcceeEEEEECCEEEEEeCCC-------ceeeEEcCcccEEEeecCCCcc
Q psy9769         429 DPSTEKWNMIAPMSTRRSSVGVGVLNGCLYAENLDG-------RILGCVKEITDWGLIIELPNFL  486 (1026)
Q Consensus       429 d~~~~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~-------~~~~~~~~~~~W~~~~~lP~~~  486 (1026)
                      ||.+++|+.+++|+.+|++|++++++++||++||..       .+..||+.+++|+.+++|+..+
T Consensus       402 Dp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~~~~~~~l~sve~YDP~t~~W~~~~~M~~~R  466 (571)
T KOG4441|consen  402 DPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGGDGSSNCLNSVECYDPETNTWTLIAPMNTRR  466 (571)
T ss_pred             cCCCCcccccCCCCcceeeeEEEEECCEEEEEcCcCCCccccceEEEEcCCCCceeecCCccccc
Confidence            999999999999999999999999999999999943       2345788889999999997643

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional	Back alignment and domain information

>PRK13806 rpsA 30S ribosomal protein S1; Provisional	Back alignment and domain information

>TIGR00717 rpsA ribosomal protein S1	Back alignment and domain information

>PRK06299 rpsA 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional	Back alignment and domain information

>PRK06299 rpsA 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>KOG4441\|consensus	Back alignment and domain information

>PRK07899 rpsA 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>TIGR00717 rpsA ribosomal protein S1	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PRK06676 rpsA 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>KOG4350\|consensus	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>PRK13806 rpsA 30S ribosomal protein S1; Provisional	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>KOG4693\|consensus	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>PRK07899 rpsA 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>PRK07400 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>KOG4693\|consensus	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>PRK06676 rpsA 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>KOG2075\|consensus	Back alignment and domain information

>PRK07400 30S ribosomal protein S1; Reviewed	Back alignment and domain information

>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed	Back alignment and domain information

>KOG1230\|consensus	Back alignment and domain information

>KOG0379\|consensus	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>KOG4152\|consensus	Back alignment and domain information

>KOG4682\|consensus	Back alignment and domain information

>KOG0379\|consensus	Back alignment and domain information

>KOG4152\|consensus	Back alignment and domain information

>KOG4591\|consensus	Back alignment and domain information

>KOG1230\|consensus	Back alignment and domain information

>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins	Back alignment and domain information

>COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO)	Back alignment and domain information

>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac	Back alignment and domain information

>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains	Back alignment and domain information

>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>KOG0783\|consensus	Back alignment and domain information

>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>smart00875 BACK BTB And C-terminal Kelch	Back alignment and domain information

>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional	Back alignment and domain information

>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain	Back alignment and domain information

>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional	Back alignment and domain information

>PRK08582 hypothetical protein; Provisional	Back alignment and domain information

>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PRK07252 hypothetical protein; Provisional	Back alignment and domain information

>cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa	Back alignment and domain information

>cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide	Back alignment and domain information

>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PRK08059 general stress protein 13; Validated	Back alignment and domain information

>PRK05807 hypothetical protein; Provisional	Back alignment and domain information

>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain	Back alignment and domain information

>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain	Back alignment and domain information

>PHA02945 interferon resistance protein; Provisional	Back alignment and domain information

>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain	Back alignment and domain information

>smart00316 S1 Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase	Back alignment and domain information

>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain	Back alignment and domain information

>KOG2437\|consensus	Back alignment and domain information

>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional	Back alignment and domain information

>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease	Back alignment and domain information

>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

>PRK03987 translation initiation factor IF-2 subunit alpha; Validated	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>KOG2437\|consensus	Back alignment and domain information

>COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain	Back alignment and domain information

>COG2183 Tex Transcriptional accessory protein [Transcription]	Back alignment and domain information

>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PRK09521 exosome complex RNA-binding protein Csl4; Provisional	Back alignment and domain information

>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase	Back alignment and domain information

>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain	Back alignment and domain information

>cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain	Back alignment and domain information

>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains	Back alignment and domain information

>cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional	Back alignment and domain information

>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>KOG1067\|consensus	Back alignment and domain information

>PRK09202 nusA transcription elongation factor NusA; Validated	Back alignment and domain information

>PHA02945 interferon resistance protein; Provisional	Back alignment and domain information

>KOG0783\|consensus	Back alignment and domain information

>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]	Back alignment and domain information

>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>TIGR02063 RNase_R ribonuclease R	Back alignment and domain information

>TIGR01953 NusA transcription termination factor NusA	Back alignment and domain information

>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form	Back alignment and domain information

>KOG0511\|consensus	Back alignment and domain information

>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PRK07252 hypothetical protein; Provisional	Back alignment and domain information

>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>PRK11642 exoribonuclease R; Provisional	Back alignment and domain information

>COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases	Back alignment and domain information

>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain	Back alignment and domain information

>COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription]	Back alignment and domain information

>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PRK08582 hypothetical protein; Provisional	Back alignment and domain information

>PHA02858 EIF2a-like PKR inhibitor; Provisional	Back alignment and domain information

>PRK12327 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>smart00316 S1 Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain	Back alignment and domain information

>PRK08563 DNA-directed RNA polymerase subunit E'; Provisional	Back alignment and domain information

>PRK08059 general stress protein 13; Validated	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain	Back alignment and domain information

>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>PRK05807 hypothetical protein; Provisional	Back alignment and domain information

>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PRK09202 nusA transcription elongation factor NusA; Validated	Back alignment and domain information

>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain	Back alignment and domain information

>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa	Back alignment and domain information

>cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain	Back alignment and domain information

>KOG2838\|consensus	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>KOG2838\|consensus	Back alignment and domain information

>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only]	Back alignment and domain information

>cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain	Back alignment and domain information

>PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions []	Back alignment and domain information

>PRK03987 translation initiation factor IF-2 subunit alpha; Validated	Back alignment and domain information

>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain	Back alignment and domain information

>cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide	Back alignment and domain information

>KOG2716\|consensus	Back alignment and domain information

>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional	Back alignment and domain information

>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ]	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>PRK12328 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain	Back alignment and domain information

>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain	Back alignment and domain information

>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain	Back alignment and domain information

>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>TIGR00757 RNaseEG ribonuclease, Rne/Rng family	Back alignment and domain information

>KOG2916\|consensus	Back alignment and domain information

>PRK05054 exoribonuclease II; Provisional	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PRK09521 exosome complex RNA-binding protein Csl4; Provisional	Back alignment and domain information

>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase	Back alignment and domain information

>KOG1856\|consensus	Back alignment and domain information

>cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits	Back alignment and domain information

>PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional	Back alignment and domain information

>COG2183 Tex Transcriptional accessory protein [Transcription]	Back alignment and domain information

>TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form	Back alignment and domain information

>KOG3473\|consensus	Back alignment and domain information

>PRK12329 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised	Back alignment and domain information

>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional	Back alignment and domain information

>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain	Back alignment and domain information

>TIGR01953 NusA transcription termination factor NusA	Back alignment and domain information

>TIGR02062 RNase_B exoribonuclease II	Back alignment and domain information

>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG3409\|consensus	Back alignment and domain information

>KOG1987\|consensus	Back alignment and domain information

>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12327 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain	Back alignment and domain information

>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional	Back alignment and domain information

>COG0557 VacB Exoribonuclease R [Transcription]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>smart00512 Skp1 Found in Skp1 protein family	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF13509 S1_2: S1 domain; PDB: 3GO5_A	Back alignment and domain information

>PRK08563 DNA-directed RNA polymerase subunit E'; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase	Back alignment and domain information

>COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription]	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>KOG1067\|consensus	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PRK12328 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>KOG2714\|consensus	Back alignment and domain information

>PRK11642 exoribonuclease R; Provisional	Back alignment and domain information

>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain	Back alignment and domain information

>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG1724\|consensus	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex []	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PRK12329 nusA transcription elongation factor NusA; Provisional	Back alignment and domain information

>TIGR02063 RNase_R ribonuclease R	Back alignment and domain information

>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases	Back alignment and domain information

>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1665\|consensus	Back alignment and domain information

>PHA02858 EIF2a-like PKR inhibitor; Provisional	Back alignment and domain information

>cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PRK10811 rne ribonuclease E; Reviewed	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>PRK11712 ribonuclease G; Provisional	Back alignment and domain information

>PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PF13509 S1_2: S1 domain; PDB: 3GO5_A	Back alignment and domain information

>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2715\|consensus	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional	Back alignment and domain information

>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG0511\|consensus	Back alignment and domain information

>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO)	Back alignment and domain information

>KOG0310\|consensus	Back alignment and domain information

>KOG1036\|consensus	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain	Back alignment and domain information

>KOG3298\|consensus	Back alignment and domain information

>PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions []	Back alignment and domain information

>KOG1332\|consensus	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK05054 exoribonuclease II; Provisional	Back alignment and domain information

>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG2055\|consensus	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex []	Back alignment and domain information

>KOG1856\|consensus	Back alignment and domain information

>KOG0316\|consensus	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG2916\|consensus	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>PLN00033 photosystem II stability/assembly factor; Provisional	Back alignment and domain information

>KOG0649\|consensus	Back alignment and domain information

>PRK12442 translation initiation factor IF-1; Reviewed	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>KOG1036\|consensus	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

Homologous Structure Templates