Psyllid ID: psy9783
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 726 | ||||||
| 194750516 | 691 | GF10481 [Drosophila ananassae] gi|190624 | 0.792 | 0.832 | 0.454 | 1e-162 | |
| 195376273 | 697 | GJ12222 [Drosophila virilis] gi|19415407 | 0.801 | 0.835 | 0.445 | 1e-161 | |
| 170043874 | 644 | ubiquitin-activating enzyme E1 [Culex qu | 0.745 | 0.840 | 0.463 | 1e-160 | |
| 383862623 | 672 | PREDICTED: SUMO-activating enzyme subuni | 0.812 | 0.877 | 0.451 | 1e-160 | |
| 157126839 | 642 | ubiquitin-activating enzyme E1 [Aedes ae | 0.757 | 0.856 | 0.458 | 1e-159 | |
| 125980480 | 697 | GA20416 [Drosophila pseudoobscura pseudo | 0.793 | 0.826 | 0.444 | 1e-157 | |
| 195167753 | 687 | GL22481 [Drosophila persimilis] gi|19410 | 0.750 | 0.793 | 0.455 | 1e-156 | |
| 348503864 | 645 | PREDICTED: SUMO-activating enzyme subuni | 0.786 | 0.885 | 0.436 | 1e-145 | |
| 213512398 | 644 | SUMO-activating enzyme subunit 2 [Salmo | 0.768 | 0.866 | 0.436 | 1e-145 | |
| 4885649 | 640 | SUMO-activating enzyme subunit 2 [Homo s | 0.783 | 0.889 | 0.418 | 1e-144 |
| >gi|194750516|ref|XP_001957576.1| GF10481 [Drosophila ananassae] gi|190624858|gb|EDV40382.1| GF10481 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Score = 578 bits (1489), Expect = e-162, Method: Compositional matrix adjust.
Identities = 327/720 (45%), Positives = 412/720 (57%), Gaps = 145/720 (20%)
Query: 1 MATKIPGVFEKDLEDLIKKSKVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLN 60
MA I GVF L++L+KKSKVLVVGAGGIGCE+LKNLVLSGF++IEI+DLDTID+SNLN
Sbjct: 1 MAAAIDGVFPASLQELVKKSKVLVVGAGGIGCEVLKNLVLSGFTDIEIIDLDTIDLSNLN 60
Query: 61 RQFLFHKQHVGKSKAQVARNSALNFNPDANIYYQVDFHLNRQFLFHKQHVGKSKAQVARN 120
RQFLFH++HVGKSKA+VAR
Sbjct: 61 ----------------------------------------RQFLFHREHVGKSKARVARE 80
Query: 121 SALNFNPDANIVAHHTSIIRFLHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHH 180
SAL+FNPDA I A+H
Sbjct: 81 SALSFNPDAKITAYH--------------------------------------------- 95
Query: 181 TSIISADFGVNYFKQFTLVMNALDNRAARNHVNRMCLASEVPLIESGTAGYEGQVELIKK 240
S+ S D+GVN+FK+F +V++ALDNRAARNHVNRMCL ++VPL+ESGT+GY GQVELIK+
Sbjct: 96 DSVTSTDYGVNFFKKFDVVLSALDNRAARNHVNRMCLNADVPLVESGTSGYNGQVELIKR 155
Query: 241 GETKCYECDPKPAAKTYPGCTIRNTPSEPIHCIVWAKHLFNYLERLMLMKRCPLILKIQK 300
G T+CYEC PK A +++PGCTIRNTPSEPIHCIVWAKHLFN L
Sbjct: 156 GLTQCYECMPKEAQRSFPGCTIRNTPSEPIHCIVWAKHLFNQL----------------- 198
Query: 301 LLERLSAMNVIRSQLPKLIQAVQLGILRLNPFTVLSGLNICSSDAGAKAAASEATANGDV 360
SQ + I + + G + S+ K A A N V
Sbjct: 199 ---------FGESQEDEDI-SPDAADPDAKDASEKEGESTTVSNEKDKEAEDTANGN--V 246
Query: 361 VRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLVWDT-LSDAVAGS 419
VR +TR WA C YD KLF KFF+ DI YL+ MS+LWKTRKAP P+ WDT L + A
Sbjct: 247 VRINTRQWAKDCNYDAGKLFNKFFNEDINYLLQMSNLWKTRKAPVPVQWDTLLPEGAADG 306
Query: 420 SKETDGGGLKDQRVWSVAECARVFERSVRELKTKFDAAVEKDEHLVWDKDDKPAMDFVAA 479
KE + +VWSV ECA +F +++EL F +E D+ LVWDKDD+PAMDFVAA
Sbjct: 307 EKEF---AKQHHKVWSVEECAHIFANALKELSASF-LKLEGDDTLVWDKDDRPAMDFVAA 362
Query: 480 CANIRAHVFSIPEKSRFDIKSMAGNIIPAIATSNAIVAGLVVLHAIHVLQARFSSCQTVY 539
CAN+R+H+F+I +KSRF+IKSMAGNIIPAIAT+NAI AG+ V+ A +VL++++ C+ VY
Sbjct: 363 CANVRSHIFNIEQKSRFEIKSMAGNIIPAIATTNAITAGISVMRAFNVLESKWEQCKAVY 422
Query: 540 LRKKPNHRDQMIVPEKYLTAPNPTCPVCSPKPQRTIGLDVTKMTVAEFEEAVLKKTLNMS 599
R + N R+Q++VPE + PNP C VCS P + +D K+ + + + VL KTLNM
Sbjct: 423 TRLRLNARNQILVPELFFPKPNPNCYVCSSDPAIGLKIDTKKVNIKQLRDDVLVKTLNM- 481
Query: 600 AMVDVMVEASGSVIISSEEGETEANNDKPL--------------------EHGLIISHRV 639
DV VE++GS++ISSEEGETE N DK L E +IISH
Sbjct: 482 LNPDVTVESTGSILISSEEGETECNEDKLLADMNIVDGVILKCDDFFQNYELSIIISHFD 541
Query: 640 SARDGPEFEILDQKDLPQPPAPDAAASTTDAAEEKMETNGNGNG-----DVGTPDSKKRK 694
S RD FE++ QP D S E K+ + NG D G SKK +
Sbjct: 542 SERDEAVFEVVADPKQLQPKEQDKEESVAAPEETKVAKKRSANGNEVAADEGPSTSKKSR 601
|
Source: Drosophila ananassae Species: Drosophila ananassae Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195376273|ref|XP_002046921.1| GJ12222 [Drosophila virilis] gi|194154079|gb|EDW69263.1| GJ12222 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|170043874|ref|XP_001849594.1| ubiquitin-activating enzyme E1 [Culex quinquefasciatus] gi|167867157|gb|EDS30540.1| ubiquitin-activating enzyme E1 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|383862623|ref|XP_003706783.1| PREDICTED: SUMO-activating enzyme subunit 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|157126839|ref|XP_001660971.1| ubiquitin-activating enzyme E1 [Aedes aegypti] gi|108873125|gb|EAT37350.1| AAEL010641-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|125980480|ref|XP_001354264.1| GA20416 [Drosophila pseudoobscura pseudoobscura] gi|54642570|gb|EAL31317.1| GA20416 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195167753|ref|XP_002024697.1| GL22481 [Drosophila persimilis] gi|194108102|gb|EDW30145.1| GL22481 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|348503864|ref|XP_003439482.1| PREDICTED: SUMO-activating enzyme subunit 2-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|213512398|ref|NP_001135121.1| SUMO-activating enzyme subunit 2 [Salmo salar] gi|209155064|gb|ACI33764.1| SUMO-activating enzyme subunit 2 [Salmo salar] gi|209155780|gb|ACI34122.1| SUMO-activating enzyme subunit 2 [Salmo salar] | Back alignment and taxonomy information |
|---|
| >gi|4885649|ref|NP_005490.1| SUMO-activating enzyme subunit 2 [Homo sapiens] gi|114676623|ref|XP_524210.2| PREDICTED: SUMO-activating enzyme subunit 2 isoform 7 [Pan troglodytes] gi|42559898|sp|Q9UBT2.2|SAE2_HUMAN RecName: Full=SUMO-activating enzyme subunit 2; AltName: Full=Anthracycline-associated resistance ARX; AltName: Full=Ubiquitin-like 1-activating enzyme E1B gi|4580600|gb|AAD24434.1|AF110957_1 SUMO-1 activating enzyme subunit 2 [Homo sapiens] gi|4096672|gb|AAC99992.1| anthracycline-associated resistance ARX [Homo sapiens] gi|13111961|gb|AAH03153.1| Ubiquitin-like modifier activating enzyme 2 [Homo sapiens] gi|32879905|gb|AAP88783.1| SUMO-1 activating enzyme subunit 2 [Homo sapiens] gi|48145629|emb|CAG33037.1| UBA2 [Homo sapiens] gi|60655679|gb|AAX32403.1| SUMO-1 activating enzyme subunit 2 [synthetic construct] gi|60655681|gb|AAX32404.1| SUMO-1 activating enzyme subunit 2 [synthetic construct] gi|123993495|gb|ABM84349.1| SUMO-1 activating enzyme subunit 2 [synthetic construct] gi|157928524|gb|ABW03558.1| SUMO1 activating enzyme subunit 2 [synthetic construct] gi|410214834|gb|JAA04636.1| ubiquitin-like modifier activating enzyme 2 [Pan troglodytes] gi|410250740|gb|JAA13337.1| ubiquitin-like modifier activating enzyme 2 [Pan troglodytes] gi|410293022|gb|JAA25111.1| ubiquitin-like modifier activating enzyme 2 [Pan troglodytes] gi|410354247|gb|JAA43727.1| ubiquitin-like modifier activating enzyme 2 [Pan troglodytes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 726 | ||||||
| FB|FBgn0029113 | 700 | Uba2 "Smt3 activating enzyme 2 | 0.370 | 0.384 | 0.494 | 6.4e-132 | |
| UNIPROTKB|Q9UBT2 | 640 | UBA2 "SUMO-activating enzyme s | 0.392 | 0.445 | 0.434 | 1.3e-123 | |
| UNIPROTKB|A4FV12 | 640 | UBA2 "UBA2 protein" [Bos tauru | 0.392 | 0.445 | 0.434 | 5.7e-123 | |
| UNIPROTKB|E2R837 | 640 | UBA2 "Uncharacterized protein" | 0.392 | 0.445 | 0.431 | 3.1e-122 | |
| UNIPROTKB|Q642Q1 | 641 | uba2-a "SUMO-activating enzyme | 0.392 | 0.444 | 0.437 | 1.1e-121 | |
| UNIPROTKB|Q7ZY60 | 641 | uba2-b "SUMO-activating enzyme | 0.392 | 0.444 | 0.437 | 3.5e-121 | |
| UNIPROTKB|F1NV31 | 591 | UBA2 "Uncharacterized protein" | 0.194 | 0.238 | 0.758 | 9.3e-121 | |
| UNIPROTKB|Q28GH3 | 641 | uba2 "SUMO-activating enzyme s | 0.392 | 0.444 | 0.441 | 2.2e-120 | |
| ZFIN|ZDB-GENE-040426-2681 | 651 | uba2 "ubiquitin-like modifier | 0.391 | 0.436 | 0.442 | 3.2e-119 | |
| MGI|MGI:1858313 | 638 | Uba2 "ubiquitin-like modifier | 0.392 | 0.446 | 0.434 | 6.7e-119 |
| FB|FBgn0029113 Uba2 "Smt3 activating enzyme 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 681 (244.8 bits), Expect = 6.4e-132, Sum P(3) = 6.4e-132
Identities = 135/273 (49%), Positives = 175/273 (64%)
Query: 357 NGDVVRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLVWDTLSDAV 416
NG+++R +TR WA YD KLF KFF+ DI YL+ MS+LWKTRKAP P+ WDTL
Sbjct: 252 NGNIMRINTRQWAKDSNYDAGKLFNKFFNEDITYLLRMSNLWKTRKAPVPVQWDTLLPE- 310
Query: 417 AGSSKETDGGGLKDQRVWSVAECARVFERSVRELKTKFDAAVEKDEHLVWDKDDKPAMDF 476
GSS + + +VWS+ ECA+VF S++EL F +E D+ L WDKDD+PAMDF
Sbjct: 311 -GSSGDQKDVAKQHHKVWSIEECAQVFANSLKELSANF-LKLEGDDTLAWDKDDQPAMDF 368
Query: 477 VAACANIRAHVFSIPEKSRFDIKSMAGNIIPAIATSNAIVAGLVVLHAIHVLQARFSSCQ 536
VAACAN+R+H+F I KSRF+IKSMAGNIIPAIAT+NAI AG+ V+ A VL+A++ C+
Sbjct: 369 VAACANVRSHIFDIERKSRFEIKSMAGNIIPAIATTNAITAGISVMRAFKVLEAKWEQCK 428
Query: 537 TVYLRKKPNHRDQMIVPEKYLTAPNPTCPVCSPKPQRTIGLDVTKMTVAEFEEAVLKKTL 596
VY R +PN R+ +VP+ L PNP C VC+ P T+ +D +M + E + VL KTL
Sbjct: 429 AVYARLRPNARNHFLVPDASLPGPNPNCHVCASDPAITLKIDTKRMRIKELRDEVLVKTL 488
Query: 597 NMSAMVDVMXXXXXXXXXXXXXXXTEANNDKPL 629
NM DV TE N+ K L
Sbjct: 489 NM-LNPDVTVQSNGSILISSEEGETECNDGKLL 520
|
|
| UNIPROTKB|Q9UBT2 UBA2 "SUMO-activating enzyme subunit 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A4FV12 UBA2 "UBA2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R837 UBA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q642Q1 uba2-a "SUMO-activating enzyme subunit 2-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7ZY60 uba2-b "SUMO-activating enzyme subunit 2-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NV31 UBA2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28GH3 uba2 "SUMO-activating enzyme subunit 2" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2681 uba2 "ubiquitin-like modifier activating enzyme 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858313 Uba2 "ubiquitin-like modifier activating enzyme 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 726 | |||
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 1e-103 | |
| cd01489 | 312 | cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E | 2e-55 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 6e-55 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 4e-44 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 4e-37 | |
| pfam00899 | 134 | pfam00899, ThiF, ThiF family | 4e-31 | |
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 6e-29 | |
| cd00757 | 228 | cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | 1e-27 | |
| COG0476 | 254 | COG0476, ThiF, Dinucleotide-utilizing enzymes invo | 2e-27 | |
| pfam02134 | 66 | pfam02134, UBACT, Repeat in ubiquitin-activating ( | 8e-26 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 3e-23 | |
| pfam10585 | 44 | pfam10585, UBA_e1_thiolCys, Ubiquitin-activating e | 5e-20 | |
| cd01483 | 143 | cd01483, E1_enzyme_family, Superfamily of activati | 7e-16 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 1e-15 | |
| cd01490 | 435 | cd01490, Ube1_repeat2, Ubiquitin activating enzyme | 3e-15 | |
| cd01484 | 234 | cd01484, E1-2_like, Ubiquitin activating enzyme (E | 4e-15 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 3e-14 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 3e-14 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 5e-14 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 6e-14 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 6e-14 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 9e-14 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 3e-13 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 6e-13 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 1e-12 | |
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 3e-12 | |
| TIGR02356 | 202 | TIGR02356, adenyl_thiF, thiazole biosynthesis aden | 7e-12 | |
| cd01487 | 174 | cd01487, E1_ThiF_like, E1_ThiF_like | 2e-11 | |
| cd01485 | 198 | cd01485, E1-1_like, Ubiquitin activating enzyme (E | 4e-11 | |
| PRK05690 | 245 | PRK05690, PRK05690, molybdopterin biosynthesis pro | 1e-10 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 1e-10 | |
| TIGR02355 | 240 | TIGR02355, moeB, molybdopterin synthase sulfurylas | 2e-10 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 2e-10 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 1e-08 | |
| cd01493 | 425 | cd01493, APPBP1_RUB, Ubiquitin activating enzyme ( | 1e-08 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 2e-08 | |
| cd01491 | 286 | cd01491, Ube1_repeat1, Ubiquitin activating enzyme | 3e-08 | |
| PRK15116 | 268 | PRK15116, PRK15116, sulfur acceptor protein CsdL; | 3e-08 | |
| TIGR02354 | 200 | TIGR02354, thiF_fam2, thiamine biosynthesis protei | 7e-08 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 1e-07 | |
| PRK07688 | 339 | PRK07688, PRK07688, thiamine/molybdopterin biosynt | 3e-07 | |
| PRK08223 | 287 | PRK08223, PRK08223, hypothetical protein; Validate | 5e-07 | |
| PRK14851 | 679 | PRK14851, PRK14851, hypothetical protein; Provisio | 8e-07 | |
| TIGR01408 | 1008 | TIGR01408, Ube1, ubiquitin-activating enzyme E1 | 6e-06 | |
| cd01492 | 197 | cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E | 6e-06 | |
| cd01488 | 291 | cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 | 2e-05 | |
| PRK12475 | 338 | PRK12475, PRK12475, thiamine/molybdopterin biosynt | 3e-05 | |
| cd01486 | 307 | cd01486, Apg7, Apg7 is an E1-like protein, that ac | 3e-05 | |
| cd00755 | 231 | cd00755, YgdL_like, Family of activating enzymes ( | 6e-05 | |
| COG1179 | 263 | COG1179, COG1179, Dinucleotide-utilizing enzymes i | 8e-05 | |
| PRK14852 | 989 | PRK14852, PRK14852, hypothetical protein; Provisio | 8e-05 | |
| TIGR01381 | 664 | TIGR01381, E1_like_apg7, E1-like protein-activatin | 3e-04 | |
| PRK08644 | 212 | PRK08644, PRK08644, thiamine biosynthesis protein | 5e-04 | |
| PRK05600 | 370 | PRK05600, PRK05600, thiamine biosynthesis protein | 0.001 | |
| PRK08328 | 231 | PRK08328, PRK08328, hypothetical protein; Provisio | 0.001 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 0.002 | |
| PRK15116 | 268 | PRK15116, PRK15116, sulfur acceptor protein CsdL; | 0.004 | |
| TIGR03736 | 244 | TIGR03736, PRTRC_ThiF, PRTRC system ThiF family pr | 0.004 |
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
Score = 318 bits (817), Expect = e-103
Identities = 127/266 (47%), Positives = 151/266 (56%), Gaps = 85/266 (31%)
Query: 21 KVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLNRQFLFHKQHVGKSKAQVARN 80
KVLVVGAGGIGCELLKNLVL+GF I I+DLDTID+SNLNRQFL
Sbjct: 1 KVLVVGAGGIGCELLKNLVLTGFGEIHIIDLDTIDLSNLNRQFL---------------- 44
Query: 81 SALNFNPDANIYYQVDFHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSIIR 140
Sbjct: 44 ------------------------------------------------------------ 44
Query: 141 FLHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSIISADFGVNYFKQFTLVM 200
F K+HVGKSKAQVA+ + L+FNP+ IVA+H +I DF V +FKQF LV
Sbjct: 45 ---------FRKKHVGKSKAQVAKEAVLSFNPNVKIVAYHANIKDPDFNVEFFKQFDLVF 95
Query: 201 NALDNRAARNHVNRMCLASEVPLIESGTAGYEGQVELIKKGETKCYECDPKPAAKTYPGC 260
NALDN AAR HVN+MCLA++VPLIESGT G+ GQV++IKKG+T+CYEC PK KT+P C
Sbjct: 96 NALDNLAARRHVNKMCLAADVPLIESGTTGFLGQVQVIKKGKTECYECQPKETPKTFPVC 155
Query: 261 TIRNTPSEPIHCIVWAKHLFNYLERL 286
TIR+TPS+PIHCIVWAK LF ++
Sbjct: 156 TIRSTPSQPIHCIVWAKSLFFLFNKV 181
|
UBA2 is part of the heterodimeric activating enzyme (E1), specific for the SUMO family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. The E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by SUMO family of ubiquitin-like proteins (Ublps) is involved in cell division, nuclear transport, the stress response and signal transduction. UBA2 contains both the nucleotide-binding motif involved in adenylation and the catalytic cysteine involved in the thioester intermediate and Ublp transfer to E2. Length = 312 |
| >gnl|CDD|238766 cd01489, Uba2_SUMO, Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|216180 pfam00899, ThiF, ThiF family | Back alignment and domain information |
|---|
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|202124 pfam02134, UBACT, Repeat in ubiquitin-activating (UBA) protein | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|192635 pfam10585, UBA_e1_thiolCys, Ubiquitin-activating enzyme active site | Back alignment and domain information |
|---|
| >gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238767 cd01490, Ube1_repeat2, Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like | Back alignment and domain information |
|---|
| >gnl|CDD|238762 cd01485, E1-1_like, Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238770 cd01493, APPBP1_RUB, Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238768 cd01491, Ube1_repeat1, Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181302 PRK08223, PRK08223, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184853 PRK14851, PRK14851, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130475 TIGR01408, Ube1, ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >gnl|CDD|238769 cd01492, Aos1_SUMO, Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|238384 cd00755, YgdL_like, Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >gnl|CDD|224100 COG1179, COG1179, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233388 TIGR01381, E1_like_apg7, E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|169382 PRK08328, PRK08328, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|185071 PRK15116, PRK15116, sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163448 TIGR03736, PRTRC_ThiF, PRTRC system ThiF family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 726 | |||
| KOG2013|consensus | 603 | 100.0 | ||
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 100.0 | |
| KOG2012|consensus | 1013 | 100.0 | ||
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| cd01489 | 312 | Uba2_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| cd01484 | 234 | E1-2_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| cd01488 | 291 | Uba3_RUB Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| KOG2015|consensus | 422 | 100.0 | ||
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 100.0 | |
| PRK08223 | 287 | hypothetical protein; Validated | 100.0 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 100.0 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 100.0 | |
| PRK07411 | 390 | hypothetical protein; Validated | 100.0 | |
| cd01491 | 286 | Ube1_repeat1 Ubiquitin activating enzyme (E1), rep | 100.0 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 100.0 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 100.0 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 100.0 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 100.0 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 100.0 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 100.0 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 100.0 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 100.0 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 99.98 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.97 | |
| COG0476 | 254 | ThiF Dinucleotide-utilizing enzymes involved in mo | 99.97 | |
| PRK14851 | 679 | hypothetical protein; Provisional | 99.97 | |
| TIGR01381 | 664 | E1_like_apg7 E1-like protein-activating enzyme Gsa | 99.96 | |
| PRK14852 | 989 | hypothetical protein; Provisional | 99.96 | |
| cd01493 | 425 | APPBP1_RUB Ubiquitin activating enzyme (E1) subuni | 99.96 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 99.96 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 99.96 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 99.95 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 99.95 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 99.95 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 99.95 | |
| KOG2017|consensus | 427 | 99.95 | ||
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 99.95 | |
| PRK07877 | 722 | hypothetical protein; Provisional | 99.94 | |
| TIGR01408 | 1008 | Ube1 ubiquitin-activating enzyme E1. This model re | 99.94 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 99.94 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 99.93 | |
| COG1179 | 263 | Dinucleotide-utilizing enzymes involved in molybdo | 99.92 | |
| TIGR03603 | 318 | cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy | 99.92 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 99.9 | |
| PF02134 | 67 | UBACT: Repeat in ubiquitin-activating (UBA) protei | 99.88 | |
| KOG2336|consensus | 422 | 99.87 | ||
| KOG2014|consensus | 331 | 99.86 | ||
| PTZ00245 | 287 | ubiquitin activating enzyme; Provisional | 99.85 | |
| KOG2018|consensus | 430 | 99.8 | ||
| KOG2337|consensus | 669 | 99.79 | ||
| KOG2016|consensus | 523 | 99.79 | ||
| KOG2012|consensus | 1013 | 99.78 | ||
| PF10585 | 45 | UBA_e1_thiolCys: Ubiquitin-activating enzyme activ | 99.47 | |
| TIGR03693 | 637 | ocin_ThiF_like putative thiazole-containing bacter | 99.43 | |
| PF09358 | 125 | UBA_e1_C: Ubiquitin-activating enzyme e1 C-termina | 99.27 | |
| PF14732 | 87 | UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti | 98.76 | |
| TIGR03882 | 193 | cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr | 97.6 | |
| cd01490 | 435 | Ube1_repeat2 Ubiquitin activating enzyme (E1), rep | 97.28 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.2 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 97.05 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 96.94 | |
| COG4015 | 217 | Predicted dinucleotide-utilizing enzyme of the Thi | 96.65 | |
| PF08825 | 84 | E2_bind: E2 binding domain; InterPro: IPR014929 E1 | 96.55 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 96.48 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 96.42 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 96.08 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 95.99 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 95.93 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 95.48 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 95.19 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 94.92 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 94.72 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.22 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 94.12 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.8 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.61 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.59 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.57 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 93.35 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.33 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 93.21 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 92.99 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 92.72 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 92.71 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 92.65 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 92.57 | |
| KOG2013|consensus | 603 | 92.52 | ||
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 92.39 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 92.22 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 92.13 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 91.43 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 91.42 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 91.38 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 91.35 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 91.24 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 91.09 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 91.06 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 90.63 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 90.62 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 90.61 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 90.59 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 90.58 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 90.53 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 90.5 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 89.89 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 89.84 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 89.82 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 89.71 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 89.68 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 89.56 | |
| PF05237 | 84 | MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T | 89.46 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 89.42 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 89.22 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 89.12 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 89.1 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 89.02 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 88.98 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 88.85 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 88.79 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 88.73 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 88.7 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 88.63 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 88.46 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 88.35 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 88.14 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 88.11 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 87.97 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 87.89 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 87.88 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 87.71 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 87.49 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 87.48 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 87.41 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 87.41 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 87.24 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 87.15 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 86.85 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 86.78 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 86.75 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 86.73 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 86.71 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 86.66 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 86.58 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 86.53 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 86.52 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 86.51 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 86.25 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 85.93 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 85.86 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 85.78 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.57 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 85.55 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 85.5 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 85.48 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 85.46 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 85.41 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 85.39 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 85.31 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 85.23 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 85.14 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.09 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 85.05 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 85.05 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 84.81 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 84.81 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 84.78 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 84.68 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 84.58 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 84.56 | |
| PLN02928 | 347 | oxidoreductase family protein | 84.55 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 84.48 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 84.44 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.38 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 84.3 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 84.28 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 84.23 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 84.22 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 84.18 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 84.1 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 84.02 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 83.98 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 83.98 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 83.97 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 83.95 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 83.94 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 83.83 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 83.67 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 83.64 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 83.58 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 83.58 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 83.52 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.38 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 83.33 | |
| KOG2015|consensus | 422 | 83.22 | ||
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 83.18 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 83.09 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 83.05 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 82.97 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 82.95 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 82.89 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 82.86 | |
| PLN02602 | 350 | lactate dehydrogenase | 82.76 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 82.58 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 82.57 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 82.37 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 82.35 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 82.25 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 82.23 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 82.22 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 82.05 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 82.05 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 81.84 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 81.67 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 81.63 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 81.58 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 81.54 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 81.42 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 81.38 | |
| PLN00106 | 323 | malate dehydrogenase | 81.33 | |
| PLN02494 | 477 | adenosylhomocysteinase | 81.2 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 81.12 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 81.1 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 81.09 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 81.08 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 81.07 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 81.04 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 80.96 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 80.93 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 80.92 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 80.85 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 80.73 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 80.73 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 80.7 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 80.68 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 80.65 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 80.65 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 80.63 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 80.47 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 80.46 | |
| PRK02318 | 381 | mannitol-1-phosphate 5-dehydrogenase; Provisional | 80.42 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 80.32 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 80.32 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 80.25 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 80.2 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 80.13 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 80.11 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 80.07 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 80.05 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 80.04 |
| >KOG2013|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-115 Score=940.33 Aligned_cols=496 Identities=48% Similarity=0.770 Sum_probs=419.2
Q ss_pred CHHHHHHHhcCcEEEEcCchHHHHHHHHHHHhCCCeEEEEeCCccCccCCCcCCCCCCCccChhHHHHHHHHhhhcCCCC
Q psy9783 10 EKDLEDLIKKSKVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLNRQFLFHKQHVGKSKAQVARNSALNFNPDA 89 (726)
Q Consensus 10 g~~~q~kL~~~kVlvVGaGgiGceiaknLal~Gv~~i~iiD~D~Ie~sNLnRQfLf~~~dvGk~Ka~va~~~l~~~np~~ 89 (726)
..+.++++..+|||||||||||||++|+|+++||++|+|||+|||++|||||||||+++|||++||.+|+
T Consensus 3 ~~~~~eai~~~riLvVGaGGIGCELLKnLal~gf~~IhiIDlDTIDlSNLNRQFLFrkkhVgqsKA~vA~---------- 72 (603)
T KOG2013|consen 3 PREKHEAIKSGRILVVGAGGIGCELLKNLALTGFEEIHIIDLDTIDLSNLNRQFLFRKKHVGQSKATVAA---------- 72 (603)
T ss_pred hHHHHHHhccCeEEEEecCcccHHHHHHHHHhcCCeeEEEeccceeccchhhhheeehhhcCchHHHHHH----------
Confidence 3567888999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceeeeeccccchhhhhhccccCchhhhHhhccccCCCCCCeEeeecchhhhhhhhchhhhhhccccCcchhhhHHHHHHh
Q psy9783 90 NIYYQVDFHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSIIRFLHLNRQFLFHKQHVGKSKAQVARNSALN 169 (726)
Q Consensus 90 ~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~q~l~~~~hvg~sk~~~ak~~~~~ 169 (726)
+.++.
T Consensus 73 ---------------------------------------------------------------------------~~v~~ 77 (603)
T KOG2013|consen 73 ---------------------------------------------------------------------------KAVKQ 77 (603)
T ss_pred ---------------------------------------------------------------------------HHHHH
Confidence 67788
Q ss_pred hCCCCeEEEEecccccccccccccccccEEEEccCcHHHHHHHHHHhhhcCCcEEEEccCCccceEEEEeCCCCcceecC
Q psy9783 170 FNPDANIVAHHTSIISADFGVNYFKQFTLVMNALDNRAARNHVNRMCLASEVPLIESGTAGYEGQVELIKKGETKCYECD 249 (726)
Q Consensus 170 ~np~~~i~~~~~~i~~~~~~~~~~~~~DlVi~alDn~~aR~~in~~c~~~~iPlI~sg~~G~~G~v~~i~p~~t~cy~C~ 249 (726)
|||++++++||++|++..|+..||++||+|+|||||.+||+|+|++|+.+++|||++|+.||.|||+++++|.|+||+|.
T Consensus 78 Fnpn~~l~~yhanI~e~~fnv~ff~qfdiV~NaLDNlaAR~yVNr~C~~a~vPLIesGt~Gf~GQv~~ii~GkTECyeC~ 157 (603)
T KOG2013|consen 78 FNPNIKLVPYHANIKEPKFNVEFFRQFDIVLNALDNLAARRYVNRMCLAASVPLIESGTGGFLGQVQVIIKGKTECYECI 157 (603)
T ss_pred hCCCCceEeccccccCcchHHHHHHHHHHHHHhhccHHHHHHHHHHHHhhcCCceecCcccccceEEEEecCCcceeccc
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCCccccCCCCCcchhhhhHh-HHhHHHHHHHhhhcchhHHHHHHHHhhhhhhhhhcccchHHHHHHHhhhcc
Q psy9783 250 PKPAAKTYPGCTIRNTPSEPIHCIVWAK-HLFNYLERLMLMKRCPLILKIQKLLERLSAMNVIRSQLPKLIQAVQLGILR 328 (726)
Q Consensus 250 ~~~~~~~~p~Cti~~~p~~~~h~i~~a~-~lf~~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~G~~~ 328 (726)
+++.+++||+||||++|++|+|||+||| ++|++||+ +..++... .++ .
T Consensus 158 pK~~~kTypvCTIRstPS~~iHCIVWAK~~lF~qlF~-----------------~d~~~q~~----~~d----------~ 206 (603)
T KOG2013|consen 158 PKPVPKTYPVCTIRSTPSEPIHCIVWAKHYLFNQLFG-----------------EDDDDQYG----RHD----------N 206 (603)
T ss_pred CCCCCCcCCceEeecCCCCceeeeeehHhHHHHHHhc-----------------cccccccc----ccc----------c
Confidence 9999999999999999999999999999 69999999 33222111 111 2
Q ss_pred CCccccccccccccchhhhhHhhhhhhhcCCccccccccchhhcccchHHHHHHHhHHHHHHHHcCCcccCCCCCCCCcc
Q psy9783 329 LNPFTVLSGLNICSSDAGAKAAASEATANGDVVRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLV 408 (726)
Q Consensus 329 ~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~w~~~c~~~~~~~f~~~F~~~I~~Ll~~~~~w~~~~~P~pl~ 408 (726)
.+|+..+ ..+.+.......+++..-.+.....|.....+.+.++|.++|..||+||+.|..+|+.|++|.||.
T Consensus 207 ~d~d~~e-------~~t~~~~~~~~et~d~~Er~~~i~~~~~~~~~~~~~i~~klF~~dI~yl~~~e~~wk~r~~p~pl~ 279 (603)
T KOG2013|consen 207 ADPDNCE-------DMTEEEAEAFRETEDLKERRESIVEIDKNLDFGPFKIFNKLFIYDIEYLLGMEALWKPRSRPVPLS 279 (603)
T ss_pred cCchhhh-------ccChhhhhhhccchHHHHHHHHHHHHhhccCCChhhhhhHHHHHHHHHHHhhhhhccCCCCCCCcc
Confidence 2332211 000011111111222222222223454455667899999999999999999999999999999999
Q ss_pred cCCCc-hhh---cCCCcccCCCCCCcccccChHHHHHHHHHHHHHHHHHhhhhhccCCCccccCCChhhHHHHHHHHHHh
Q psy9783 409 WDTLS-DAV---AGSSKETDGGGLKDQRVWSVAECARVFERSVRELKTKFDAAVEKDEHLVWDKDDKPAMDFVAACANIR 484 (726)
Q Consensus 409 ~~~~~-~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~f~~s~~~L~~~l~~~~~~~~~l~FDKDDd~hmDFVtAAANLR 484 (726)
|.... ... .+.....-..++.+|.+|++.++..+|..++..|.-+.++ ....-.+.|||||...|+||+||||+|
T Consensus 280 ~~~~i~~~~~t~ns~~q~~~~a~~~~~~v~~v~~~~~vf~~~i~~l~~~~~~-~~~h~~l~fdKdd~~~~~FVaaaaNiR 358 (603)
T KOG2013|consen 280 IAEVISTSLETINSIVQSITSAQLNDQNVWTVDEGAVVFRLSIQALDLRCPK-ESDHWYLIFDKDDASTMEFVAAAANIR 358 (603)
T ss_pred hhhccCCccccccchhhhccccccCCcceeeeccccHHHHHHHHHhcccCCc-cCCCceEEEcCCcHHHHHHHHHHhhhh
Confidence 98752 111 1111111224567999999999999999999888655544 112233999999999999999999999
Q ss_pred HHhcCCCCCCHHHHHHhhcCCCcchhHHHHHHHHHHHHHHHHHHhhhhcccchhhhccCCCCCCccccccccCCCCCCCC
Q psy9783 485 AHVFSIPEKSRFDIKSMAGNIIPAIATSNAIVAGLVVLHAIHVLQARFSSCQTVYLRKKPNHRDQMIVPEKYLTAPNPTC 564 (726)
Q Consensus 485 A~nY~Ip~~s~~~vK~IAGnIIPAIATTnAIVAGLvvlEl~KlL~~k~e~~rn~flnl~pn~~~~~~vP~~~~~ePnp~C 564 (726)
|+.|+||++|.|++|.|||||||||||||||||||+|+|++|+|+|++..|+++|+..+||.|++.++| ..+.||||+|
T Consensus 359 a~if~ipmkS~Fdik~mAgnIipaIAtTNAiIagliv~eaiKvl~~~~~~~~~~f~~~~~n~r~r~l~~-~~~~~PNp~C 437 (603)
T KOG2013|consen 359 AHIFGIPMKSLFDIKQMAGNIIPAIATTNAIIAGLIVTEAIKVLGGDFDDCNMIFLAKRPNPRKRVLLP-WALRPPNPNC 437 (603)
T ss_pred hhhhccchhhhhchHhHhcccchhhhhhhhHHHHHHHHHHHHHhccchhcceeeEEccCCCccceeecc-cccCCCCCCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999999 8899999999
Q ss_pred CCCCCCCeEEEEEECCCCcHHHHHHHHHhcccCCccceeEEEecCCeEEEeccccccccccCCchhh-------hhhhcc
Q psy9783 565 PVCSPKPQRTIGLDVTKMTVAEFEEAVLKKTLNMSAMVDVMVEASGSVIISSEEGETEANNDKPLEH-------GLIISH 637 (726)
Q Consensus 565 ~vC~~~~~~tl~id~~~~TL~~lid~ilk~~l~m~~~pdV~~~~~G~ll~ss~e~e~~~nl~k~L~e-------lv~v~~ 637 (726)
+||+..+ .+++++.+++||..|+|.|+|.+|+| . |+|++... .| ++++ ++++|++|+|+| +|.+.|
T Consensus 438 ~vCs~~~-~~l~ln~~~~~~~~L~D~ivk~r~~~-~-pdvsll~~-~L-i~~~--d~e~n~~k~lsel~i~ngsli~~~~ 510 (603)
T KOG2013|consen 438 PVCSEVP-LVLELNTRKSTLRDLVDKIVKTRLGY-L-PDVSLLDD-DL-IDDM--DFEDNLDKTLSELGILNGSLINVKD 510 (603)
T ss_pred ccccccc-eEEEeccccchHHHHHHHHHHHHhcc-C-cccchhhh-hh-cccc--cchhhhhhhHHhhCCCCCceEeeec
Confidence 9999887 88999999999999999999999999 6 99988753 33 3333 899999999999 566666
|
|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >KOG2012|consensus | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 | Back alignment and domain information |
|---|
| >cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like | Back alignment and domain information |
|---|
| >cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 | Back alignment and domain information |
|---|
| >KOG2015|consensus | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p | Back alignment and domain information |
|---|
| >PRK14852 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >KOG2017|consensus | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK07877 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01408 Ube1 ubiquitin-activating enzyme E1 | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02134 UBACT: Repeat in ubiquitin-activating (UBA) protein; InterPro: IPR000127 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >KOG2336|consensus | Back alignment and domain information |
|---|
| >KOG2014|consensus | Back alignment and domain information |
|---|
| >PTZ00245 ubiquitin activating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG2018|consensus | Back alignment and domain information |
|---|
| >KOG2337|consensus | Back alignment and domain information |
|---|
| >KOG2016|consensus | Back alignment and domain information |
|---|
| >KOG2012|consensus | Back alignment and domain information |
|---|
| >PF10585 UBA_e1_thiolCys: Ubiquitin-activating enzyme active site ; InterPro: IPR019572 Ubiquitin-activating enzyme (E1 enzyme) activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein | Back alignment and domain information |
|---|
| >PF09358 UBA_e1_C: Ubiquitin-activating enzyme e1 C-terminal domain; InterPro: IPR018965 This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B | Back alignment and domain information |
|---|
| >TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain | Back alignment and domain information |
|---|
| >cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] | Back alignment and domain information |
|---|
| >PF08825 E2_bind: E2 binding domain; InterPro: IPR014929 E1 and E2 enzymes play a central role in ubiquitin and ubiquitin-like protein transfer cascades | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >KOG2013|consensus | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >KOG2015|consensus | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 726 | ||||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 5e-72 | ||
| 3kyc_B | 660 | Human Sumo E1 Complex With A Sumo1-Amp Mimic Length | 1e-63 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 2e-71 | ||
| 3kyd_B | 551 | Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mi | 2e-63 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 6e-71 | ||
| 1y8q_B | 640 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 1e-63 | ||
| 2px9_A | 217 | The Intrinsic Affinity Between E2 And The Cys Domai | 6e-34 | ||
| 4ii2_A | 1001 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 2e-33 | ||
| 2nvu_B | 805 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 1e-28 | ||
| 1yov_B | 444 | Insights Into The Ubiquitin Transfer Cascade From T | 2e-28 | ||
| 3gzn_B | 463 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 2e-28 | ||
| 1tt5_B | 434 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 2e-28 | ||
| 3dbr_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 1e-27 | ||
| 1r4m_B | 431 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 3e-27 | ||
| 3dbl_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 3e-27 | ||
| 3dbh_B | 434 | Structural Dissection Of A Gating Mechanism Prevent | 3e-27 | ||
| 3cmm_A | 1015 | Crystal Structure Of The Uba1-Ubiquitin Complex Len | 8e-25 | ||
| 3cmm_A | 1015 | Crystal Structure Of The Uba1-Ubiquitin Complex Len | 4e-06 | ||
| 1jwb_B | 249 | Structure Of The Covalent Acyl-Adenylate Form Of Th | 2e-11 | ||
| 1jwb_B | 249 | Structure Of The Covalent Acyl-Adenylate Form Of Th | 1e-07 | ||
| 1zud_1 | 251 | Structure Of This-Thif Protein Complex Length = 251 | 3e-09 | ||
| 1zfn_A | 253 | Structural Analysis Of Escherichia Coli Thif Length | 3e-09 | ||
| 3h5a_A | 358 | Crystal Structure Of E. Coli Mccb Length = 358 | 3e-08 | ||
| 3h5n_A | 353 | Crystal Structure Of E. Coli Mccb + Atp Length = 35 | 3e-08 | ||
| 3guc_A | 292 | Human Ubiquitin-Activating Enzyme 5 In Complex With | 1e-07 | ||
| 1y8q_A | 346 | Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex | 2e-07 | ||
| 3vh1_A | 598 | Crystal Structure Of Saccharomyces Cerevisiae Atg7 | 3e-07 | ||
| 3vh2_A | 616 | Crystal Structure Of Saccharomyces Cerevisiae Atg7 | 3e-07 | ||
| 4gsk_A | 615 | Crystal Structure Of An Atg7-Atg10 Crosslinked Comp | 3e-07 | ||
| 4gsl_A | 615 | Crystal Structure Of An Atg7-Atg3 Crosslinked Compl | 3e-07 | ||
| 3vh3_A | 340 | Crystal Structure Of Atg7ctd-Atg8 Complex Length = | 3e-07 | ||
| 3t7e_A | 344 | Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E | 3e-07 | ||
| 3rui_A | 340 | Crystal Structure Of Atg7c-Atg8 Complex Length = 34 | 3e-07 | ||
| 1r4m_A | 529 | Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Com | 2e-04 | ||
| 3gzn_A | 534 | Structure Of Nedd8-Activating Enzyme In Complex Wit | 2e-04 | ||
| 1tt5_A | 531 | Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 I | 2e-04 | ||
| 2nvu_A | 536 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 2e-04 | ||
| 1yov_A | 537 | Insights Into The Ubiquitin Transfer Cascade From T | 2e-04 |
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
|
| >pdb|3KYC|B Chain B, Human Sumo E1 Complex With A Sumo1-Amp Mimic Length = 660 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|3KYD|B Chain B, Human Sumo E1~sumo1-amp Tetrahedral Intermediate Mimic Length = 551 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|1Y8Q|B Chain B, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 640 | Back alignment and structure |
| >pdb|2PX9|A Chain A, The Intrinsic Affinity Between E2 And The Cys Domain Of E1 In Ubiquitin-Like Modifications Length = 217 | Back alignment and structure |
| >pdb|4II2|A Chain A, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 1001 | Back alignment and structure |
| >pdb|2NVU|B Chain B, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 805 | Back alignment and structure |
| >pdb|1YOV|B Chain B, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 444 | Back alignment and structure |
| >pdb|3GZN|B Chain B, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 463 | Back alignment and structure |
| >pdb|1TT5|B Chain B, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 434 | Back alignment and structure |
| >pdb|3DBR|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190gln-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 431 | Back alignment and structure |
| >pdb|3DBL|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190wt-Nedd8ala72gln) Length = 434 | Back alignment and structure |
| >pdb|3DBH|B Chain B, Structural Dissection Of A Gating Mechanism Preventing Misactivation Of Ubiquitin By Nedd8's E1 (Appbp1- Uba3arg190ala-Nedd8ala72arg) Length = 434 | Back alignment and structure |
| >pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 | Back alignment and structure |
| >pdb|3CMM|A Chain A, Crystal Structure Of The Uba1-Ubiquitin Complex Length = 1015 | Back alignment and structure |
| >pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 | Back alignment and structure |
| >pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 | Back alignment and structure |
| >pdb|1ZUD|1 Chain 1, Structure Of This-Thif Protein Complex Length = 251 | Back alignment and structure |
| >pdb|1ZFN|A Chain A, Structural Analysis Of Escherichia Coli Thif Length = 253 | Back alignment and structure |
| >pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 | Back alignment and structure |
| >pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 | Back alignment and structure |
| >pdb|3GUC|A Chain A, Human Ubiquitin-Activating Enzyme 5 In Complex With Amppnp Length = 292 | Back alignment and structure |
| >pdb|1Y8Q|A Chain A, Sumo E1 Activating Enzyme Sae1-Sae2-Mg-Atp Complex Length = 346 | Back alignment and structure |
| >pdb|3VH1|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Atg7 (1-595) Length = 598 | Back alignment and structure |
| >pdb|3VH2|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Atg7 (1-613) Length = 616 | Back alignment and structure |
| >pdb|4GSK|A Chain A, Crystal Structure Of An Atg7-Atg10 Crosslinked Complex Length = 615 | Back alignment and structure |
| >pdb|4GSL|A Chain A, Crystal Structure Of An Atg7-Atg3 Crosslinked Complex Length = 615 | Back alignment and structure |
| >pdb|3VH3|A Chain A, Crystal Structure Of Atg7ctd-Atg8 Complex Length = 340 | Back alignment and structure |
| >pdb|3T7E|A Chain A, Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E2 Architecture And Mechanism In The Autophagy Pathway Length = 344 | Back alignment and structure |
| >pdb|3RUI|A Chain A, Crystal Structure Of Atg7c-Atg8 Complex Length = 340 | Back alignment and structure |
| >pdb|1R4M|A Chain A, Appbp1-Uba3-Nedd8, An E1-Ubiquitin-Like Protein Complex Length = 529 | Back alignment and structure |
| >pdb|3GZN|A Chain A, Structure Of Nedd8-Activating Enzyme In Complex With Nedd8 And Mln4924 Length = 534 | Back alignment and structure |
| >pdb|1TT5|A Chain A, Structure Of Appbp1-Uba3-Ubc12n26: A Unique E1-E2 Interaction Required For Optimal Conjugation Of The Ubiquitin-Like Protein Nedd8 Length = 531 | Back alignment and structure |
| >pdb|2NVU|A Chain A, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 536 | Back alignment and structure |
| >pdb|1YOV|A Chain A, Insights Into The Ubiquitin Transfer Cascade From The Refined Structure Of The Activating Enzyme For Nedd8 Length = 537 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 726 | |||
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 1e-167 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 3e-84 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 1e-35 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 1e-75 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 3e-31 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 5e-75 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 4e-27 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 2e-38 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 2e-29 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 8e-28 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 4e-25 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 1e-24 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 1e-22 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 5e-22 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 1e-20 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 3e-20 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-15 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 | Back alignment and structure |
|---|
Score = 495 bits (1276), Expect = e-167
Identities = 296/757 (39%), Positives = 391/757 (51%), Gaps = 172/757 (22%)
Query: 5 IPGVFEKDLEDLIKKSKVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLNRQFL 64
+ ++L + + +VLVVGAGGIGCELLKNLVL+GFS+I+++DLDTIDVSNLNRQFL
Sbjct: 3 LSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFL 62
Query: 65 FHKQHVGKSKAQVARNSALNFNPDANIYYQVDFHLNRQFLFHKQHVGKSKAQVARNSALN 124
Sbjct: 62 ------------------------------------------------------------ 62
Query: 125 FNPDANIVAHHTSIIRFLHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSII 184
F K+HVG+SKAQVA+ S L F P ANIVA+H SI+
Sbjct: 63 -------------------------FQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIM 97
Query: 185 SADFGVNYFKQFTLVMNALDNRAARNHVNRMCLASEVPLIESGTAGYEGQVELIKKGETK 244
+ D+ V +F+QF LVMNALDNRAARNHVNRMCLA++VPLIESGTAGY GQV IKKG T+
Sbjct: 98 NPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTE 157
Query: 245 CYECDPKPAAKTYPGCTIRNTPSEPIHCIVWAKHLFNYLERLMLMKRCPLILKIQKLLER 304
CYEC PKP +T+PG TIRNTPSEPIHCIVWAK+LFN L
Sbjct: 158 CYECHPKPTQRTFPGATIRNTPSEPIHCIVWAKYLFNQL--------------------- 196
Query: 305 LSAMNVIRSQLPKLIQAVQLGILRLNPFTVLSGLNICSSDAGAKAAASEATANGDVVRTS 364
+ ++ R +P A+A A + +GD+ R S
Sbjct: 197 ----------FGEEDADQEVSPDRADPEAAWEPTE-------AEARARASNEDGDIKRIS 239
Query: 365 TRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLVWDTLSD----AVAGSS 420
T+ WA + GYDP KLF K F DIRYL++M LW+ RK P PL W + A
Sbjct: 240 TKEWAKSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKPPVPLDWAEVQSQGEETNASDQ 299
Query: 421 KETDGGGLKDQRVWSVAECARVFERSVRELKTKFDAAVEKDEHLVWDKDDKPAMDFVAAC 480
+ GLKDQ+V V AR+F +S+ L+ A L+WDKDD AMDFV +
Sbjct: 300 QNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHL-AEKGDGAELIWDKDDPSAMDFVTSA 358
Query: 481 ANIRAHVFSIPEKSRFDIKSMAGNIIPAIATSNAIVAGLVVLHAIHVLQARFSSCQTVYL 540
AN+R H+FS+ KSRFDIKSMAGNIIPAIAT+NA++AGL+VL + +L + C+T++L
Sbjct: 359 ANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFL 418
Query: 541 RKKPNHRDQMIVPEKYLTAPNPTCPVCSPKPQRTIGLDVTKMTVAEFEEAVLKKTLNMSA 600
K+PN R +++VP L PNP C VC+ KP+ T+ L+V K+TV ++ ++K+ M A
Sbjct: 419 NKQPNPRKKLLVPCA-LDPPNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVA 477
Query: 601 MVDVMVEASGSVIISSEEGETEANNDKPL-----EHG---------------LIISHRVS 640
+ + G+++ISSEEGETEANN K L +G + I H
Sbjct: 478 PDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGSRLQADDFLQDYTLLINILHSED 537
Query: 641 ARDGPEFEIL-DQKDLPQPPAPDAAASTTDAAEEKM---------------------ETN 678
EFE++ D + P + AA + + E +
Sbjct: 538 LGKDVEFEVVGDAPEKVGPKQAEDAAKSITNGSDDGAQPSTSTAQEQDDVLIVDSDEEDS 597
Query: 679 GNGNGDVGTPDSKKRKVDSSDESLPAKKVRTDEKSTD 715
N S+KRK+D E+L AK+ R ++K
Sbjct: 598 SNNADVSEEERSRKRKLD-EKENLSAKRSRIEQKEEL 633
|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} Length = 276 | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 726 | |||
| 1y8q_B | 640 | Anthracycline-, ubiquitin-like 2 activating enzyme | 100.0 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 100.0 | |
| 1tt5_B | 434 | Ubiquitin-activating enzyme E1C isoform 1; cell cy | 100.0 | |
| 2nvu_B | 805 | Maltose binding protein/NEDD8-activating enzyme E1 | 100.0 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 100.0 | |
| 1y8q_A | 346 | Ubiquitin-like 1 activating enzyme E1A; SUMO, hete | 100.0 | |
| 1tt5_A | 531 | APPBP1, amyloid protein-binding protein 1; cell cy | 100.0 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 100.0 | |
| 1zud_1 | 251 | Adenylyltransferase THIF; thiamin, thiazole, prote | 100.0 | |
| 3rui_A | 340 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.97 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 99.97 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 99.97 | |
| 4gsl_A | 615 | Ubiquitin-like modifier-activating enzyme ATG7; ub | 99.97 | |
| 3cmm_A | 1015 | Ubiquitin-activating enzyme E1 1; UBA1, protein tu | 99.96 | |
| 3vh1_A | 598 | Ubiquitin-like modifier-activating enzyme ATG7; au | 99.96 | |
| 1z7l_A | 276 | Ubiquitin-activating enzyme E1 1; SCCH, second cat | 98.21 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.29 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.79 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 96.79 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.56 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 96.5 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.5 | |
| 1y8x_B | 98 | Ubiquitin-activating enzyme E1C; ubiquitin-conjuga | 96.42 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 96.34 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 96.16 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 95.79 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.71 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 95.48 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 95.27 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 95.26 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 95.25 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 95.12 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 95.07 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 95.0 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 94.95 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 94.67 | |
| 3onh_A | 127 | Ubiquitin-activating enzyme E1-like; ligase, SUMO | 94.44 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 94.22 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 94.19 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 94.14 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 94.11 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 94.05 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 94.03 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 93.95 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 93.94 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 93.93 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 93.9 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 93.9 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 93.88 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 93.72 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 93.48 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 93.43 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 93.36 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 93.36 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 93.34 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 93.2 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 93.2 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 92.94 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 92.93 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 92.92 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 92.86 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 92.81 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 92.64 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 92.5 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 92.47 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 92.44 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 92.41 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 92.39 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 92.38 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 92.31 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 92.26 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 92.24 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 92.23 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 92.21 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 92.01 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 91.91 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 91.89 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 91.69 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 91.62 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 91.55 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 91.55 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 91.45 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 91.42 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 91.33 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 91.31 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 91.22 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 91.19 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 91.1 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 91.07 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 91.02 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 90.97 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 90.84 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 90.69 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 90.62 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 90.43 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 90.4 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 90.31 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 90.28 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 90.28 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 90.2 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 90.19 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 90.17 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 90.16 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 90.14 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 90.13 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 90.09 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 90.07 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 90.06 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 89.97 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 89.96 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 89.96 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 89.92 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 89.9 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 89.89 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 89.88 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 89.86 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 89.82 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 89.67 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 89.62 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 89.6 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 89.57 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 89.55 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 89.51 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 89.51 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 89.5 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 89.46 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 89.46 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 89.28 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 89.23 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 89.21 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 89.2 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 89.06 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 88.81 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 88.71 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 88.69 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 88.59 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 88.59 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 88.58 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 88.57 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 88.55 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 88.51 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 88.51 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 88.49 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 88.49 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 88.41 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 88.37 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 88.21 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 88.21 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 88.16 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 88.06 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 88.04 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 88.02 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 88.01 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 88.0 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 87.99 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 87.93 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 87.81 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 87.8 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 87.7 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 87.69 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 87.59 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 87.5 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 87.49 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 87.47 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 87.36 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 87.35 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 87.35 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 87.31 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 87.18 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 87.17 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 87.14 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 87.09 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 87.0 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 86.94 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 86.93 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 86.88 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 86.85 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 86.81 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 86.79 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 86.78 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 86.7 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 86.62 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 86.56 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 86.41 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 86.31 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 86.24 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 86.18 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 86.18 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 86.1 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 86.1 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 86.09 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 85.97 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 85.91 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 85.89 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 85.87 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 85.81 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 85.7 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 85.7 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 85.66 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 85.63 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 85.62 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 85.61 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 85.57 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 85.57 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 85.54 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 85.51 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 85.51 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 85.49 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 85.45 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 85.44 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 85.42 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 85.39 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 85.39 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 85.36 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 85.36 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 85.28 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 85.22 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 85.09 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 85.08 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 85.08 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 85.01 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 84.95 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 84.92 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 84.86 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 84.85 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 84.82 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 84.81 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 84.8 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 84.78 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 84.77 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 84.68 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 84.65 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 84.57 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 84.5 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 84.49 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 84.46 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 84.42 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 84.42 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 84.4 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 84.33 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 84.27 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 84.26 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 84.18 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 84.16 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 84.16 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 84.13 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 84.1 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 84.03 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 84.03 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 84.03 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 84.01 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 84.0 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 83.96 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 83.96 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 83.88 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 83.85 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 83.75 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 83.73 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 83.72 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 83.62 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 83.6 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 83.56 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 83.54 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 83.5 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 83.46 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 83.44 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 83.42 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 83.32 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 83.3 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 83.29 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 83.19 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 83.18 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 83.16 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 83.13 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 83.08 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 82.94 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 82.8 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 82.77 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 82.68 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 82.68 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 82.66 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 82.64 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 82.61 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 82.55 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 82.55 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 82.54 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 82.54 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 82.52 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 82.51 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 82.44 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 82.42 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 82.41 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 82.35 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 82.31 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 82.31 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 82.19 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 82.17 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 82.14 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 82.14 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 82.08 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 82.07 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 82.05 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 82.03 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 82.03 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 81.98 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 81.97 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 81.95 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 81.92 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 81.9 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 81.88 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 81.82 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 81.76 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 81.75 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 81.74 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 81.73 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 81.71 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 81.67 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 81.56 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 81.45 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 81.38 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 81.37 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 81.31 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 81.28 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 81.26 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 81.19 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 82.05 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 81.07 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 81.01 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 80.95 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 80.94 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 80.88 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 80.84 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 80.84 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 80.79 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 80.77 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 80.73 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 80.71 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 80.64 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 80.64 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 80.57 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 80.53 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 80.51 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 80.49 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 80.48 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 80.46 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 80.46 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 80.43 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 80.42 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 80.42 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 80.39 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 80.38 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 80.29 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 80.28 | |
| 3h8v_A | 292 | Ubiquitin-like modifier-activating enzyme 5; rossm | 80.27 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 80.27 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 80.26 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 80.25 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 80.22 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 80.22 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 80.2 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 80.2 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 80.07 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 80.06 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 80.03 |
| >1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A | Back alignment and structure |
|---|
Probab=100.00 E-value=3.7e-113 Score=980.95 Aligned_cols=530 Identities=52% Similarity=0.881 Sum_probs=428.2
Q ss_pred cccccCHHHHHHHhcCcEEEEcCchHHHHHHHHHHHhCCCeEEEEeCCccCccCCCcCCCCCCCccChhHHHHHHHHhhh
Q psy9783 5 IPGVFEKDLEDLIKKSKVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLNRQFLFHKQHVGKSKAQVARNSALN 84 (726)
Q Consensus 5 ~~~~~g~~~q~kL~~~kVlvVGaGgiGceiaknLal~Gv~~i~iiD~D~Ie~sNLnRQfLf~~~dvGk~Ka~va~~~l~~ 84 (726)
|+++||.++|++|++++|+||||||+||++|++|+++|||+|+|+|+|+|+.|||+|||||+.+|||++||++|+++|++
T Consensus 3 qi~l~G~e~Q~kL~~s~VlVVGaGGLGsevak~La~aGVG~ItlvD~D~Ve~SNLnRQflf~~~dVGk~KAeaaa~~L~~ 82 (640)
T 1y8q_B 3 LSRGLPRELAEAVAGGRVLVVGAGGIGCELLKNLVLTGFSHIDLIDLDTIDVSNLNRQFLFQKKHVGRSKAQVAKESVLQ 82 (640)
T ss_dssp ---CCCHHHHHHHHHCEEEEECCSHHHHHHHHHHHHHTCCEEEEEECCBCCGGGGGTCTTCCGGGTTSBHHHHHHHHHHT
T ss_pred hhhhcCHHHHHHHhcCeEEEECcCHHHHHHHHHHHHcCCCeEEEecCCEEChhhcCCCcCCChhHcChHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999965555
Q ss_pred cCCCCceeeeeccccchhhhhhccccCchhhhHhhccccCCCCCCeEeeecchhhhhhhhchhhhhhccccCcchhhhHH
Q psy9783 85 FNPDANIYYQVDFHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSIIRFLHLNRQFLFHKQHVGKSKAQVAR 164 (726)
Q Consensus 85 ~np~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~q~l~~~~hvg~sk~~~ak 164 (726)
+|
T Consensus 83 iN------------------------------------------------------------------------------ 84 (640)
T 1y8q_B 83 FY------------------------------------------------------------------------------ 84 (640)
T ss_dssp TC------------------------------------------------------------------------------
T ss_pred HC------------------------------------------------------------------------------
Confidence 54
Q ss_pred HHHHhhCCCCeEEEEecccccccccccccccccEEEEccCcHHHHHHHHHHhhhcCCcEEEEccCCccceEEEEeCCCCc
Q psy9783 165 NSALNFNPDANIVAHHTSIISADFGVNYFKQFTLVMNALDNRAARNHVNRMCLASEVPLIESGTAGYEGQVELIKKGETK 244 (726)
Q Consensus 165 ~~~~~~np~~~i~~~~~~i~~~~~~~~~~~~~DlVi~alDn~~aR~~in~~c~~~~iPlI~sg~~G~~G~v~~i~p~~t~ 244 (726)
|+++|+++..++++..+..+|+.++|+||+|+||+++|.++|++|+.+++|+|++|+.|+.|++.++.|+.++
T Consensus 85 -------P~v~V~a~~~~i~~~~~~~~~~~~~DlVvda~Dn~~aR~~ln~~c~~~~iPlI~~g~~G~~G~v~vi~p~~t~ 157 (640)
T 1y8q_B 85 -------PKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTE 157 (640)
T ss_dssp -------TTCEEEEEESCTTSTTSCHHHHTTCSEEEECCSCHHHHHHHHHHHHHHTCCEEEEEEETTEEEEEEECTTTSC
T ss_pred -------CCCeEEEEecccchhhhhHhhhcCCCEEEECCCCHHHHHHHHHHHHHcCCCEEEEEEecccceEEEECCCCCC
Confidence 5556666666666655667889999999999999999999999999999999999999999999999999999
Q ss_pred ceecCCCCCCCCCCCccccCCCCCcchhhhhHhHHhHHHHHHHhhhcchhHHHHHHHHhhhhhhhhhcccchHHHHHHHh
Q psy9783 245 CYECDPKPAAKTYPGCTIRNTPSEPIHCIVWAKHLFNYLERLMLMKRCPLILKIQKLLERLSAMNVIRSQLPKLIQAVQL 324 (726)
Q Consensus 245 cy~C~~~~~~~~~p~Cti~~~p~~~~h~i~~a~~lf~~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~ 324 (726)
||+|.+.++++++|.||++++|+.|+|||+||+++|+.||+. ....+++ .++
T Consensus 158 Cy~C~~~p~~~~~p~Cti~~~p~~~~hci~~a~~~f~~lf~~-----------------~~~~~~~----~~~------- 209 (640)
T 1y8q_B 158 CYECHPKPTQRTFPGATIRNTPSEPIHCIVWAKYLFNQLFGE-----------------EDADQEV----SPD------- 209 (640)
T ss_dssp CTTSSCCCCCCCCCTTTTTSCCCSHHHHHHHHHHHHHHHHSC-----------------CCGGGCC----SCC-------
T ss_pred CcccCCCCCCcccceeeecCCCCchHHHHHHHHHHHHHHhCC-----------------cchhhhh----ccc-------
Confidence 999999888899999999999999999999999999999993 2222222 111
Q ss_pred hhccCCccccccccccccchhhhhHhhhhhhhcCCccccccccchhhcccchH-HHHHHHhHHHHHHHHcCCcccCCCCC
Q psy9783 325 GILRLNPFTVLSGLNICSSDAGAKAAASEATANGDVVRTSTRAWASACGYDPR-KLFAKFFDADIRYLISMSDLWKTRKA 403 (726)
Q Consensus 325 G~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~w~~~c~~~~~-~~f~~~F~~~I~~Ll~~~~~w~~~~~ 403 (726)
..+|+.... ......+.......+.+.+...+.|+ .|+.||+ .+|+++|+++|++||+|++||+++|+
T Consensus 210 ---~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~a~~~~f~k~F~~~I~~Ll~~~~fW~~kr~ 278 (640)
T 1y8q_B 210 ---RADPEAAWE-------PTEAEARARASNEDGDIKRISTKEWA-KSTGYDPVKLFTKLFKDDIRYLLTMDKLWRKRKP 278 (640)
T ss_dssp ---TTCTTSCCC----------------------------CHHHH-HHTTSCHHHHHHHHHTHHHHHHTTCGGGCSSSCC
T ss_pred ---ccchhhhhh-------hhhhhhhhhhhhhhhHHHHHhhhhHH-HhHhHHHHHHHHHHHhhHHHHHHhCcccccCCCC
Confidence 123322100 00001111122233445555567897 6777776 59999999999999999999999999
Q ss_pred CCCcccCCCch-hhcCC-Cc--ccCCCCCCcccccChHHHHHHHHHHHHHHHHHhhhhhccCCCccccCCChhhHHHHHH
Q psy9783 404 PQPLVWDTLSD-AVAGS-SK--ETDGGGLKDQRVWSVAECARVFERSVRELKTKFDAAVEKDEHLVWDKDDKPAMDFVAA 479 (726)
Q Consensus 404 P~pl~~~~~~~-~~~~~-~~--~~~~~~~~~~~~~~~~~~~~~f~~s~~~L~~~l~~~~~~~~~l~FDKDDd~hmDFVtA 479 (726)
|+||.||.... +.... .. .....+++++++|++.++.++|.+++++|.+++.. .....+++|||||+.|||||+|
T Consensus 279 P~pl~fd~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~l~~~l~~-~~~~~~~~FdKDDd~h~dFV~a 357 (640)
T 1y8q_B 279 PVPLDWAEVQSQGEETNASDQQNEPQLGLKDQQVLDVKSYARLFSKSIETLRVHLAE-KGDGAELIWDKDDPSAMDFVTS 357 (640)
T ss_dssp CCCCCHHHHHHC--------------CCCGGGSCCCHHHHHHHHHHHHHHHHHHHHH-TCTTCCCCCCTTCHHHHHHHHH
T ss_pred CCCcccCccccccccccccccccccccCCChhhhcChhhhhhhHHHHHHHHHHHhhh-cccCCCcccCCCCHHHHHHHHH
Confidence 99999998643 22111 00 01235778899999999999999999999999876 3457799999999999999999
Q ss_pred HHHHhHHhcCCCCCCHHHHHHhhcCCCcchhHHHHHHHHHHHHHHHHHHhhhhcccchhhhccCCCCCCccccccccCCC
Q psy9783 480 CANIRAHVFSIPEKSRFDIKSMAGNIIPAIATSNAIVAGLVVLHAIHVLQARFSSCQTVYLRKKPNHRDQMIVPEKYLTA 559 (726)
Q Consensus 480 AANLRA~nY~Ip~~s~~~vK~IAGnIIPAIATTnAIVAGLvvlEl~KlL~~k~e~~rn~flnl~pn~~~~~~vP~~~~~e 559 (726)
||||||+||+||++|||++|+|||||||||||||||||||+|+|+||++++.++.|||+|+|++++++++++.+ ..+.+
T Consensus 358 aaNlRA~~y~I~~~~~~~~K~iAG~IIPAIATTnAiVaGl~~lE~~Kvl~~~~~~~kn~f~n~a~~~~~~~~~~-~~p~~ 436 (640)
T 1y8q_B 358 AANLRMHIFSMNMKSRFDIKSMAGNIIPAIATTNAVIAGLIVLEGLKILSGKIDQCRTIFLNKQPNPRKKLLVP-CALDP 436 (640)
T ss_dssp HHHHHHHHTTCCCCCHHHHHHHHHTCCCCCHHHHHHHHHHHHHHHHHHHTTCGGGCEEEEECSSCCTTSEEEEE-EECCC
T ss_pred HHHHHHHHcCCCcCCHHHHHHHhCCcccchhhHHHHHHHHHHHHHHHHHhccHHhhhhhheeeccCCCCcEEee-cccCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999988888888 67789
Q ss_pred CCCCCCCCCCCCeEEEEEECCCCcHHHHHHHHHhcccCCccceeEEE-ecCCeEEEeccccccccccCCchhhh-h----
Q psy9783 560 PNPTCPVCSPKPQRTIGLDVTKMTVAEFEEAVLKKTLNMSAMVDVMV-EASGSVIISSEEGETEANNDKPLEHG-L---- 633 (726)
Q Consensus 560 Pnp~C~vC~~~~~~tl~id~~~~TL~~lid~ilk~~l~m~~~pdV~~-~~~G~ll~ss~e~e~~~nl~k~L~el-v---- 633 (726)
|+|+|++|+..+++++++++++|||++|+++|++++|||.. |.|+. .+.+++||+++++++++||+|+|+|+ |
T Consensus 437 p~~~c~vc~~~~~~~~~~~~~~~TL~~li~~~~~~~~~l~~-~~is~~~~~~~~ly~~~~~~~~~~l~~~l~el~v~~~~ 515 (640)
T 1y8q_B 437 PNPNCYVCASKPEVTVRLNVHKVTVLTLQDKIVKEKFAMVA-PDVQIEDGKGTILISSEEGETEANNHKKLSEFGIRNGS 515 (640)
T ss_dssp CCTTCTTTSSSCEEEEEECTTTCBHHHHHHCCCCCCTCCSS-CEEEESSSSCCEEECSSSSSSTTGGGSBGGGGTCCTTC
T ss_pred CCCCCcccCCccEEEEEEeCCCCcHHHHHHHHHHHhhCCCC-ceEEEEcCCCcEEEeccchhhHHhhhCcHHHhCccCCc
Confidence 99999999766788999999999999999998788999998 99988 33458999999899999999999993 2
Q ss_pred ---------------hhcccCCCCCCCeEEEEec-CCCCCCCCc
Q psy9783 634 ---------------IISHRVSARDGPEFEILDQ-KDLPQPPAP 661 (726)
Q Consensus 634 ---------------~v~~~~~~~~~~~feV~~~-~~~~~p~~~ 661 (726)
.+.|+++.++...|+|.++ |.+.+|+++
T Consensus 516 ~~~v~d~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 559 (640)
T 1y8q_B 516 RLQADDFLQDYTLLINILHSEDLGKDVEFEVVGDAPEKVGPKQA 559 (640)
T ss_dssp EEEEEETTTTEEEEEEEEECSCCCTTCCEEETTCC---------
T ss_pred EEEecCCCccEEEEEEEEecCcccCCCCeEEecCCccccCCCcc
Confidence 2345555555567777776 555555544
|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* | Back alignment and structure |
|---|
| >2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* | Back alignment and structure |
|---|
| >1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A | Back alignment and structure |
|---|
| >3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A | Back alignment and structure |
|---|
| >3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A | Back alignment and structure |
|---|
| >1z7l_A Ubiquitin-activating enzyme E1 1; SCCH, second catalytic cysteine half-domain, ligase; HET: TBR; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 726 | ||||
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 1e-40 | |
| d1yovb1 | 426 | c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T | 1e-27 | |
| d1yova1 | 529 | c.111.1.2 (A:6-534) Amyloid beta precursor protein | 3e-39 | |
| d1jw9b_ | 247 | c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr | 8e-15 | |
| d2vapa1 | 209 | c.32.1.1 (A:23-231) Cell-division protein FtsZ {Ar | 0.001 |
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: UBA3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 152 bits (385), Expect = 1e-40
Identities = 84/283 (29%), Positives = 117/283 (41%), Gaps = 101/283 (35%)
Query: 12 DLEDLIKKSKVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLNRQFLFHKQHVG 71
L+ L+ KVLV+GAGG+GCELLKNL LSGF I ++D+DTIDVSNLNRQFL
Sbjct: 30 SLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFL------- 82
Query: 72 KSKAQVARNSALNFNPDANIYYQVDFHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANI 131
F + +G+ KA+VA + P+ N+
Sbjct: 83 ---------------------------------FRPKDIGRPKAEVAAEFLNDRVPNCNV 109
Query: 132 VAHHTSIIRFLHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSIISADFGVN 191
V H I DF
Sbjct: 110 VPHFNKI-----------------------------------------------QDFNDT 122
Query: 192 YFKQFTLVMNALDNRAARNHVNRMCL------------ASEVPLIESGTAGYEGQVELIK 239
+++QF +++ LD+ AR +N M + +S VPLI+ GT G++G +I
Sbjct: 123 FYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVIL 182
Query: 240 KGETKCYECDPK--PAAKTYPGCTIRNTPSEPIHCIVWAKHLF 280
G T C EC + P +P CTI + P P HCI + + L
Sbjct: 183 PGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQ 225
|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 209 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 726 | |||
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 100.0 | |
| d1yova1 | 529 | Amyloid beta precursor protein-binding protein 1, | 100.0 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.13 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 96.36 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 96.25 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.13 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.98 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.79 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 95.68 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 95.21 | |
| d1y8xb1 | 92 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 95.16 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 95.15 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 94.92 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 94.89 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 94.83 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.77 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 94.71 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 94.7 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 94.65 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 94.51 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 94.45 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 94.38 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 94.3 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 94.28 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 94.25 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 94.14 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 94.13 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 94.08 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 94.06 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 94.01 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 93.99 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 93.97 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 93.87 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 93.8 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.73 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 93.71 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 93.68 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 93.6 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 93.4 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 93.38 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 93.35 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 93.32 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 93.2 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 93.09 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 93.01 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 92.92 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 92.84 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 92.76 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 92.65 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 92.64 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 92.48 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 92.25 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 92.25 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 92.24 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 92.17 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 92.14 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 92.02 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 91.91 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 91.9 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 91.79 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 91.65 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 91.65 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 91.65 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 91.6 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 91.48 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 91.45 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 91.39 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 91.31 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 91.27 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 91.27 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 91.19 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 91.13 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 91.1 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 90.99 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 90.93 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 90.92 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 90.87 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 90.86 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 90.69 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 90.62 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 90.58 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 90.54 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 90.53 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 90.37 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 90.34 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 90.27 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 90.17 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 90.13 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 89.97 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 89.97 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 89.76 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 89.7 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 89.66 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 89.54 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 89.37 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 89.19 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 89.18 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 88.96 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 88.67 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 88.39 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 88.35 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 88.31 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 88.11 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 87.61 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 87.54 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 87.39 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 87.1 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 86.98 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 86.93 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 86.82 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 86.81 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 86.69 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 86.65 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 86.63 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 86.51 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 86.31 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 86.21 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 86.12 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 86.08 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 85.95 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 85.73 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 85.43 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 85.16 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 85.1 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 85.08 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 84.71 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 84.62 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 84.55 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 84.51 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 84.11 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 83.91 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 83.83 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 83.81 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 83.8 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 83.78 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 83.68 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 83.64 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 83.64 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 83.64 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 83.64 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 83.59 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 83.47 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 83.27 | |
| d2vapa1 | 209 | Cell-division protein FtsZ {Archaeon Methanococcus | 83.15 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 83.14 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 83.11 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 83.06 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 82.82 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 82.81 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 82.79 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 82.68 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 82.62 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 82.61 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 82.57 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 82.52 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 82.45 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 82.43 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 82.41 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 82.4 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 82.33 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 82.33 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 82.29 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 82.29 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 82.29 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 82.27 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 81.93 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 81.82 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 81.64 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 81.63 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 81.6 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 81.57 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 81.48 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 81.39 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 81.29 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 81.28 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 81.26 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 81.15 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 81.02 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 80.87 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 80.65 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 80.46 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 80.39 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 80.39 | |
| d1ofua1 | 198 | Cell-division protein FtsZ {Pseudomonas aeruginosa | 80.34 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 80.3 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 80.25 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 80.25 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 80.18 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 80.12 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 80.05 |
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Activating enzymes of the ubiquitin-like proteins superfamily: Activating enzymes of the ubiquitin-like proteins family: Ubiquitin activating enzymes (UBA) domain: UBA3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2e-72 Score=618.91 Aligned_cols=355 Identities=32% Similarity=0.577 Sum_probs=281.0
Q ss_pred HHHHHHHhcCcEEEEcCchHHHHHHHHHHHhCCCeEEEEeCCccCccCCCcCCCCCCCccChhHHHHHHHHhhhcCCCCc
Q psy9783 11 KDLEDLIKKSKVLVVGAGGIGCELLKNLVLSGFSNIEIVDLDTIDVSNLNRQFLFHKQHVGKSKAQVARNSALNFNPDAN 90 (726)
Q Consensus 11 ~~~q~kL~~~kVlvVGaGgiGceiaknLal~Gv~~i~iiD~D~Ie~sNLnRQfLf~~~dvGk~Ka~va~~~l~~~np~~~ 90 (726)
+..|.+|+++|||||||||+|||+||+|+++|||+|+|+|+|+|+.|||+|||||+.+|||++||++|+++++++||+
T Consensus 29 e~~~~~l~~~kVlvvG~GglG~ei~k~L~~~Gvg~i~lvD~D~Ve~sNL~RQflf~~~diG~~Ka~~a~~~l~~~np~-- 106 (426)
T d1yovb1 29 ESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPN-- 106 (426)
T ss_dssp SHHHHHHHHCCEEEECSSTTHHHHHHHHHTTTCCCEEEECCCBCCGGGGGTCTTCCGGGTTSBHHHHHHHHHHHHSTT--
T ss_pred HHHHHHHhcCeEEEECCCHHHHHHHHHHHHcCCCeEEEEECCCcchhhhcccccCChhHcCcHHHHHHHHHHHhhCCC--
Confidence 456888999999999999999999999999999999999999999999999999999999999999999666555555
Q ss_pred eeeeeccccchhhhhhccccCchhhhHhhccccCCCCCCeEeeecchhhhhhhhchhhhhhccccCcchhhhHHHHHHhh
Q psy9783 91 IYYQVDFHLNRQFLFHKQHVGKSKAQVARNSALNFNPDANIVAHHTSIIRFLHLNRQFLFHKQHVGKSKAQVARNSALNF 170 (726)
Q Consensus 91 v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~l~~q~l~~~~hvg~sk~~~ak~~~~~~ 170 (726)
T Consensus 107 -------------------------------------------------------------------------------- 106 (426)
T d1yovb1 107 -------------------------------------------------------------------------------- 106 (426)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred CCCCeEEEEecccccccccccccccccEEEEccCcHHHHHHHHHHhh------------hcCCcEEEEccCCccceEEEE
Q psy9783 171 NPDANIVAHHTSIISADFGVNYFKQFTLVMNALDNRAARNHVNRMCL------------ASEVPLIESGTAGYEGQVELI 238 (726)
Q Consensus 171 np~~~i~~~~~~i~~~~~~~~~~~~~DlVi~alDn~~aR~~in~~c~------------~~~iPlI~sg~~G~~G~v~~i 238 (726)
++|++++.++.+ ++.+|+++||+|++|+||+++|.++|++|+ +.++|+|++|+.|+.||+.++
T Consensus 107 ---v~i~~~~~~i~~--~~~~~~~~~DlVi~~~Dn~~aR~~in~~c~~l~k~~~~~~~~~~~iPlI~gg~~G~~G~~~vi 181 (426)
T d1yovb1 107 ---CNVVPHFNKIQD--FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVI 181 (426)
T ss_dssp ---CCCEEECSCGGG--BCHHHHTTCSEEEECCSCHHHHHHHHHHHHHTCCEETTEECGGGCCCEEEEEEETTEEEEEEE
T ss_pred ---CceEeeeccccc--hHHHHHHhcchheeccCcHHHHHHHHHHHHHhhcccccccccccCCceEEeEEeeeEEEEEEE
Confidence 455555555543 346789999999999999999999999997 467899999999999999999
Q ss_pred eCCCCcceecCCC--CCCCCCCCccccCCCCCcchhhhhHhHHhHHHHHHHhhhcchhHHHHHHHHhhhhhhhhhcccch
Q psy9783 239 KKGETKCYECDPK--PAAKTYPGCTIRNTPSEPIHCIVWAKHLFNYLERLMLMKRCPLILKIQKLLERLSAMNVIRSQLP 316 (726)
Q Consensus 239 ~p~~t~cy~C~~~--~~~~~~p~Cti~~~p~~~~h~i~~a~~lf~~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 316 (726)
.|+.|+||+|... |+++++|.|||+++|+.|+|||+||+.+.
T Consensus 182 ~p~~t~Cy~C~~~~~p~~~~~p~CTi~~~P~~~~hci~~ak~l~------------------------------------ 225 (426)
T d1yovb1 182 LPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCIEYVRMLQ------------------------------------ 225 (426)
T ss_dssp CTTTSCCGGGGGGGSCCCCCCCHHHHHHCCCSHHHHHHHHHHTH------------------------------------
T ss_pred CCCCCCCcCcCCCCCCCCCCCCcccccCCCCCchheeehhhhhc------------------------------------
Confidence 9999999999854 66789999999999999999999998641
Q ss_pred HHHHHHHhhhccCCccccccccccccchhhhhHhhhhhhhcCCccccccccchhhcccchHHHHHHHhHHHHHHHHcCCc
Q psy9783 317 KLIQAVQLGILRLNPFTVLSGLNICSSDAGAKAAASEATANGDVVRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSD 396 (726)
Q Consensus 317 ~~~~~v~~G~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~w~~~c~~~~~~~f~~~F~~~I~~Ll~~~~ 396 (726)
|.+.
T Consensus 226 ---------------------------------------------------~~~~------------------------- 229 (426)
T d1yovb1 226 ---------------------------------------------------WPKE------------------------- 229 (426)
T ss_dssp ---------------------------------------------------HHHS-------------------------
T ss_pred ---------------------------------------------------cccc-------------------------
Confidence 1000
Q ss_pred ccCCCCCCCCcccCCCchhhcCCCcccCCCCCCcccccChHHHHHHHHHHHHHHHHHhhhhhccCCCccccCCChhhHHH
Q psy9783 397 LWKTRKAPQPLVWDTLSDAVAGSSKETDGGGLKDQRVWSVAECARVFERSVRELKTKFDAAVEKDEHLVWDKDDKPAMDF 476 (726)
Q Consensus 397 ~w~~~~~P~pl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~s~~~L~~~l~~~~~~~~~l~FDKDDd~hmDF 476 (726)
++ ......||+||+.||+|
T Consensus 230 -----~~--------------------------------------------------------~~~~~~~d~dd~~~i~~ 248 (426)
T d1yovb1 230 -----QP--------------------------------------------------------FGEGVPLDGDDPEHIQW 248 (426)
T ss_dssp -----CT--------------------------------------------------------TSTTCCCCTTCHHHHHH
T ss_pred -----cc--------------------------------------------------------ccccCCCCCCCHHHHHH
Confidence 00 00123489999999999
Q ss_pred HHHHHHHhHHhcCCCCCCHHHHHHhhcCCCcchhHHHHHHHHHHHHHHHHHHhhhhcccchhhhccCCCCCCcccccccc
Q psy9783 477 VAACANIRAHVFSIPEKSRFDIKSMAGNIIPAIATSNAIVAGLVVLHAIHVLQARFSSCQTVYLRKKPNHRDQMIVPEKY 556 (726)
Q Consensus 477 VtAAANLRA~nY~Ip~~s~~~vK~IAGnIIPAIATTnAIVAGLvvlEl~KlL~~k~e~~rn~flnl~pn~~~~~~vP~~~ 556 (726)
|+++||+||.+|+|+..+++.+|++|||||||||||||||||++++|++|++.++....+|.|+-.... ....+ ..
T Consensus 249 i~~~a~~ra~~~~I~~~~~~~~k~ia~nIIPaiatTnAIVagl~~~E~iK~lt~~~~p~~n~~~~~~~~---~~~~~-~~ 324 (426)
T d1yovb1 249 IFQKSLERASQYNIRGVTYRLTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVD---GLYTY-TF 324 (426)
T ss_dssp HHHHHHHHHHHTTCCCCCHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHHHCSSCCCCSEEEEECSB---SCEEE-EE
T ss_pred HHHHHHHHHHhcCCCCccHHHHHHHhhccccccccHHHHHHHHHHHHHHHHHhcCCccccceEEEecCC---CceEe-ee
Confidence 999999999999999999999999999999999999999999999999999998655555544422211 12233 33
Q ss_pred CCCCCCCCCCCCCCCeEEEEEECCCCcHHHHHHHHHhc-ccCCccceeEEE--ecCCeEEEe----ccccccccccCCch
Q psy9783 557 LTAPNPTCPVCSPKPQRTIGLDVTKMTVAEFEEAVLKK-TLNMSAMVDVMV--EASGSVIIS----SEEGETEANNDKPL 629 (726)
Q Consensus 557 ~~ePnp~C~vC~~~~~~tl~id~~~~TL~~lid~ilk~-~l~m~~~pdV~~--~~~G~ll~s----s~e~e~~~nl~k~L 629 (726)
..+|+|+|.||+..+ +++.++ .++||++|++++.++ +|+|.. |+++. .+.+.+||. +.+.++++||+|+|
T Consensus 325 ~~~k~~~C~vC~~~~-~~~~~~-~~~tL~~li~~~~~~~~l~~~~-p~~~~~~~~~~~~Ly~~~~~~le~~~~~nl~k~L 401 (426)
T d1yovb1 325 EAERKENCPACSQLP-QNIQFS-PSAKLQEVLDYLTNSASLQMKS-PAITATLEGKNRTLYLQSVTSIEERTRPNLSKTL 401 (426)
T ss_dssp CCCCCTTCTTTCSSC-BCCC-------CTTHHHHTTTCSSSCCSS-CCEECC-----CEECCCC----CGGGSTTC----
T ss_pred eccCCCCCCeeCCce-EEEEEC-CCCCHHHHHHHHHHhhCcCccC-CcceeeecCCCcEEEecCCchhhHHhhhhhcCCH
Confidence 567999999999865 345444 479999999999776 689988 99854 444466662 34678999999999
Q ss_pred hhh
Q psy9783 630 EHG 632 (726)
Q Consensus 630 ~el 632 (726)
+||
T Consensus 402 ~eL 404 (426)
T d1yovb1 402 KEL 404 (426)
T ss_dssp ---
T ss_pred HHh
Confidence 998
|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|