O15182 CETN3_HUMAN
Gene name: CETN3
Protein name: Centrin-3
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301
- cytoskeleton organization GO:0007010
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75596 | CLEC3A | 0.99655 | anatomical structure development GO:0048856 |
| 2 | Q92466 | DDB2 | 0.81574 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 3 | Q9HBE4 | IL21 | 0.81276 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | P0C843 | LINC00032 | 0.78984 | |
| 5 | Q15388 | TOMM20 | 0.75378 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 6 | P62753 | RPS6 | 0.74522 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q5JUX0 | SPIN3 | 0.71219 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 reproduction GO:0000003 |
| 8 | Q9BQ24 | ZFYVE21 | 0.70711 | |
| 9 | Q9UBV4 | WNT16 | 0.70711 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 10 | Q9H9S5 | FKRP | 0.70711 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 protein maturation GO:0051604 |
20 40 60 80 100 AA: MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .....................DD............................................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[R]: RselvvdktkRkkRR RICH_[KR]: RselvvdKtKRKKRR
120 140 160 AA: EEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI STMI: DO_DISOPRED3: ................................................................... DO_IUPRED2A: ........................................DDD........................ DO_SPOTD: ................................................................... CONSENSUS: ................................................................... CONSENSUS_MOBI: ...................................................................