O75596 CLC3A_HUMAN
Gene name: CLEC3A
Protein name: C-type lectin domain family 3 member A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O15182 | CETN3 | 0.99655 | cell cycle GO:0007049 cell division GO:0051301 cytoskeleton organization GO:0007010 ... |
| 2 | Q6W0C5 | DPPA3 | 0.99655 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 3 | Q92466 | DDB2 | 0.80936 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q9HBE4 | IL21 | 0.80201 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | P0C843 | LINC00032 | 0.78711 | |
| 6 | Q15388 | TOMM20 | 0.76369 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular protein modification process GO:0006464 ... |
| 7 | Q9H2U6 | LINC00597 | 0.76339 | |
| 8 | Q9UBV4 | WNT16 | 0.76339 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 9 | Q6IS24 | GALNT17 | 0.76339 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 10 | P62753 | RPS6 | 0.75599 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGG STMI: SSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: .........................DDDDDDDDDDDDDDD............................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.............................................................. CONSENSUS: DDDDDDDDDDDDDDDD.............................................................. CONSENSUS_MOBI: .............................................................................. RICH_[R]: RlkaRkhskRRvR RICH_[KR]: RlKaRKhsKRR
120 140 160 180 AA: ILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ STMI: DO_DISOPRED3: ................................................................................................. DO_IUPRED2A: ................................................................................................. DO_SPOTD: ................................................................................................. CONSENSUS: ................................................................................................. CONSENSUS_MOBI: .................................................................................................