O75920 SERF1_HUMAN

Gene name: SERF1A
Protein name: Small EDRK-rich factor 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P24844 MYL9 0.82544 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
2 Q9BY42 RTF2 0.82353 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
3 Q9NRQ5 SMCO4 0.81517
4 Q86UB2 BIVM 0.8146 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
5 Q9Y324 FCF1 0.81056 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
6 Q9P0M6 MACROH2A2 0.80073 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 P42127 ASIP 0.79668 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
8 A0A1B0GTY4 TEX50 0.79427
9 Q6NW29 RWDD4 0.79257
10 Q9Y291 MRPS33 0.79145 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412

                                           20                  40                  60                  80                 100
AA:                      MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDD..................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
RICH_[QS]:                                                SQrkQSSggQkSeS                                                     
RICH_[K]:                            KnmKKtqeisKgKrKedsltasqrK                                                               
RICH_[S]:                                             SltaSqrkqSSggqkSeSkmS                                                  
RICH_fLPS_[K]:                  elarqKnmKKtqeisKgKrK                                                                         
RICH_MOBI_[QS]:                                           SQrkQSSggQkSeS                                                     
RICH_MOBI_[K]:                       KnmKKtqeisKgKrKedsltasqrK                                                               
RICH_fLPS_MOBI_[K]:             elarqKnmKKtqeisKgKrK                                                                         

                                   
AA:                      SFYEDFCCWI
STMI:                              
DO_DISOPRED3:            ..........
DO_IUPRED2A:             ..........
DO_SPOTD:                ..........
CONSENSUS:               ..........
CONSENSUS_MOBI:          ..........