Q6W0C5 DPPA3_HUMAN

Gene name: DPPA3
Protein name: Developmental pluripotency-associated protein 3

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- embryo development GO:0009790

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6W0C5 DPPA3 1 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
2 O75596 CLEC3A 0.99655 anatomical structure development GO:0048856
3 Q92466 DDB2 0.81574 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
4 Q9HBE4 IL21 0.81276 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 P0C843 LINC00032 0.78984
6 Q15388 TOMM20 0.75378 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
7 P62753 RPS6 0.74522 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 Q5JUX0 SPIN3 0.71219 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
reproduction GO:0000003
9 Q9HBV1 POPDC3 0.70711 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 Q9UBV4 WNT16 0.70711 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MDPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAVLREIEDEWLYSRRGVRTLLSVQREKMARLR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDD......................................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.............D.....D.D...........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............D.....DDDDDDDD......................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................................

                                          120                 140 
AA:                      YMLLGGVRTHERRPTNKEPKGVKKESRPFKCPCSFCVSNGWDPSENARIGNQDTKPLQP
STMI:                                                                               
DO_DISOPRED3:            ..........DDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDD
DO_IUPRED2A:             .....DDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....DDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................................DDDDDDDDDDDDDDDDDDDD
RICH_[R]:                       RtheRRptnkepkgvkkesR                                
RICH_[KR]:                      RtheRRptnKepKgvKKesR