P62081 RS7_HUMAN
Gene name: RPS7
Protein name: 40S ribosomal protein S7
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- ribosome biogenesis GO:0042254
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96B42 | TMEM18 | 0.70711 | |
| 2 | Q96H40 | ZNF486 | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | O75596 | CLEC3A | 0.64594 | anatomical structure development GO:0048856 |
| 4 | Q9HBE4 | IL21 | 0.64232 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q92466 | DDB2 | 0.60718 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 6 | Q8IZU8 | DSEL | 0.58356 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 7 | P0DMQ9 | C8orf89 | 0.57735 | |
| 8 | P0C843 | LINC00032 | 0.5585 | |
| 9 | Q9HBH0 | RHOF | 0.55815 | cytoskeleton organization GO:0007010 immune system process GO:0002376 signal transduction GO:0007165 ... |
| 10 | Q56A73 | SPIN4 | 0.54545 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 reproduction GO:0000003 |
20 40 60 80 100 AA: MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKEIEVGGGRKAIIIFVPVPQLKSFQKIQVRLVRELEKKFSGKHVVFIAQRRI STMI: DO_DISOPRED3: DDDDDD.DDDD......................................................................................... DO_IUPRED2A: ..............D..................................................................................... DO_SPOTD: DDDDDDD............................................................................................. CONSENSUS: DDDDDD.............................................................................................. CONSENSUS_MOBI: DDDD................................................................................................
120 140 160 180 AA: LPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL STMI: DO_DISOPRED3: ...DDDDDDDDDD................................................................................. DO_IUPRED2A: ...DDDDDDDDDDDDDDDD........................................................................... DO_SPOTD: ..DDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: ...DDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: .............................................................................................. RICH_[KR]: RtKnKqKRpR