Q9NQG1 MANBL_HUMAN

Gene name: MANBAL
Protein name: Protein MANBAL

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UQ80 PA2G4 0.71186 biosynthetic process GO:0009058
cell death GO:0008219
cell differentiation GO:0030154
...
2 P42127 ASIP 0.71092 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
3 Q96A08 H2BC1 0.70351 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
4 P24844 MYL9 0.69099 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 Q9NX58 LYAR 0.68965 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 Q9NRQ5 SMCO4 0.68907
7 Q15651 HMGN3 0.68712 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
8 Q86V59 PNMA8A 0.68697
9 Q9Y324 FCF1 0.68279 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
10 Q03169 TNFAIP2 0.68246 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80               
AA:                      MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSAEVTRKPKAAVPSVNKRPKKETKKKR
STMI:                                           MMMMMMMMMMMMMMMMMMMMM                                         
DO_DISOPRED3:            DDDDD...........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             D..DDD..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDD.................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDD.................                     ....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................                     ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                                               EAEAEpsEprsAEvtrkpkAA                
RICH_[AP]:                                                                  AePsePrsAevtrkPkAAvP              
RICH_[E]:                                                                EaEaEpsEprsaE                        
RICH_[K]:                                                                                KpKaavpsvnKrpKKetKKK 
RICH_fLPS_[K]:                                                                           KpKaavpsvnKrpKKetKKK 
RICH_MOBI_[AE]:                                                          EAEAEpsEprsAEvtrkpkAA                
RICH_MOBI_[E]:                                                           EaEaEpsEprsaE                        
RICH_MOBI_[K]:                                                                           KpKaavpsvnKrpKKetKKK 
RICH_MOBI_[KV]:                                                                               VpsVnKrpKK      
RICH_fLPS_MOBI_[K]:                                                                      KpKaavpsvnKrpKKetKKK