Citrus Sinensis ID: 001748

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102

MEGRRHSVDIPISRTLIALRRVRSLRDPSTNSMSKFSALLDNVNWETNSSNGISSRFDNGCKGLFESESLSINGLKKEKDDDLELHCGLDNSKFMSFQNLGWIDTDNPNLIKQVDRLDNYQSKEEEVDGHESLGERRCINHLNREFDMCCSMPYSQPMEDVGFCKGPNVGSSSMEDIDQSASIWKLQYKNEGRLCGAANGGASRVSTPCPSISEIMANHSRSLFANEEIDVNQSHHGCGLSCCWSRTPRSRQSNLSSDLEDNPLLSGEIGETAHYGRSGHKLINNEISTYSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLSSSESSLDLNDSKLCLRYAHDKDGDSHCTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAPVSAKENKPSFSLFSCSRWVQQSRSTTERETDSDYSDYFSEKPMIRARHTLTCSSDCGSQMSHNCCHKTDVVRALRSSEGNVLSTGTVSFHRSIQDDISRSAGCEISSLNRNDYYCQVLSPQEPETQPSCFPRTLRLQKKLRASDTSEMVCTSNKLALSIPKKTSFDTYISVDDPHVFYGSSNYHHSSVRDEDGPQENSDVLCWRTPTFPLKKAGQMAHQRKRSNIMDCILPCTNAK

cccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccccccccccccHHHHHHccccccccEEEccccccccHHHHHHHHcccccccccccEEEEEcccccccHHHHHHHHHHccccccccEEEEEccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHcccccEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccccccHHHHHccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccc

cccccccccccHHHHHHHHHHHHcccccccccHHHccccHccccEEccccccEEEEEccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccEEcccccccccHcccccccccccEEEEcccccccccccccccccccccccccccccccccHHcccccccccccHHHHHcccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccEEEEEcccHHHHHHHHHHHHcccccccccccEEEEEEcHHHccHHHHHHHHHHHHcccccEEEEEEEccHHHccHHHHcccEEEEcccccHHHHHHHHHHHHHHccccEcHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccccccccHccHHHHHccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccEEEEEccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEccccEEEEcccccccccEEEcccccEEccccccccccccccccccccccEEEcccccccHHHHHHHHHHccccccHcEEccccccc

megrrhsvdipisRTLIALRRVrslrdpstnsmSKFSALLDNvnwetnssngissrfdngckglfeseslsinglkkekdddlelhcgldnskfmsfqnlgwidtdnpnlikqvdrldnyqskeeevdgheslgerrcINHLNRefdmccsmpysqpmedvgfckgpnvgsssmedidQSASIWKLQYKnegrlcgaanggasrvstpcpsiseimanhsrslfaneeidvnqshhgcglsccwsrtprsrqsnlssdlednpllsgeigetahygrsghkLINNEIstysetpwslsqkfrpnffdelvGQNVVVRSLLSAISRGMVTsfylfhgprgtgktSASRIFAAALNclsledqkpcglcrecalfssgrsrdvkevdsvrinrsdrvgslmksaflppfssrfKIFIIDECQLLHGETWATVLNSLENISQHVVFVMItpeldklprsalsrsqkyhfpkikdgdiASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLalssdtsnTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLsssessldlndskLCLRyahdkdgdshctisprdsfkhlvrgscvgdkanklgaLEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLcapvsakenkpsfslfscsrwvqqsrstteretdsdysdyfsekpmirarhtltcssdcgsqmshncchkTDVVRALRSsegnvlstgtVSFHRSIQDdisrsagceisslnrndyycqvlspqepetqpscfprtLRLQKKlrasdtsemvctsnklalsipkktsfdtyisvddphvfygssnyhhssvrdedgpqensdvlcwrtptfplkkagqmAHQRkrsnimdcilpctnak

megrrhsvdipisrtlialrrvrslrdpstnsmSKFSALLDNVNWETNSSNGISSRFDNGCKGLFESESLSINGLKKEKDDDLELHCGLDNSKFMSFQNLGWIDTDNPNLIKQVDRLDNYQSKeeevdgheslgerRCINHLNREFDMCCSMPYSQPMEDVGFCKGPNVGSSSMEDIDQSASIWKLQYKNEGRLCGAANGGASRVSTPCPSISEIMANHSRSLFANEEIDVNQSHHGCGLSCCWSRTPRSRQSNLSSDLEDNPLLSGEIGETAHYGRSGHKLINNEISTYSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECAlfssgrsrdvkevdsvrinrsdrvgslmksaflppFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSalsrsqkyhfpkikdgdiaSRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLalssdtsntvIRARElmrskidpMQLISQLANLIMDILAGKCLEDCSEARKNFfgkhtseadMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLSSSESSLDLNDSKLCLRYAHDKDGDSHCTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAPVSAKenkpsfslfscsrwvqqsrstteretdsdysdyfsekpmiRARHTLTCSSDCGSQMSHNCCHKTDVVRALRSSEGNVLSTGTVSFHRSIQDDISRSAGCEISSLNRNDYYCQVLSpqepetqpscfpRTLRLQKKlrasdtsemvctsnklalsipkktsFDTYISVDDPHVFYGSSNYHHSSVRDEDGPQENSDVLCWRTPTFPLKkagqmahqrkrsnimdcilpctnak

MEGRRHSVDIPISRTLIALRRVRSLRDPSTNSMSKFSALLDNVNWETNSSNGISSRFDNGCKGLFESESLSINGLKKEKDDDLELHCGLDNSKFMSFQNLGWIDTDNPNLIKQVDRLDNYQSKEEEVDGHESLGERRCINHLNREFDMCCSMPYSQPMEDVGFCKGPNVGSSSMEDIDQSASIWKLQYKNEGRLCGAANGGASRVSTPCPSISEIMANHSRSLFANEEIDVNQSHHGCGLSCCWSRTPRSRQSNLSSDLEDNPLLSGEIGETAHYGRSGHKLINNEISTYSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVsddelldlldlalssdtsNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVAllqlsssessldlndsklCLRYAHDKDGDSHCTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAPVSAKENKPSFSLFSCSRWVQQSRSTTERETDSDYSDYFSEKPMIRARHTLTCSSDCGSQMSHNCCHKTDVVRALRSSEGNVLSTGTVSFHRSIQDDISRSAGCEISSLNRNDYYCQVLSPQEPETQPSCFPRTLRLQKKLRASDTSEMVCTSNKLALSIPKKTSFDTYISVDDPHVFYGSSNYHHSSVRDEDGPQENSDVLCWRTPTFPLKKAGQMAHQRKRSNIMDCILPCTNAK

***********ISRTLIALR******************LLDNVNW**************GCKGLF*****************LELHCGLDNSKFMSFQNLGWIDTDNPNLIKQVDRL******************RRCINHLNREFDMCCSMPYSQPMEDVGFCK***************ASIWKLQYKNEGRLCGAAN**********************SLFANEEIDVNQSHHGCGLSCCWS*****************************YGRSGHKLINNEISTYSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECALFSS*******************VGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLP*******QKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFG******************************QTTWLTVALLQL***********SKLCLRYAHDKDGDSHCTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAPVSAKENKPSFSLFSCSRWV*************************RARHTLTCSSDCGSQMSHNCCHKTDVVRALRSSEGNVLSTGTVSFHRSIQDDISRSAGCEISSLNRNDYYCQVL******************************VCTSNKLALSIPKKTSFDTYISVDDPHVFYGS*******************VLCWRTPTFPLK*************IMDCILP*****

*********IPISRTLIALRRVR*********************************************************************************************************************************************************************************************************************************************************************************LSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQL********************************************************************AT*****************LSSLHVNHGLAVAELEFHH************LIASTLQSVLGCNVEIRLLC*************************************************************************************************************************************************************ALSIPKKTSFDTYIS*****************************VLCWRTPTFP******************CILPCTN**

********DIPISRTLIALRRVRSLRDPSTNSMSKFSALLDNVNWETNSSNGISSRFDNGCKGLFESESLSINGLKKEKDDDLELHCGLDNSKFMSFQNLGWIDTDNPNLIKQVDRLDNYQ***********LGERRCINHLNREFDMCCSMPYSQPMEDVGFCKGPNVGSSSMEDIDQSASIWKLQYKNEGRLCGAANGGASRVSTPCPSISEIMANHSRSLFANEEIDVNQSHHGCGLSCCWSR*************EDNPLLSGEIGETAHYGRSGHKLINNEISTYSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLSSSESSLDLNDSKLCLRYAHDKDGDSHCTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAPVSAKENKPSFSLFSCS*****************YSDYFSEKPMIRARHTLTCSSDCGSQMSHNCCHKTDVVRALRSSEGNVLSTGTVSFHRSIQDDISRSAGCEISSLNRNDYYCQVLSPQEPETQPSCFPRTLRLQKKL*********CTSNKLALSIPKKTSFDTYISVDDPHVFYGSSNY**************SDVLCWRTPTFPL**********KRSNIMDCILPCTNAK

******SVDIPISRTLIALRRVRSLRDPSTNSMSKFSALLDNVNWETNSSNGISSRFDNGCKGLFESESLSINGLKKEKDDDLELHCGLDNSKFMSFQNLGWID*DNPNLIKQVDRLDNYQSKEEE*DGHESLGERRCINHLNREFDMCCSMPYSQP***VGFC*******************************************************SRSLFANEEIDVNQSHHGCGLSCCWSRTPRSR***L**DLEDNPLL**********************STYSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLSSSE*****************************************************YKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAPVS************************************************************NCCHKTDVVRALRSSEGNVLSTGTVSF***************************VLSP**P*TQPSCFPRTLRLQKKLRASDTSEMVCTSNKLALSIPKKTSFDTYISVDDPHVFYG****************ENSDVLCWRTPTFPLKKAGQMAHQRKRSNIMDCILPCTN**

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1018	2.2.26 [Sep-21-2011]
P09122		563	DNA polymerase III subuni	yes	no	0.357	0.646	0.293	9e-44
Q89A95		370	DNA polymerase III subuni	yes	no	0.277	0.764	0.302	4e-36
P43746		688	DNA polymerase III subuni	yes	no	0.242	0.359	0.318	6e-36
P75177		681	DNA polymerase III subuni	yes	no	0.279	0.418	0.309	8e-36
P57553		361	DNA polymerase III subuni	yes	no	0.342	0.966	0.259	1e-35
P06710		643	DNA polymerase III subuni	N/A	no	0.280	0.444	0.306	9e-35
P74876		642	DNA polymerase III subuni	yes	no	0.249	0.395	0.321	3e-34
P47658		597	DNA polymerase III subuni	yes	no	0.247	0.422	0.338	4e-34
P63975		578	DNA polymerase III subuni	yes	no	0.233	0.411	0.340	1e-32
P63976		578	DNA polymerase III subuni	yes	no	0.233	0.411	0.340	1e-32

>sp\|P09122\|DPO3X_BACSU DNA polymerase III subunit gamma/tau OS=Bacillus subtilis (strain 168) GN=dnaX PE=3 SV=3	Back alignment and function desciption

 Score =  179 bits (454), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 109/372 (29%), Positives = 197/372 (52%), Gaps = 8/372 (2%)

Query: 296 SLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNC 355
           +L + FRP  F+++VGQ  + ++L +A+ +   +  YLF GPRGTGKTSA++IFA A+NC
Sbjct: 5   ALYRVFRPQRFEDVVGQEHITKTLQNALLQKKFSHAYLFSGPRGTGKTSAAKIFAKAVNC 64

Query: 356 LSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFI 415
                 +PC  C  C   ++G   DV E+D+   N  D +  +       P +  +K++I
Sbjct: 65  EHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEIRDIRDKVKFAPSAVTYKVYI 124

Query: 416 IDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIA 475
           IDE  +L    +  +L +LE   +H +F++ T E  K+P + +SR Q++ F +I    I 
Sbjct: 125 IDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIPLTIISRCQRFDFKRITSQAIV 184

Query: 476 SRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQ-LSLLGKKITLSLAYELIGIV 534
            R+ +I   E +  ++ +L+ IA+ ++G +RDA  LLDQ +S  G  + +  A  + G V
Sbjct: 185 GRMNKIVDAEQLQVEEGSLEIIASAADGGMRDALSLLDQAISFSGDILKVEDALLITGAV 244

Query: 535 SDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKC---LEDC 591
           S   +  L       + S+ +    EL++   DP +LI  +     D+L  K    LE  
Sbjct: 245 SQLYIGKLAKSLHDKNVSDALETLNELLQQGKDPAKLIEDMIFYFRDMLLYKTAPGLEGV 304

Query: 592 SEARK--NFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQL--SSSES 647
            E  K    F + + +   Q L   + IL+++ ++++ + H   +  VA++++  +S +S
Sbjct: 305 LEKVKVDETFRELSEQIPAQALYEMIDILNKSHQEMKWTNHPRIFFEVAVVKICQTSHQS 364

Query: 648 SLDLNDSKLCLR 659
           + DL +  + ++
Sbjct: 365 AADLPEVDMLMK 376

DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria.
Bacillus subtilis (strain 168) (taxid: 224308)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 7

>sp\|Q89A95\|DPO3X_BUCBP DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaX PE=3 SV=1	Back alignment and function description

>sp\|P43746\|DPO3X_HAEIN DNA polymerase III subunit tau/gamma OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaX PE=3 SV=1	Back alignment and function description

>sp\|P75177\|DPO3X_MYCPN DNA polymerase III subunit gamma/tau OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaX PE=3 SV=1	Back alignment and function description

>sp\|P57553\|DPO3X_BUCAI DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaX PE=3 SV=1	Back alignment and function description

>sp\|P06710\|DPO3X_ECOLI DNA polymerase III subunit tau OS=Escherichia coli (strain K12) GN=dnaX PE=1 SV=1	Back alignment and function description

>sp\|P74876\|DPO3X_SALTY DNA polymerase III subunit tau OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaX PE=3 SV=2	Back alignment and function description

>sp\|P47658\|DPO3X_MYCGE DNA polymerase III subunit gamma/tau OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaX PE=3 SV=3	Back alignment and function description

>sp\|P63975\|DPO3X_MYCTU DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis GN=dnaX PE=3 SV=1	Back alignment and function description

>sp\|P63976\|DPO3X_MYCBO DNA polymerase III subunit gamma/tau OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaX PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1018
255540419		1025	replication factor C / DNA polymerase II	0.982	0.975	0.593	0.0
224119534		965	predicted protein [Populus trichocarpa]	0.915	0.965	0.601	0.0
224133772		907	predicted protein [Populus trichocarpa]	0.853	0.958	0.577	0.0
297733651		875	unnamed protein product [Vitis vinifera]	0.751	0.874	0.641	0.0
356513662		976	PREDICTED: uncharacterized protein LOC10	0.923	0.963	0.537	0.0
356563163		976	PREDICTED: uncharacterized protein LOC10	0.917	0.956	0.531	0.0
356518927		979	PREDICTED: uncharacterized protein LOC10	0.923	0.960	0.523	0.0
356507313		952	PREDICTED: uncharacterized protein LOC10	0.897	0.960	0.531	0.0
357477253		936	DNA polymerase III subunit gamma/tau [Me	0.877	0.954	0.539	0.0
358348981		903	DNA polymerase III subunit gamma/tau [Me	0.867	0.977	0.493	0.0

>gi\|255540419\|ref\|XP_002511274.1\| replication factor C / DNA polymerase III gamma-tau subunit, putative [Ricinus communis] gi\|223550389\|gb\|EEF51876.1\| replication factor C / DNA polymerase III gamma-tau subunit, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1076 bits (2782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1042 (59%), Positives = 740/1042 (71%), Gaps = 42/1042 (4%)

Query: 1    MEGRRHSVDIPISRTLIALRRVRSLRDPSTNSMSKFSALLDNVNWETNSSNGISSRFDNG 60
            M+GRRHSVDIPISRTLIALRRVRSLRDPSTN MSKFSALL+NVNWETNS+NGIS +F  G
Sbjct: 2    MDGRRHSVDIPISRTLIALRRVRSLRDPSTNCMSKFSALLENVNWETNSTNGISLQFTGG 61

Query: 61   CK-------GLFESESLSINGLKKEKDDDLELHCGLDNSKFMSFQNLGWIDTDNPNL--- 110
            C+       G     +  +N ++ E+ DD  L   L  SK     NL     +N      
Sbjct: 62   CQQGGSDHNGFARLNNSGLNRIRDEEIDDFHLQHDLVKSK----PNLNLAREENAGASLR 117

Query: 111  IKQVDRLDNYQSKEEEVDGHESLGERRCINHLNREFDMCCSMPYSQPMEDVGFCKGPNVG 170
             K+++ LDN    +E+V G +SL ER  INH ++  ++ C  P S    +        + 
Sbjct: 118  TKKLEGLDNGVLYQEDVSGKKSLSERYYINHRDKGLELTCITPLSNAESNNELI----LR 173

Query: 171  SSSMEDIDQSASIWKLQYKNEGRLCGAANGGASRVSTPCPSISEIMANHSRSLFANEEID 230
            S  +E  DQS S  K QYKN  +  G      SRV +PC S+S+ ++++  SL ANE+ D
Sbjct: 174  SPKVECFDQSISRKKSQYKNHDKSSGMVGDILSRVGSPCLSVSDALSSYGVSLLANEDTD 233

Query: 231  -VNQSHHGCGLSCCWSRTPRSRQSNLSSDLEDNPLLSGEIGETAHYGRSGHKLINNEIST 289
             + Q+  GCG+SCCW+RTPR R+SN  SD+E  PLL  ++ ET  +G+   KLI NE   
Sbjct: 234  FMVQNDRGCGISCCWTRTPRFRESNPYSDVEGRPLLLKDLAETIPHGQRNLKLITNE--- 290

Query: 290  YSETPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIF 349
               +P S SQKFRP  F+ELVGQNVVVRSLLSAI++G VTS YLFHGPRGTGKTSASRIF
Sbjct: 291  ---SPRSFSQKFRPKSFEELVGQNVVVRSLLSAIAQGRVTSLYLFHGPRGTGKTSASRIF 347

Query: 350  AAALNCLSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSS 409
            AAALNCLSLE+ KPCGLCREC  F SGRSRDVKEVDSVRINR +R+ +L+K+A +PP SS
Sbjct: 348  AAALNCLSLEEYKPCGLCRECVQFFSGRSRDVKEVDSVRINRVERIRALIKNAAIPPVSS 407

Query: 410  RFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKI 469
            RFK+FI+DEC LL GETWAT+LNSLEN+ QHVVFVM+TP LDKLPRSA++ SQKYHFPKI
Sbjct: 408  RFKVFIVDECHLLQGETWATILNSLENLPQHVVFVMVTPHLDKLPRSAVTHSQKYHFPKI 467

Query: 470  KDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYE 529
            KD DIA RL+ IC+EE I+FDQ ALDFIAAKSNGS+RDAEM+LDQ+SLLGK+IT+SLAYE
Sbjct: 468  KDADIAVRLKNICIEEGIDFDQVALDFIAAKSNGSLRDAEMMLDQMSLLGKRITMSLAYE 527

Query: 530  LIGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLE 589
            L G+VSDDELLDLLDLALSSDTSNTVIRARELMRS+IDPMQL+SQLAN+IMD+LAGKC E
Sbjct: 528  LAGVVSDDELLDLLDLALSSDTSNTVIRARELMRSRIDPMQLVSQLANIIMDMLAGKCQE 587

Query: 590  DCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLSSSESS- 648
            D SE R+ F  +H +EADMQ+LS ALK+LSETEKQLRMSK Q+TWLTVALLQLSS E+  
Sbjct: 588  DSSEVRRKFSSRHATEADMQRLSHALKVLSETEKQLRMSKSQSTWLTVALLQLSSLEAPF 647

Query: 649  LDLNDSKLCLRYAHDKDGDSHCTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIW 708
            L+ ND    +R A D+DGD   T S  +S K L+  SC   K +  G   D K TLESIW
Sbjct: 648  LNANDPNPSIRNAQDRDGDFCSTSSTGESLKLLLPCSCEDGKLHNGG---DCKATLESIW 704

Query: 709  KTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQS 768
            K ATELCQSNSL+ FL KQGKLSSL VN  LAVAELEFH  DYVS+AEKSWK IAS LQS
Sbjct: 705  KNATELCQSNSLRNFLGKQGKLSSLCVNQDLAVAELEFHRPDYVSKAEKSWKTIASALQS 764

Query: 769  VLGCNVEIRL---LC--APVSAKENKPSFSLFSCSRWV-QQSRSTTERETDSDYSDYFSE 822
            +LG NVEIR+   LC  A    K  K  FSLFSCSR V ++S+  TE  +DSDYS + SE
Sbjct: 765  ILGRNVEIRINLVLCDSALKCKKLRKLPFSLFSCSRRVLRRSQLPTECGSDSDYSGHMSE 824

Query: 823  KPMIRARHTLTCSSDCGSQMSHNCCHKTDVVRALRSSEGNVLSTGTVSFHRSIQDDISRS 882
            KP+   R  LTCSSDC SQM H    + DVV+ALR++EGNVLS G  S HRS+QDD  + 
Sbjct: 825  KPIKGDRVILTCSSDCRSQMPHYIFPRVDVVKALRNNEGNVLSIGRNSSHRSLQDDTLKI 884

Query: 883  AGCEISSLNR--NDYYCQVLSPQEPETQPSCFPRTLRLQKKLRASDTSEMVCT----SNK 936
                  SL         +  S +E E QP+CF RTLRLQK+L +++ S +VC     +NK
Sbjct: 885  PAYGNDSLKEEGGSLGYETFSSEETEEQPNCFSRTLRLQKRLPSTNHSRIVCMGNQEANK 944

Query: 937  LALSIPKKTSFDTYISVDDPHVFYGSSNYHHSSVRDEDGPQENSDVLCWRTPTFPLKKAG 996
            LALS P K S +T  S  +      S+N  ++S R EDG  ENS  LCWRTPTF   KA 
Sbjct: 945  LALSFPAKRSIETCNSTTNGSYVLNSNNDTNNS-RSEDGLTENSAALCWRTPTFTQSKAW 1003

Query: 997  QMAHQRKRSNIMDCILPCTNAK 1018
            Q+ H R+RS +   +LPC +AK
Sbjct: 1004 QLTHHRRRSPLARWVLPCASAK 1025

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224119534\|ref\|XP_002318098.1\| predicted protein [Populus trichocarpa] gi\|222858771\|gb\|EEE96318.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224133772\|ref\|XP_002321657.1\| predicted protein [Populus trichocarpa] gi\|222868653\|gb\|EEF05784.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297733651\|emb\|CBI14898.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356513662\|ref\|XP_003525530.1\| PREDICTED: uncharacterized protein LOC100786687 [Glycine max]	Back alignment and taxonomy information

>gi\|356563163\|ref\|XP_003549834.1\| PREDICTED: uncharacterized protein LOC100808544 [Glycine max]	Back alignment and taxonomy information

>gi\|356518927\|ref\|XP_003528127.1\| PREDICTED: uncharacterized protein LOC100812040 [Glycine max]	Back alignment and taxonomy information

>gi\|356507313\|ref\|XP_003522412.1\| PREDICTED: uncharacterized protein LOC100819111 [Glycine max]	Back alignment and taxonomy information

>gi\|357477253\|ref\|XP_003608912.1\| DNA polymerase III subunit gamma/tau [Medicago truncatula] gi\|355509967\|gb\|AES91109.1\| DNA polymerase III subunit gamma/tau [Medicago truncatula]	Back alignment and taxonomy information

>gi\|358348981\|ref\|XP_003638519.1\| DNA polymerase III subunit gamma/tau [Medicago truncatula] gi\|355504454\|gb\|AES85657.1\| DNA polymerase III subunit gamma/tau [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1018
TAIR\|locus:2121934		857	AT4G24790 [Arabidopsis thalian	0.637	0.757	0.500	2.7e-192
TAIR\|locus:2065299		1218	STI "STICHEL" [Arabidopsis tha	0.371	0.310	0.467	5.4e-102
TAIR\|locus:2012497		1116	AT1G14460 [Arabidopsis thalian	0.368	0.336	0.462	2.1e-101
TAIR\|locus:2172013		966	AT5G45720 [Arabidopsis thalian	0.565	0.596	0.331	1.4e-84
UNIPROTKB\|Q97RF7		551	dnaX "DNA polymerase III, gamm	0.234	0.433	0.373	7.2e-41
UNIPROTKB\|P09122		563	dnaX "DNA polymerase III subun	0.336	0.609	0.292	6.4e-39
TIGR_CMR\|CHY_2675		511	CHY_2675 "putative DNA polymer	0.335	0.669	0.284	1.4e-38
TIGR_CMR\|CJE_1293		509	CJE_1293 "DNA polymerase III,	0.234	0.469	0.366	2.1e-37
TIGR_CMR\|GSU_0094		579	GSU_0094 "DNA polymerase III,	0.333	0.585	0.335	1.1e-36
TIGR_CMR\|CBU_0659		509	CBU_0659 "DNA polymerase III,	0.233	0.467	0.359	1.9e-36

TAIR\|locus:2121934 AT4G24790 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1560 (554.2 bits), Expect = 2.7e-192, Sum P(4) = 2.7e-192
 Identities = 350/699 (50%), Positives = 452/699 (64%)

Query:   142 LNREFDMCCSMPYSQPMEDVGFCKGPNVGSS--SMEDIDQSASIWKLQYKNEGRLCGAAN 199
             +N E D  CS    +   D+   KG ++  +  S+  ++++ S  + +     +L  +  
Sbjct:   102 INVEGD-ACSRSSERSCSDLSV-KGRDLACNAPSISHVEEAGSGGRYRTHYSTKLASSVG 159

Query:   200 GGASRVSTPCPSISEIMANHSRSLFANEEIDVN-QSHHGCGLSCCWSRTPRSRQSNLSSD 258
                SR+ +P  S      NHS   + +E++D + QS+ GCG++ CWSRTPR R SN SSD
Sbjct:   160 EYGSRLGSPMNS-----TNHS--YYGDEDVDFDSQSNRGCGITYCWSRTPRYRGSNQSSD 212

Query:   259 LEDNPLLSGEIGETAHYGRSGHKLINNEISTYSETPWSLSQKFRPNFFDELVGQNVVVRS 318
             +E+ PLL G     +      H++++           SLSQKFRP  FDELVGQ VVV+ 
Sbjct:   213 VEEYPLLPGNGNGESDVVTPSHEVLSR----------SLSQKFRPKSFDELVGQEVVVKC 262

Query:   319 LLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLS-LEDQKPCGLCRECALFSSGR 377
             LLS I RG +TS YLFHGPRGTGKTS S+IFAAALNCLS     +PCGLC EC  + SGR
Sbjct:   263 LLSTILRGRITSVYLFHGPRGTGKTSTSKIFAAALNCLSQAAHSRPCGLCSECKSYFSGR 322

Query:   378 SRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENI 437
              RDV E DS ++NR   + SL+KSA LPP SSRFK+FIIDECQLL  ETW T+LNSL+N 
Sbjct:   323 GRDVMETDSGKLNRPSYLRSLIKSASLPPVSSRFKVFIIDECQLLCQETWGTLLNSLDNF 382

Query:   438 SQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFI 497
             SQH VF+++T EL+KLPR+ LSRSQKYHF K+ D DI+++L +IC+EE I+FDQ A+DFI
Sbjct:   383 SQHSVFILVTSELEKLPRNVLSRSQKYHFSKVCDADISTKLAKICIEEGIDFDQGAVDFI 442

Query:   498 AAKSNGSIRDAEMLLDQLSLLGKKITLSLAYELIGIVXXXXXXXXXXXXXXXXXXNTVIR 557
             A+KS+GS+RDAE++LDQLSLLGK+IT SLAY+LIG+V                  NTVIR
Sbjct:   443 ASKSDGSLRDAEIMLDQLSLLGKRITTSLAYKLIGVVSDDELLDLLDLAMSSDTSNTVIR 502

Query:   558 ARELMRSKIDPMQLISQLANLIMDILAGKCLEDCSEARKNFFGKHTSEADMQKLSRALKI 617
             ARELMRSKIDPMQLISQLAN+IMDI+AG   E  S  R  F  +HTSE +MQKL  ALKI
Sbjct:   503 ARELMRSKIDPMQLISQLANVIMDIIAGNSQESSSATRLRFLTRHTSEEEMQKLRNALKI 562

Query:   618 LSETEKQLRMSKHQTTWLTVAXXXXXXXXXXXXXXXXXXCLRYAHDKDGDSHCTISPRDS 677
             LS+ EK LR SK+QTTWLTVA                     +A D++G +      +D 
Sbjct:   563 LSDAEKHLRASKNQTTWLTVALLQLSNTDSSS----------FATDENGRNQIN---KDV 609

Query:   678 FKHLVRGSCVGD--KAN-KLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLH 734
                     C GD  K++ + G   +   T+ES+WKT T+LC S+SLK FL K+G+L+SL 
Sbjct:   610 ELSSTSSGCPGDVIKSDAEKGQERNCNETVESVWKTVTDLCCSDSLKRFLWKRGRLTSLT 669

Query:   735 VNHGLAVAELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRL-----LCAPVSAKENK 789
             V+ G+A+AELEF+   +V+RAEKSWKLIA + QSVLGCNVEI++      C+P  + +  
Sbjct:   670 VDKGVAIAELEFYTPQHVARAEKSWKLIADSFQSVLGCNVEIQMNLVISACSPPKSAKAA 729

Query:   790 PS--FSLFSCSRWVQQSRSTTERETDSDYSDYFSEKPMI 826
              S  F LFSCSR +      T R TDSD +   SEKP +
Sbjct:   730 ASLFFGLFSCSRRMLHKSYLTTR-TDSDCA---SEKPAV 764

GO:0003677 "DNA binding" evidence=IEA

GO:0003887 "DNA-directed DNA polymerase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006260 "DNA replication" evidence=IEA

GO:0009360 "DNA polymerase III complex" evidence=IEA

TAIR\|locus:2065299 STI "STICHEL" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2012497 AT1G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2172013 AT5G45720 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q97RF7 dnaX "DNA polymerase III, gamma and tau subunits" [Streptococcus pneumoniae TIGR4 (taxid:170187)]	Back alignment and assigned GO terms

UNIPROTKB\|P09122 dnaX "DNA polymerase III subunit gamma/tau" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_2675 CHY_2675 "putative DNA polymerase III, gamma/tau subunits" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|CJE_1293 CJE_1293 "DNA polymerase III, gamma/tau subunits" [Campylobacter jejuni RM1221 (taxid:195099)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_0094 GSU_0094 "DNA polymerase III, gamma and tau subunits" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|CBU_0659 CBU_0659 "DNA polymerase III, gamma and tau subunits" [Coxiella burnetii RSA 493 (taxid:227377)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1018
TIGR02397		355	TIGR02397, dnaX_nterm, DNA polymerase III, subunit	1e-113
COG2812		515	COG2812, DnaX, DNA polymerase III, gamma/tau subun	2e-72
PRK05563		559	PRK05563, PRK05563, DNA polymerase III subunits ga	3e-71
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	6e-60
PRK14953		486	PRK14953, PRK14953, DNA polymerase III subunits ga	2e-59
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	3e-58
PRK07133		725	PRK07133, PRK07133, DNA polymerase III subunits ga	9e-57
PRK14965		576	PRK14965, PRK14965, DNA polymerase III subunits ga	2e-55
PRK05896		605	PRK05896, PRK05896, DNA polymerase III subunits ga	3e-55
PRK06305		451	PRK06305, PRK06305, DNA polymerase III subunits ga	2e-54
PRK14963		504	PRK14963, PRK14963, DNA polymerase III subunits ga	3e-54
PRK14962		472	PRK14962, PRK14962, DNA polymerase III subunits ga	2e-52
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	9e-52
PRK14970		367	PRK14970, PRK14970, DNA polymerase III subunits ga	1e-51
PRK14969		527	PRK14969, PRK14969, DNA polymerase III subunits ga	6e-50
PRK06647		563	PRK06647, PRK06647, DNA polymerase III subunits ga	7e-49
PRK14955		397	PRK14955, PRK14955, DNA polymerase III subunits ga	9e-48
PRK14961		363	PRK14961, PRK14961, DNA polymerase III subunits ga	6e-47
PRK08451		535	PRK08451, PRK08451, DNA polymerase III subunits ga	1e-46
PRK14964		491	PRK14964, PRK14964, DNA polymerase III subunits ga	3e-45
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	6e-45
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	7e-45
PRK06645		507	PRK06645, PRK06645, DNA polymerase III subunits ga	8e-45
PRK14954		620	PRK14954, PRK14954, DNA polymerase III subunits ga	1e-44
PRK14952		584	PRK14952, PRK14952, DNA polymerase III subunits ga	2e-42
PRK14956		484	PRK14956, PRK14956, DNA polymerase III subunits ga	2e-42
PRK14959		624	PRK14959, PRK14959, DNA polymerase III subunits ga	4e-42
PRK14958		509	PRK14958, PRK14958, DNA polymerase III subunits ga	6e-42
PRK08691		709	PRK08691, PRK08691, DNA polymerase III subunits ga	4e-41
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	4e-41
PRK09111		598	PRK09111, PRK09111, DNA polymerase III subunits ga	3e-39
PRK14960		702	PRK14960, PRK14960, DNA polymerase III subunits ga	8e-38
PRK14957		546	PRK14957, PRK14957, DNA polymerase III subunits ga	4e-37
PRK14949		944	PRK14949, PRK14949, DNA polymerase III subunits ga	1e-30
TIGR00678		188	TIGR00678, holB, DNA polymerase III, delta' subuni	2e-28
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	1e-27
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	5e-27
pfam13177		161	pfam13177, DNA_pol3_delta2, DNA polymerase III, de	1e-26
PRK12402		337	PRK12402, PRK12402, replication factor C small sub	1e-21
PRK00440		319	PRK00440, rfc, replication factor C small subunit;	2e-19
PRK08058		329	PRK08058, PRK08058, DNA polymerase III subunit del	9e-14
COG1466		334	COG1466, HolA, DNA polymerase III, delta subunit [	2e-13
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	3e-13
TIGR01128		302	TIGR01128, holA, DNA polymerase III, delta subunit	3e-13
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	2e-12
PRK07399		314	PRK07399, PRK07399, DNA polymerase III subunit del	2e-12
PRK07940		394	PRK07940, PRK07940, DNA polymerase III subunit del	1e-11
PRK05574		340	PRK05574, holA, DNA polymerase III subunit delta;	1e-09
PRK07276		290	PRK07276, PRK07276, DNA polymerase III subunit del	2e-09
PRK08699		325	PRK08699, PRK08699, DNA polymerase III subunit del	2e-09
PLN03025		319	PLN03025, PLN03025, replication factor C subunit;	6e-09
PRK04132		846	PRK04132, PRK04132, replication factor C small sub	2e-08
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	3e-08
PRK05707		328	PRK05707, PRK05707, DNA polymerase III subunit del	3e-06
PHA02544		316	PHA02544, 44, clamp loader, small subunit; Provisi	1e-05
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	2e-05
COG2255		332	COG2255, RuvB, Holliday junction resolvasome, heli	2e-05
PRK13341		725	PRK13341, PRK13341, recombination factor protein R	2e-05
PRK00080		328	PRK00080, ruvB, Holliday junction DNA helicase Ruv	3e-05
PRK06964		342	PRK06964, PRK06964, DNA polymerase III subunit del	7e-05
TIGR02902		531	TIGR02902, spore_lonB, ATP-dependent protease LonB	1e-04
PRK06090		319	PRK06090, PRK06090, DNA polymerase III subunit del	2e-04
pfam13401		124	pfam13401, AAA_22, AAA domain	5e-04
TIGR02903		615	TIGR02903, spore_lon_C, ATP-dependent protease, Lo	5e-04
pfam13191		154	pfam13191, AAA_16, AAA ATPase domain	5e-04
PRK05917		290	PRK05917, PRK05917, DNA polymerase III subunit del	6e-04
pfam05496		231	pfam05496, RuvB_N, Holliday junction DNA helicase	7e-04
COG0470		230	COG0470, HolB, ATPase involved in DNA replication	0.001
COG0593		408	COG0593, DnaA, ATPase involved in DNA replication	0.003

>gnl\|CDD\|233847 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau	Back alignment and domain information

 Score =  352 bits (905), Expect = e-113
 Identities = 132/353 (37%), Positives = 204/353 (57%), Gaps = 7/353 (1%)

Query: 296 SLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNC 355
            L++K+RP  F++++GQ  +V++L +AI  G +   YLF GPRGTGKTS +RIFA ALNC
Sbjct: 3   VLARKYRPQTFEDVIGQEHIVQTLKNAIKNGRIAHAYLFSGPRGTGKTSIARIFAKALNC 62

Query: 356 LSLEDQKPCGLCRECALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFI 415
            +  D +PC  C  C   +SG S DV E+D+   N  D +  ++ +    P S ++K++I
Sbjct: 63  QNGPDGEPCNECESCKEINSGSSLDVIEIDAASNNGVDDIREILDNVKYAPSSGKYKVYI 122

Query: 416 IDECQLLHGETWATVLNSLENISQHVVFVMITPELDKLPRSALSRSQKYHFPKIKDGDIA 475
           IDE  +L    +  +L +LE   +HVVF++ T E  K+P + LSR Q++ F +I   DI 
Sbjct: 123 IDEVHMLSKSAFNALLKTLEEPPEHVVFILATTEPHKIPATILSRCQRFDFKRIPLEDIV 182

Query: 476 SRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGK-KITLSLAYELIGIV 534
            RL++I  +E I  +  AL+ IA  ++GS+RDA  LLDQL   G   IT     EL+G+V
Sbjct: 183 ERLKKILDKEGIKIEDEALELIARAADGSLRDALSLLDQLISFGNGNITYEDVNELLGLV 242

Query: 535 SDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGK-----CLE 589
            D++L++LL+  L+ DT+  +    E++ S +DP + +  L  ++ D+L  K      L 
Sbjct: 243 DDEKLIELLEAILNKDTAEALKILDEILESGVDPEKFLEDLIEILRDLLLIKKTPSNLLA 302

Query: 590 DCSEARKNFFGKHTSEADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQL 642
              E+ + F  +   +  ++ L R L IL E  K LR S     WL + LL+L
Sbjct: 303 V-LESEQEFLKELALKLSLEFLLRLLDILLEALKDLRFSNDPRIWLEMTLLRL 354

This model represents the well-conserved first ~ 365 amino acids of the translation of the dnaX gene. The full-length product of the dnaX gene in the model bacterium E. coli is the DNA polymerase III tau subunit. A translational frameshift leads to early termination and a truncated protein subunit gamma, about 1/3 shorter than tau and present in roughly equal amounts. This frameshift mechanism is not necessarily universal for species with DNA polymerase III but appears conserved in the exterme thermophile Thermus thermophilis [DNA metabolism, DNA replication, recombination, and repair]. Length = 355

>gnl\|CDD\|225369 COG2812, DnaX, DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235505 PRK05563, PRK05563, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237867 PRK14953, PRK14953, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235943 PRK07133, PRK07133, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235638 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|180523 PRK06305, PRK06305, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237869 PRK14962, PRK14962, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|184934 PRK14970, PRK14970, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237873 PRK14969, PRK14969, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235845 PRK06647, PRK06647, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|184919 PRK14955, PRK14955, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|184925 PRK14961, PRK14961, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236267 PRK08451, PRK08451, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237870 PRK14964, PRK14964, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|180643 PRK06645, PRK06645, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|184920 PRK14956, PRK14956, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|184922 PRK14958, PRK14958, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237868 PRK14960, PRK14960, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|184921 PRK14957, PRK14957, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237863 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|233087 TIGR00678, holB, DNA polymerase III, delta' subunit	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|221959 pfam13177, DNA_pol3_delta2, DNA polymerase III, delta subunit	Back alignment and domain information

>gnl\|CDD\|237090 PRK12402, PRK12402, replication factor C small subunit 2; Reviewed	Back alignment and domain information

>gnl\|CDD\|234763 PRK00440, rfc, replication factor C small subunit; Reviewed	Back alignment and domain information

>gnl\|CDD\|181214 PRK08058, PRK08058, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|224383 COG1466, HolA, DNA polymerase III, delta subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|233280 TIGR01128, holA, DNA polymerase III, delta subunit	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|236011 PRK07399, PRK07399, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|236134 PRK07940, PRK07940, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|235511 PRK05574, holA, DNA polymerase III subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|180916 PRK07276, PRK07276, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|181538 PRK08699, PRK08699, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|178596 PLN03025, PLN03025, replication factor C subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|235223 PRK04132, PRK04132, replication factor C small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|180215 PRK05707, PRK05707, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|222866 PHA02544, 44, clamp loader, small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>gnl\|CDD\|235898 PRK06964, PRK06964, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB	Back alignment and domain information

>gnl\|CDD\|180394 PRK06090, PRK06090, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|234053 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family	Back alignment and domain information

>gnl\|CDD\|221970 pfam13191, AAA_16, AAA ATPase domain	Back alignment and domain information

>gnl\|CDD\|102059 PRK05917, PRK05917, DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>gnl\|CDD\|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus	Back alignment and domain information

>gnl\|CDD\|223546 COG0470, HolB, ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1018
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	100.0
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	100.0
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	100.0
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	100.0
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	100.0
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	100.0
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	100.0
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	100.0
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	100.0
PLN03025		319	replication factor C subunit; Provisional	100.0
PRK07940		394	DNA polymerase III subunit delta'; Validated	100.0
PRK00440		319	rfc replication factor C small subunit; Reviewed	100.0
PRK07993		334	DNA polymerase III subunit delta'; Validated	100.0
PRK05564		313	DNA polymerase III subunit delta'; Validated	100.0
PRK08058		329	DNA polymerase III subunit delta'; Validated	100.0
PRK12402		337	replication factor C small subunit 2; Reviewed	100.0
PRK05707		328	DNA polymerase III subunit delta'; Validated	100.0
PRK06871		325	DNA polymerase III subunit delta'; Validated	100.0
PRK06964		342	DNA polymerase III subunit delta'; Validated	100.0
PRK07399		314	DNA polymerase III subunit delta'; Validated	100.0
PRK06090		319	DNA polymerase III subunit delta'; Validated	100.0
PRK07471		365	DNA polymerase III subunit delta'; Validated	100.0
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	100.0
PRK08769		319	DNA polymerase III subunit delta'; Validated	99.98
PRK08699		325	DNA polymerase III subunit delta'; Validated	99.97
PHA02544		316	44 clamp loader, small subunit; Provisional	99.97
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.97
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.97
PRK07276		290	DNA polymerase III subunit delta'; Validated	99.97
PRK05917		290	DNA polymerase III subunit delta'; Validated	99.96
PRK04195		482	replication factor C large subunit; Provisional	99.96
PRK04132		846	replication factor C small subunit; Provisional	99.96
PRK13342		413	recombination factor protein RarA; Reviewed	99.96
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	99.95
PRK07132		299	DNA polymerase III subunit delta'; Validated	99.95
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.95
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	99.95
PRK13341		725	recombination factor protein RarA/unknown domain f	99.95
PRK07452		326	DNA polymerase III subunit delta; Validated	99.94
KOG2028		554	consensus ATPase related to the helicase subunit o	99.94
PRK05818		261	DNA polymerase III subunit delta'; Validated	99.94
PRK07914		320	hypothetical protein; Reviewed	99.93
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	99.93
PRK05629		318	hypothetical protein; Validated	99.93
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	99.93
PRK05574		340	holA DNA polymerase III subunit delta; Reviewed	99.93
PRK06585		343	holA DNA polymerase III subunit delta; Reviewed	99.93
PRK05907		311	hypothetical protein; Provisional	99.92
PRK08487		328	DNA polymerase III subunit delta; Validated	99.92
TIGR01128		302	holA DNA polymerase III, delta subunit. subunit ar	99.91
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.9
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.87
COG1466		334	HolA DNA polymerase III, delta subunit [DNA replic	99.85
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.84
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.83
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.83
PRK06581		263	DNA polymerase III subunit delta'; Validated	99.81
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.76
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.75
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.74
PRK08084		235	DNA replication initiation factor; Provisional	99.73
PRK12422		445	chromosomal replication initiation protein; Provis	99.72
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.72
PRK08727		233	hypothetical protein; Validated	99.72
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	99.71
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.71
COG0593		408	DnaA ATPase involved in DNA replication initiation	99.7
PRK06893		229	DNA replication initiation factor; Validated	99.7
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.7
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.7
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.69
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.68
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.67
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.67
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.67
PRK05642		234	DNA replication initiation factor; Validated	99.66
PRK06620		214	hypothetical protein; Validated	99.66
CHL00181		287	cbbX CbbX; Provisional	99.66
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.65
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.64
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	99.62
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	99.61
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.61
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.6
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.6
PRK09087		226	hypothetical protein; Validated	99.59
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.59
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	99.58
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.58
CHL00195		489	ycf46 Ycf46; Provisional	99.57
PRK08485		206	DNA polymerase III subunit delta'; Validated	99.55
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.54
CHL00176		638	ftsH cell division protein; Validated	99.53
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.52
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.52
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.5
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.5
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.49
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.48
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.47
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.45
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.45
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.45
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	99.43
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.42
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.42
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.42
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	99.42
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.39
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.39
CHL00095		821	clpC Clp protease ATP binding subunit	99.37
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.36
PF12169		143	DNA_pol3_gamma3: DNA polymerase III subunits gamma	99.36
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.36
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.35
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.34
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.33
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.33
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.33
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.32
CHL00206		2281	ycf2 Ycf2; Provisional	99.32
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.32
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.31
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.3
PRK10865		857	protein disaggregation chaperone; Provisional	99.29
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	99.29
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.28
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	99.28
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.28
PF00004		132	AAA: ATPase family associated with various cellula	99.28
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.28
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.27
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.27
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.27
PRK10865		857	protein disaggregation chaperone; Provisional	99.27
CHL00095		821	clpC Clp protease ATP binding subunit	99.26
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.26
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.26
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	99.24
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.24
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	99.22
PRK14700		300	recombination factor protein RarA; Provisional	99.22
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.22
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.21
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	99.21
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.2
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.17
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.17
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.16
PF06144		172	DNA_pol3_delta: DNA polymerase III, delta subunit;	99.16
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.15
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.12
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.11
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.1
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.1
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.09
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.08
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	99.08
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	99.07
PRK13531		498	regulatory ATPase RavA; Provisional	99.06
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.06
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.05
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	99.05
PRK11608		326	pspF phage shock protein operon transcriptional ac	99.03
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.02
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	99.01
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	98.99
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.98
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	98.96
KOG1968		871	consensus Replication factor C, subunit RFC1 (larg	98.95
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	98.94
PRK05022		509	anaerobic nitric oxide reductase transcription reg	98.92
PRK15424		538	propionate catabolism operon regulatory protein Pr	98.92
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	98.87
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	98.87
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	98.85
COG2204		464	AtoC Response regulator containing CheY-like recei	98.85
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	98.84
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	98.8
KOG1514		767	consensus Origin recognition complex, subunit 1, a	98.79
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	98.79
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	98.77
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	98.77
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	98.76
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	98.74
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	98.73
COG1221		403	PspF Transcriptional regulators containing an AAA-	98.73
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.73
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	98.71
PRK15115		444	response regulator GlrR; Provisional	98.7
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.68
PRK13765		637	ATP-dependent protease Lon; Provisional	98.67
PHA02244		383	ATPase-like protein	98.65
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	98.63
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	98.62
COG0714		329	MoxR-like ATPases [General function prediction onl	98.61
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	98.61
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	98.6
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	98.58
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	98.57
smart00350		509	MCM minichromosome maintenance proteins.	98.56
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	98.56
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	98.54
PRK10365		441	transcriptional regulatory protein ZraR; Provision	98.49
smart00382		148	AAA ATPases associated with a variety of cellular	98.48
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	98.46
COG0606		490	Predicted ATPase with chaperone activity [Posttran	98.43
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	98.39
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	98.38
PRK08116		268	hypothetical protein; Validated	98.38
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	98.37
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	98.37
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	98.37
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	98.36
PF07726		131	AAA_3: ATPase family associated with various cellu	98.36
PRK12377		248	putative replication protein; Provisional	98.34
PF13173		128	AAA_14: AAA domain	98.28
PRK09862		506	putative ATP-dependent protease; Provisional	98.26
PRK07952		244	DNA replication protein DnaC; Validated	98.26
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	98.26
KOG2170		344	consensus ATPase of the AAA+ superfamily [General	98.22
PF14840		125	DNA_pol3_delt_C: Processivity clamp loader gamma c	98.22
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	98.2
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	98.19
PRK15455		644	PrkA family serine protein kinase; Provisional	98.15
COG3283		511	TyrR Transcriptional regulator of aromatic amino a	98.14
PRK08181		269	transposase; Validated	98.13
PRK06921		266	hypothetical protein; Provisional	98.12
PRK04841		903	transcriptional regulator MalT; Provisional	98.1
PRK06526		254	transposase; Provisional	98.02
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.98
PRK08939		306	primosomal protein DnaI; Reviewed	97.94
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	97.93
PF05729		166	NACHT: NACHT domain	97.93
KOG0736		953	consensus Peroxisome assembly factor 2 containing	97.92
PRK04132		846	replication factor C small subunit; Provisional	97.91
PRK06835		329	DNA replication protein DnaC; Validated	97.81
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	97.8
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.76
COG3284		606	AcoR Transcriptional activator of acetoin/glycerol	97.69
COG1484		254	DnaC DNA replication protein [DNA replication, rec	97.68
PLN03210		1153	Resistant to P. syringae 6; Provisional	97.68
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	97.63
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	97.62
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	97.62
PRK09183		259	transposase/IS protein; Provisional	97.62
PHA00729		226	NTP-binding motif containing protein	97.61
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	97.57
PF14516		331	AAA_35: AAA-like domain	97.56
COG1241		682	MCM2 Predicted ATPase involved in replication cont	97.55
PF13191		185	AAA_16: AAA ATPase domain; PDB: 2V1U_A.	97.54
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	97.52
PRK04296		190	thymidine kinase; Provisional	97.5
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	97.49
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	97.47
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	97.47
COG4650		531	RtcR Sigma54-dependent transcription regulator con	97.42
PHA02774		613	E1; Provisional	97.41
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	97.39
PF07693		325	KAP_NTPase: KAP family P-loop domain; InterPro: IP	97.25
KOG2543		438	consensus Origin recognition complex, subunit 5 [R	97.23
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309		127	Torsin: Torsin; InterPro: IPR010448 This family co	97.19
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	97.19
TIGR01618		220	phage_P_loop phage nucleotide-binding protein. Thi	97.17
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	97.14
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	97.1
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	97.07
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	97.04
KOG0481		729	consensus DNA replication licensing factor, MCM5 c	97.01
KOG0477		854	consensus DNA replication licensing factor, MCM2 c	96.98
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	96.98
PRK13695		174	putative NTPase; Provisional	96.84
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	96.83
KOG0482		721	consensus DNA replication licensing factor, MCM7 c	96.83
PRK10536		262	hypothetical protein; Provisional	96.81
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.79
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.78
PF10443		431	RNA12: RNA12 protein; InterPro: IPR018850 Mitochon	96.74
PF08298		358	AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi	96.72
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	96.71
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	96.7
PHA02624		647	large T antigen; Provisional	96.69
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.68
PF00493		331	MCM: MCM2/3/5 family This family extends the MCM d	96.66
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	96.65
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	96.55
PRK13889		988	conjugal transfer relaxase TraA; Provisional	96.49
PTZ00202		550	tuzin; Provisional	96.49
PF10236		309	DAP3: Mitochondrial ribosomal death-associated pro	96.48
PRK14974		336	cell division protein FtsY; Provisional	96.48
PF08542		89	Rep_fac_C: Replication factor C C-terminal domain;	96.42
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	96.42
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	96.37
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.34
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.29
KOG3347		176	consensus Predicted nucleotide kinase/nuclear prot	96.29
PF05272		198	VirE: Virulence-associated protein E; InterPro: IP	96.28
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	96.26
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	96.21
TIGR01359		183	UMP_CMP_kin_fam UMP-CMP kinase family. This subfam	96.2
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	96.17
PRK13826		1102	Dtr system oriT relaxase; Provisional	96.14
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	96.14
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	96.13
COG2842		297	Uncharacterized ATPase, putative transposase [Gene	96.11
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	96.07
PRK10875		615	recD exonuclease V subunit alpha; Provisional	96.03
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	96.01
KOG1808		1856	consensus AAA ATPase containing von Willebrand fac	96.0
COG4178		604	ABC-type uncharacterized transport system, permeas	95.99
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	95.95
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	95.93
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	95.91
PRK00771		437	signal recognition particle protein Srp54; Provisi	95.89
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	95.88
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	95.87
COG4088		261	Predicted nucleotide kinase [Nucleotide transport	95.86
smart00487		201	DEXDc DEAD-like helicases superfamily.	95.78
PRK14532		188	adenylate kinase; Provisional	95.76
TIGR00767		415	rho transcription termination factor Rho. Members	95.74
PF12780		268	AAA_8: P-loop containing dynein motor region D4; I	95.74
cd01128		249	rho_factor Transcription termination factor rho is	95.73
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.71
PF13479		213	AAA_24: AAA domain	95.68
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	95.67
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	95.64
PRK06762		166	hypothetical protein; Provisional	95.58
cd02021		150	GntK Gluconate kinase (GntK) catalyzes the phospho	95.52
PRK09376		416	rho transcription termination factor Rho; Provisio	95.48
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	95.46
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	95.44
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	95.42
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	95.4
PRK14527		191	adenylate kinase; Provisional	95.38
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	95.37
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	95.35
TIGR02237		209	recomb_radB DNA repair and recombination protein R	95.33
PHA02530		300	pseT polynucleotide kinase; Provisional	95.28
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	95.22
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	95.18
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	95.16
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	95.14
PRK08118		167	topology modulation protein; Reviewed	95.13
PRK10416		318	signal recognition particle-docking protein FtsY;	95.12
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	95.11
PRK14528		186	adenylate kinase; Provisional	95.1
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	95.09
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	95.09
cd01428		194	ADK Adenylate kinase (ADK) catalyzes the reversibl	95.09
CHL00195		489	ycf46 Ycf46; Provisional	95.08
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	95.03
COG1485		367	Predicted ATPase [General function prediction only	95.02
TIGR01613		304	primase_Cterm phage/plasmid primase, P4 family, C-	94.99
TIGR03574		249	selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem	94.99
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	94.98
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	94.97
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	94.97
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	94.93
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	94.92
PF00488		235	MutS_V: MutS domain V C-terminus.; InterPro: IPR00	94.89
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.89
PRK09435		332	membrane ATPase/protein kinase; Provisional	94.88
cd03284		216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	94.88
cd03216		163	ABC_Carb_Monos_I This family represents the domain	94.88
PRK06067		234	flagellar accessory protein FlaH; Validated	94.87
PRK04220		301	2-phosphoglycerate kinase; Provisional	94.86
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	94.84
PRK11823		446	DNA repair protein RadA; Provisional	94.81
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	94.75
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.73
TIGR00064		272	ftsY signal recognition particle-docking protein F	94.7
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	94.67
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	94.65
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	94.64
PRK00300		205	gmk guanylate kinase; Provisional	94.6
PF00519		432	PPV_E1_C: Papillomavirus helicase; InterPro: IPR00	94.6
PRK00131		175	aroK shikimate kinase; Reviewed	94.58
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	94.53
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	94.52
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	94.5
cd03227		162	ABC_Class2 ABC-type Class 2 contains systems invol	94.48
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	94.45
PRK08533		230	flagellar accessory protein FlaH; Reviewed	94.44
PRK07261		171	topology modulation protein; Provisional	94.44
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	94.44
COG4619		223	ABC-type uncharacterized transport system, ATPase	94.43
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	94.42
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	94.41
COG1067		647	LonB Predicted ATP-dependent protease [Posttransla	94.4
PF01926		116	MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I	94.34
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	94.34
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	94.32
cd03246		173	ABCC_Protease_Secretion This family represents the	94.31
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	94.29
PRK14737		186	gmk guanylate kinase; Provisional	94.28
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	94.27
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	94.26
PRK00091		307	miaA tRNA delta(2)-isopentenylpyrophosphate transf	94.26
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	94.21
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	94.21
PF13238		129	AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB	94.2
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	94.19
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	94.17
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	94.14
PRK08356		195	hypothetical protein; Provisional	94.14
cd03115		173	SRP The signal recognition particle (SRP) mediates	94.05
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	94.05
cd02020		147	CMPK Cytidine monophosphate kinase (CMPK) catalyze	94.05
COG3899		849	Predicted ATPase [General function prediction only	94.05
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	94.04
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	94.0
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	93.99
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	93.95
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	93.87
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	93.82
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	93.8
PRK12337		475	2-phosphoglycerate kinase; Provisional	93.76
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	93.74
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	93.71
PRK03839		180	putative kinase; Provisional	93.71
TIGR02533		486	type_II_gspE general secretory pathway protein E.	93.64
COG1936		180	Predicted nucleotide kinase (related to CMP and AM	93.64
cd03239		178	ABC_SMC_head The structural maintenance of chromos	93.64
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	93.6
PF13245		76	AAA_19: Part of AAA domain	93.59
PRK13808		333	adenylate kinase; Provisional	93.59
cd01394		218	radB RadB. The archaeal protein radB shares simila	93.55
cd03286		218	ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS	93.54
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	93.53
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	93.52
TIGR01360		188	aden_kin_iso1 adenylate kinase, isozyme 1 subfamil	93.49
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	93.47
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	93.46
PF10923		416	DUF2791: P-loop Domain of unknown function (DUF279	93.45
cd03276		198	ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein	93.45
PRK09361		225	radB DNA repair and recombination protein RadB; Pr	93.43
PRK00409		782	recombination and DNA strand exchange inhibitor pr	93.41
cd00464		154	SK Shikimate kinase (SK) is the fifth enzyme in th	93.41
PRK06547		172	hypothetical protein; Provisional	93.39
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	93.38
PRK06696		223	uridine kinase; Validated	93.35
cd00983		325	recA RecA is a bacterial enzyme which has roles in	93.33
cd01852		196	AIG1 AIG1 (avrRpt2-induced gene 1). This represent	93.33
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	93.31
PRK10867		433	signal recognition particle protein; Provisional	93.3
PRK09354		349	recA recombinase A; Provisional	93.28
KOG3354		191	consensus Gluconate kinase [Carbohydrate transport	93.26
cd01878		204	HflX HflX subfamily. A distinct conserved domain w	93.25
cd03285		222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	93.19
PLN02674		244	adenylate kinase	93.18
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	93.16
COG0703		172	AroK Shikimate kinase [Amino acid transport and me	93.16
TIGR01313		163	therm_gnt_kin carbohydrate kinase, thermoresistant	93.12
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	93.1
COG0529		197	CysC Adenylylsulfate kinase and related kinases [I	93.09
PRK13947		171	shikimate kinase; Provisional	93.05
PRK13948		182	shikimate kinase; Provisional	93.04
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	93.0
PRK14531		183	adenylate kinase; Provisional	93.0
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	92.95
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	92.93
TIGR00959		428	ffh signal recognition particle protein. This mode	92.93
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	92.92
cd00227		175	CPT Chloramphenicol (Cm) phosphotransferase (CPT).	92.89
cd02019		69	NK Nucleoside/nucleotide kinase (NK) is a protein	92.89
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	92.87
PF02463		220	SMC_N: RecF/RecN/SMC N terminal domain; InterPro:	92.87
PRK04301		317	radA DNA repair and recombination protein RadA; Va	92.86
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	92.85
PLN02772		398	guanylate kinase	92.83
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	92.82
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	92.81

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Probab=100.00  E-value=4.9e-60  Score=566.57  Aligned_cols=483  Identities=29%  Similarity=0.471  Sum_probs=408.3

Q ss_pred             CCcccccccCCCCcccccCcHHHHHHHHHHHHcCCCCcEEEEECCCchHHHHHHHHHHHHHhccCCC--CCCCCCCcccc
Q 001748          293 TPWSLSQKFRPNFFDELVGQNVVVRSLLSAISRGMVTSFYLFHGPRGTGKTSASRIFAAALNCLSLE--DQKPCGLCREC  370 (1018)
Q Consensus       293 ~~~~L~eKyRP~tFddLVGqe~iv~~L~~aIk~grl~~ayLf~GPpGTGKTtLAraLAkaL~c~~~~--~~~PCg~C~sc  370 (1018)
                      .+.||.+||||++|++++||++++..|.+++..++++|+|||+||+|+|||++|++||+.++|....  ...|||.|..|
T Consensus         2 ~~~pl~~kyRP~~f~~liGq~~i~~~L~~~l~~~rl~~a~Lf~Gp~G~GKttlA~~lAk~L~c~~~~~~~~~~Cg~C~~C   81 (620)
T PRK14948          2 AYEPLHHKYRPQRFDELVGQEAIATTLKNALISNRIAPAYLFTGPRGTGKTSSARILAKSLNCLNSDKPTPEPCGKCELC   81 (620)
T ss_pred             CcchHHHHhCCCcHhhccChHHHHHHHHHHHHcCCCCceEEEECCCCCChHHHHHHHHHHhcCCCcCCCCCCCCcccHHH
Confidence            3678999999999999999999999999999999999999999999999999999999999997643  34799999999


Q ss_pred             ceeccCCCCcccccccccccchhHHHHHHHHhcCCCCCCCceEEEEeCccccCHHHHHHHHHHHhccCCcEEEEEEecCC
Q 001748          371 ALFSSGRSRDVKEVDSVRINRSDRVGSLMKSAFLPPFSSRFKIFIIDECQLLHGETWATVLNSLENISQHVVFVMITPEL  450 (1018)
Q Consensus       371 ~~i~sG~~~DvieIdaas~~~vd~IReLie~a~~~P~~g~~kVLIIDEaD~Ls~~a~naLLk~LEepp~~vifILaTn~~  450 (1018)
                      +.+..|.|+|++++++....+++.||++++.+.+.|++++++||||||+|+|+.+++|+||++||+|+.+++||++|+++
T Consensus        82 ~~i~~g~h~D~~ei~~~~~~~vd~IReii~~a~~~p~~~~~KViIIDEad~Lt~~a~naLLK~LEePp~~tvfIL~t~~~  161 (620)
T PRK14948         82 RAIAAGNALDVIEIDAASNTGVDNIRELIERAQFAPVQARWKVYVIDECHMLSTAAFNALLKTLEEPPPRVVFVLATTDP  161 (620)
T ss_pred             HHHhcCCCccEEEEeccccCCHHHHHHHHHHHhhChhcCCceEEEEECccccCHHHHHHHHHHHhcCCcCeEEEEEeCCh
Confidence            99999999999999988778899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchHHHhcCccEEEeCCCChhHHHHHHHHHHHHhcCCCCHHHHHHHHHHcCCCHHHHHHHHHHHHhhCCccCHHHHHHH
Q 001748          451 DKLPRSALSRSQKYHFPKIKDGDIASRLRRICVEEAINFDQAALDFIAAKSNGSIRDAEMLLDQLSLLGKKITLSLAYEL  530 (1018)
Q Consensus       451 ~kL~~tI~SRcq~I~F~~ls~eEI~~~L~~iakkegI~Id~eAL~~LA~~s~GnLR~Al~lLeqLsl~g~~IT~edV~el  530 (1018)
                      .+++++|+|||+.++|.+++.+++..+|..+++++|+.++++++.+|++.++|++|+|+++|++++++.+.||.++|+++
T Consensus       162 ~~llpTIrSRc~~~~f~~l~~~ei~~~L~~ia~kegi~is~~al~~La~~s~G~lr~A~~lLeklsL~~~~It~e~V~~l  241 (620)
T PRK14948        162 QRVLPTIISRCQRFDFRRIPLEAMVQHLSEIAEKESIEIEPEALTLVAQRSQGGLRDAESLLDQLSLLPGPITPEAVWDL  241 (620)
T ss_pred             hhhhHHHHhheeEEEecCCCHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCHHHHHHHHHHHHhccCCCCHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999988889999999999


Q ss_pred             hccCChhHHHHHHHHHHcCChHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhcccccchh------HHHHHHHHhhhh
Q 001748          531 IGIVSDDELLDLLDLALSSDTSNTVIRARELMRSKIDPMQLISQLANLIMDILAGKCLEDCS------EARKNFFGKHTS  604 (1018)
Q Consensus       531 lg~v~ee~If~Lldail~~d~~~al~~l~eLl~~G~dpl~LL~~L~~~LRdLL~~K~~~~~~------~i~~~~l~r~a~  604 (1018)
                      ++...++.+|++++++..++...++..+++++..|.++..++.+|..+|||++.++......      ......+.++++
T Consensus       242 vg~~~e~~i~~Ll~ai~~~d~~~al~~~~~Ll~~g~~p~~iL~~L~~~~RDLL~~K~~~~~~~l~~i~~d~~~~l~~~A~  321 (620)
T PRK14948        242 LGAVPEQDLLNLLKALASNDPESLLDSCRQLLDRGREPLAILQGLAAFYRDLLLAKTAPNRPDLVAVSQQTWDELCKLAK  321 (620)
T ss_pred             hcCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHhcccchhhhhcCHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999988754322      122355677889


Q ss_pred             cCCHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHhccCCCC-CCcchhhhhhccc----cCCCCC-----C---c--
Q 001748          605 EADMQKLSRALKILSETEKQLRMSKHQTTWLTVALLQLSSSESS-LDLNDSKLCLRYA----HDKDGD-----S---H--  669 (1018)
Q Consensus       605 ~~s~~~L~~aL~iLseae~qLK~s~n~rl~LE~lLlkL~~~~~~-~~~~~~~~~~~~~----~~~~~~-----~---~--  669 (1018)
                      +++...|.++++.|.++++++|++.++++|||.++++|+..+.. ...++.....+..    .+....     .   .  
T Consensus       322 ~~s~~~L~~~i~~L~eae~~LK~n~nprL~LE~lLl~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  401 (620)
T PRK14948        322 QINLERILQWQQHLKGSEYQLKNSTQPRLWLEVTLLGLLPSAFISEIANASAPANPTPAPNPSPPPAPIQPSAPKTKQAA  401 (620)
T ss_pred             hCCHHHHHHHHHHHHHHHHHHhcCCCccHHHHHHHHHhhccCccccccccccccccCCccccCcccccCCCCCCCCCCCC
Confidence            99999999999999999999999999999999999999876531 1111111111000    000000     0   0  


Q ss_pred             -------ccCCCCCCcccccCCcccCCccccccccccchhhHHHHHHHHHHHhcchhHHHHHHHcCceeeeeecCceEEE
Q 001748          670 -------CTISPRDSFKHLVRGSCVGDKANKLGALEDYKGTLESIWKTATELCQSNSLKTFLRKQGKLSSLHVNHGLAVA  742 (1018)
Q Consensus       670 -------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~W~~i~~~~~~~~l~~~L~~~g~l~~~~~~~~~~v~  742 (1018)
                             ...+.+.+.+...+..+...++  .........+|+++|++|++.|+.+++|+||++||+|+++  ++..++|
T Consensus       402 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~l~~~w~~~~~~~~~~~~~~~~~~~~~l~~~--~~~~~~~  477 (620)
T PRK14948        402 TTPSPPPAKASPPIPVPAEPTEPSPTPPA--NAANAPPSLNLEELWQQILAKLELPSTRMLLSQQAELVSL--DSNRAVI  477 (620)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCccccCHHHHHHHHHHhCCChhHHHHHHhhhheecc--cCCEEEE
Confidence                   0000001111111111111111  1112334569999999999999999999999999999876  4555655


Q ss_pred             EEcccchhhHhhhhhhHHHHHHHHHHHhCCeEEEEEEEcc
Q 001748          743 ELEFHHRDYVSRAEKSWKLIASTLQSVLGCNVEIRLLCAP  782 (1018)
Q Consensus       743 ~~~f~~~~~~~~~e~~~~~i~~~~~~~lg~~v~v~~~~~~  782 (1018)
                        .| ++.|++++++++..|+++|++++|++|+|.+....
T Consensus       478 --~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  514 (620)
T PRK14948        478 --AV-SPNWLGMVQSRKPLLEQAFAKVLGRSIKLNLESQS  514 (620)
T ss_pred             --Ee-CHHHHHHHHHhHHHHHHHHHHHhCCCeEEEEEecC
Confidence              56 88999999999999999999999999999998865

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07276 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK07132 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK07452 DNA polymerase III subunit delta; Validated	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK05818 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07914 hypothetical protein; Reviewed	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK05629 hypothetical protein; Validated	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PRK05574 holA DNA polymerase III subunit delta; Reviewed	Back alignment and domain information

>PRK06585 holA DNA polymerase III subunit delta; Reviewed	Back alignment and domain information

>PRK05907 hypothetical protein; Provisional	Back alignment and domain information

>PRK08487 DNA polymerase III subunit delta; Validated	Back alignment and domain information

>TIGR01128 holA DNA polymerase III, delta subunit	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>COG1466 HolA DNA polymerase III, delta subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK06581 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>PRK08485 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12169 DNA_pol3_gamma3: DNA polymerase III subunits gamma and tau domain III; InterPro: IPR022754 This domain is found in bacteria and eukaryotes, and is approximately 110 amino acids in length	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK14700 recombination factor protein RarA; Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06144 DNA_pol3_delta: DNA polymerase III, delta subunit; InterPro: IPR010372 DNA polymerase III, delta subunit (2	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only]	Back alignment and domain information

>PF14840 DNA_pol3_delt_C: Processivity clamp loader gamma complex DNA pol III C-term; PDB: 3GLG_F 1XXH_A 3GLF_F 1JQJ_C 3GLI_F	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15455 PrkA family serine protein kinase; Provisional	Back alignment and domain information

>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PHA02774 E1; Provisional	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals	Back alignment and domain information

>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair]	Back alignment and domain information

>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>TIGR01618 phage_P_loop phage nucleotide-binding protein	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair]	Back alignment and domain information

>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair]	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ]	Back alignment and domain information

>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PHA02624 large T antigen; Provisional	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PTZ00202 tuzin; Provisional	Back alignment and domain information

>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PF08542 Rep_fac_C: Replication factor C C-terminal domain; InterPro: IPR013748 Replication factor C (RFC) is a multimeric AAA+ protein complex that loads the DNA polymerase processivity clamp PCNA (Proliferating Cell Nuclear Antigen) onto DNA using ATP to drive the reaction []	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism]	Back alignment and domain information

>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only]	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK14532 adenylate kinase; Provisional	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PF13479 AAA_24: AAA domain	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK06762 hypothetical protein; Provisional	Back alignment and domain information

>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK14527 adenylate kinase; Provisional	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK08118 topology modulation protein; Reviewed	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK14528 adenylate kinase; Provisional	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP)	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>COG1485 Predicted ATPase [General function prediction only]	Back alignment and domain information

>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain	Back alignment and domain information

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF00488 MutS_V: MutS domain V C-terminus	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK04220 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species	Back alignment and domain information

>PRK00131 aroK shikimate kinase; Reviewed	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK07261 topology modulation protein; Provisional	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK14737 gmk guanylate kinase; Provisional	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08356 hypothetical protein; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PRK12337 2-phosphoglycerate kinase; Provisional	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>PRK03839 putative kinase; Provisional	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PRK13808 adenylate kinase; Provisional	Back alignment and domain information

>cd01394 radB RadB	Back alignment and domain information

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria	Back alignment and domain information

>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK09361 radB DNA repair and recombination protein RadB; Provisional	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>PRK06547 hypothetical protein; Provisional	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>PRK06696 uridine kinase; Validated	Back alignment and domain information

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1)	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd01878 HflX HflX subfamily	Back alignment and domain information

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes	Back alignment and domain information

>PLN02674 adenylate kinase	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13947 shikimate kinase; Provisional	Back alignment and domain information

>PRK13948 shikimate kinase; Provisional	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PRK14531 adenylate kinase; Provisional	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT)	Back alignment and domain information

>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1018
1njg_A		250	Nucleotide-Free Form Of An Isolated E. Coli Clamp L		2e-34
3glh_B		376	Crystal Structure Of The E. Coli Clamp Loader Bound		4e-34
1jr3_A		373	Crystal Structure Of The Processivity Clamp Loader		5e-34
1xxi_B		368	Adp Bound E. Coli Clamp Loader Complex Length = 368		5e-34
3glg_B		395	Crystal Structure Of A Mutant (Gammat157a) E. Coli		6e-34
3glf_B		395	Crystal Structure Of The Ecoli Clamp Loader Bound T		6e-34
1iqp_A		327	Crystal Structure Of The Clamp Loader Small Subunit		6e-15
2chq_A		319	Replication Factor C Adpnp Complex Length = 319		9e-13
2chg_A		226	Replication Factor C Domains 1 And 2 Length = 226		9e-13
1sxj_C		340	Crystal Structure Of The Eukaryotic Clamp Loader (R		2e-10
1sxj_D		353	Crystal Structure Of The Eukaryotic Clamp Loader (R		5e-09

>pdb|1NJG|A Chain A, Nucleotide-Free Form Of An Isolated E. Coli Clamp Loader Gamma Subunit Length = 250