Citrus Sinensis ID: 003587

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------81

MARGQATILFRIYRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRFIELKARSFCSSVGNEGLVNNGTATKPKVEDVEQESGVNFVQGGEEDKVEVLDDYFDGSVISDSTMVESVHKNSNQSVRFLHLSTRDPVEVFGELRSTEKGAKINRSDFEVLREVFRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLVPFSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGLTTTLNLDDLDYLIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSKNAPVSIAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQSLTNANWKPESRQAGKPKLHQQREDGYDRPRSIIKSYENRKRQEKTSLTLHTEKIPA

ccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHccccEEEEEccccccHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHcccccEEEcccccccccccccEEEEccEEcccccccEEEEEcccccccccccHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccccEEEEEccccccccccccEEEEEcccccccccEEEccHHHHHHHcccccccccccccEEEEEEccccHHHHHHHHcccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccc

ccccHHHHHHHHHHcccccEEEEEEEccccccccccccccEccccccccccccccccccHcccccEEEEcccccccEEEEEEEEEEEEEccccccccccccccccccccHccccccccccccccEccHcHHHcccEEcccEEEEEccccccccccccccccccccccccccccccHcHHcccccHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHcccccEccHHHHHHHHHHHHHHHccccccEEcccEEEEccccccEEEEEEEEcccccEEEEEEEHHHHcccccccHHHHHHHHcccHcHEEccccHHHHHHHHHHHHHcccEEEEEEEEcccccEEccHHHcccHHccccccEEEEEcHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccccccEEEEEcHHHccccccEEEEEEEEEEcccccEEEEccHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHcccccEEEccHHHHHHHHHHHHHcccccHHHHEEEEccccccccHHHHHHHHHHHHHHHccccccEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccHHHccccccHHHcccHHHHHHccccccccccccccc

MARGQATILFRIYRSKnnvsrvgalssnqcfhsvgrcdkwvleknqfgltfdgrkreFSASLIDTVrfhlpsgntrfIELKARSFCssvgneglvnngtatkpkvedveqesgvnfvqggeedkvevlddyfdgsvisdsTMVESVHKNSNQSVRFLHLSTRDPVEVFGELrstekgakinrsDFEVLREVFRFFSNSGWAANQALAVYIGksffptaagkFRSYFIKKCPDDVAQYLVWlgpsddavKFLFPIFVEFCIEEFPDEIKRFRAMIEsadltkphtwfpFARVMKRKIiyhcgptnsgktYNALQRFMEakkgiycsplRLLAMEVFDKVNALGVYCSLltgqekklvpfsnhIACTvemvstdemydvAVIDEIQMMSDACRGYAWTRALLGLMADEihlcgdpsVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLgdlrnvrsgdcvVAFSRREIFEVKMAIEKHtnhhccviygalppetrRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLskyngdkiipvpgsqvkqiagragrrgsiypdgltttlnlDDLDYLIECLKQPFEVvkkvglfpFFEQVELFAGQLSNYTFCQLLEKFgencrldgsyflcRHDHIKKVANMLEKVQglsledrfnfcfapvnirdpkAMYHLLRFAssysknapvsiamgmpkgsakndAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQsltnanwkpesrqagkpklhqqredgydrprSIIKSYENrkrqektsltlhtekipa

MARGQATILFRIYRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRFIELKARSFCSSvgneglvnngtatkpkvedveqESGVnfvqggeedkveVLDDYFDGSVISDSTMVESVHKNsnqsvrflhlstrdPVEVfgelrstekgakinrsdfEVLREVFRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIEsadltkphtwfPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGqekklvpfSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTllgdlrnvrsgdcVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYngdkiipvpgsqvkqiagragrrgsiypdgLTTTLNLDDLDYLIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSKNAPVSIAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQSLTNanwkpesrqagkpklhqqredgydrprsiiksyenrkrqektsltlhtekipa

MARGQATILFRIYRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRFIELKARSFCSSVGNEGLVNNGTATKPKVEDVEQESGVNFVQGGEEDKVEVLDDYFDGSVISDSTMVESVHKNSNQSVRFLHLSTRDPVEVFGELRSTEKGAKINRSDFEVLREVFRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLVPFSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGltttlnlddldylIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSKNAPVSIAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQSLTNANWKPESRQAGKPKLHQQREDGYDRPRSIIKSYENRKRQEKTSLTLHTEKIPA

******TILFRIYRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRFIELKARSFCSSVGNEGLV****************************KVEVLDDYFDGSVIS***************VRFLHLSTRDPVEVFGELR****GAKINRSDFEVLREVFRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLVPFSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGLTTTLNLDDLDYLIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSK********************LLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQ*********************************************************

************YRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRF*********************************************************************************LSTRDPVEVFG*LRS*****KINRSDFEVLREVFRFFSNS**********YIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLVPFSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGLTTTLNLDDLDYLIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSKNAPVSIAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQSLT******************************************************

**RGQATILFRIYRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRFIELKARSFCSSVGNE**********PKVE*****SGVNFVQGGEEDKVEVLDDYFDGSVISDSTMVESVHKNSNQSVRFLHLSTRDPVEVFGELRSTEKGAKINRSDFEVLREVFRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLVPFSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGLTTTLNLDDLDYLIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSKNAPVSIAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQSLTNANWKP************************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		809	2.2.26 [Sep-21-2011]
Q8IYB8		786	ATP-dependent RNA helicas	yes	no	0.629	0.647	0.432	1e-120
Q5EBA1		776	ATP-dependent RNA helicas	yes	no	0.658	0.686	0.416	1e-119
Q80YD1		779	ATP-dependent RNA helicas	yes	no	0.658	0.684	0.411	1e-116
Q5ZJT0		794	ATP-dependent RNA helicas	yes	no	0.757	0.772	0.379	1e-115
A4IG62		763	ATP-dependent RNA helicas	yes	no	0.677	0.718	0.392	1e-114
Q9VN03		763	ATP-dependent RNA helicas	yes	no	0.650	0.689	0.4	1e-110
Q295E6		762	ATP-dependent RNA helicas	yes	no	0.729	0.774	0.372	1e-106
Q17828		721	ATP-dependent RNA helicas	yes	no	0.583	0.654	0.405	1e-105
Q61SU7		721	ATP-dependent RNA helicas	N/A	no	0.583	0.654	0.403	1e-105
O94445		647	ATP-dependent RNA helicas	yes	no	0.551	0.689	0.393	3e-91

>sp\|Q8IYB8\|SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens GN=SUPV3L1 PE=1 SV=1	Back alignment and function desciption

 Score =  432 bits (1110), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/548 (43%), Positives = 340/548 (62%), Gaps = 39/548 (7%)

Query: 214 FFPTAAGKFRSYFIKKCPDDVAQYLVW------LGPSDDAVKFLFPIFVEFCIEEFP--- 264
            F  A   FR+Y ++    DV  ++V          +DD    LFP F+    + FP   
Sbjct: 119 LFHQAFISFRNYIMQSHSLDVDIHIVLNDICFGAAHADD----LFPFFLRHAKQIFPVLD 174

Query: 265 --DEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGI 322
             D++++       +DL  P  W+P AR M+RKII+H GPTNSGKTY+A+Q++  AK G+
Sbjct: 175 CKDDLRKI------SDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGV 228

Query: 323 YCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLV----PFSNHIACTVEMVSTDEMYDVA 378
           YC PL+LLA E+F+K NA GV C L+TG+E+  V      ++H++CTVEM S    Y+VA
Sbjct: 229 YCGPLKLLAHEIFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVA 288

Query: 379 VIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYERF 438
           VIDEIQM+ D  RG+AWTRALLGL A+E+HLCG+P+ +D+V ++   TG+E+  + Y+R 
Sbjct: 289 VIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRL 348

Query: 439 KPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQ 498
            P+ V     L  L N+R GDC+V FS+ +I+ V   IE        VIYG+LPP T+  
Sbjct: 349 TPISV-LDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEIR-GLESAVIYGSLPPGTKLA 406

Query: 499 QANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYN----GDK-IIPVPGSQVKQ 553
           QA  FND ++   +LVA+DA+GMGLNL+IRR++FYSL K +    G++ + P+  SQ  Q
Sbjct: 407 QAKKFNDPNDPCKILVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQ 466

Query: 554 IAGRAGRRGSIYPDGLTTTLNLDDLDYLIECLKQPFEVVKKVGLFPFFEQVELFAGQLSN 613
           IAGRAGR  S + +G  TT+N +DL  L E LK+P + ++  GL P  EQ+E+FA  L +
Sbjct: 467 IAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPD 526

Query: 614 YTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPK 673
            T   L++ F +  ++DG YF+C  D  K  A +++ +  LSL  R+ FC AP+N + P 
Sbjct: 527 ATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAELIQHIP-LSLRVRYVFCTAPINKKQPF 585

Query: 674 AMYHLLRFASSYSKNAPVSIA-----MGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQF 728
               LL+FA  YS+N P++ A     +  P    KN  +L+DLE  H VL +YLWLS++F
Sbjct: 586 VCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRF 645

Query: 729 KEEVFPYA 736
             ++FP A
Sbjct: 646 M-DMFPDA 652

Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. ATPase and ATP-dependent multisubstrate helicase, able to unwind double stranded (ds) DNA and RNA, and RNA/DNA heteroduplexes in the 5'-to-3' direction. Plays a role in the RNA surveillance system in mitochondria; regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. Also implicated in recombination and chromatin maintenance pathways. May protect cells from apoptosis. Associates with mitochondrial DNA.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q5EBA1\|SUV3_RAT ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Rattus norvegicus GN=Supv3l1 PE=2 SV=1	Back alignment and function description

>sp\|Q80YD1\|SUV3_MOUSE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Mus musculus GN=Supv3l1 PE=2 SV=1	Back alignment and function description

>sp\|Q5ZJT0\|SUV3_CHICK ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Gallus gallus GN=SUPV3L1 PE=2 SV=1	Back alignment and function description

>sp\|A4IG62\|SUV3_DANRE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Danio rerio GN=supv3l1 PE=2 SV=1	Back alignment and function description

>sp\|Q9VN03\|SUV3_DROME ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila melanogaster GN=CG9791 PE=2 SV=3	Back alignment and function description

>sp\|Q295E6\|SUV3_DROPS ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA22038 PE=3 SV=1	Back alignment and function description

>sp\|Q17828\|SUV3_CAEEL ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis elegans GN=C08F8.2 PE=3 SV=2	Back alignment and function description

>sp\|Q61SU7\|SUV3_CAEBR ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG06022 PE=3 SV=3	Back alignment and function description

>sp\|O94445\|SUV3_SCHPO ATP-dependent RNA helicase suv3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suv3 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		809
359488988		806	PREDICTED: ATP-dependent RNA helicase SU	0.976	0.980	0.713	0.0
147834594		906	hypothetical protein VITISV_028450 [Viti	0.972	0.868	0.715	0.0
255566773		820	ATP-dependent RNA and DNA helicase, puta	0.966	0.953	0.708	0.0
449495319		795	PREDICTED: ATP-dependent RNA helicase SU	0.939	0.955	0.708	0.0
449441634		777	PREDICTED: ATP-dependent RNA helicase SU	0.906	0.943	0.718	0.0
297805736		777	hypothetical protein ARALYDRAFT_356016 [	0.953	0.992	0.666	0.0
356550962		805	PREDICTED: ATP-dependent RNA helicase SU	0.868	0.873	0.706	0.0
15242497		776	putative ATP-dependent RNA helicase [Ara	0.953	0.993	0.663	0.0
10176976		769	mitochondrial RNA helicase-like protein	0.941	0.990	0.668	0.0
356573474		829	PREDICTED: ATP-dependent RNA helicase SU	0.962	0.939	0.643	0.0

>gi\|359488988\|ref\|XP_003633851.1\| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1184 bits (3062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/825 (71%), Positives = 666/825 (80%), Gaps = 35/825 (4%)

Query: 1   MARGQATILFRIYRSKNNVSRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSA 60
           MARG A +L RI  SK++VSR     S +C HS G   +W   +N     FD  K  F  
Sbjct: 1   MARGPAALLSRIRSSKHDVSRFRVFPSKRCIHSFG---EW---RNPTASAFDLSKPAFFT 54

Query: 61  SLIDTVRFHLPSGNTRFIELK----ARSFCSSVGNEGLVNNGTATKPKVEDVEQESGVN- 115
           SL++ V     SG+    + +    AR F SS+  +G  +  T     +ED +  S ++ 
Sbjct: 55  SLMNLVHLQSASGSPNLRDFRNSIGARHF-SSMREDGDGDENTVPGLTIEDGDDVSSISD 113

Query: 116 --FVQGGEEDKVEVLDDYFDGSVISDSTMVESVHKN----SNQSVRFLHLSTRDPVEVFG 169
              V+ G+E K              DS+MVES + +    S +SV + H++ RDP E++ 
Sbjct: 114 STMVENGDEGKSNC-----------DSSMVESGNSSDDVGSGESVGYEHVAYRDPAELYR 162

Query: 170 ELRSTEKGAKINRSDFEVLREVFRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKK 229
           EL  ++  AK  +SD+E++ E+   F  SGWAANQALA+YIG SFFPTAA KFRS+  KK
Sbjct: 163 ELCDSQTSAKPTKSDWEMVSEILHHFRKSGWAANQALAIYIGMSFFPTAASKFRSFMSKK 222

Query: 230 CPDDVAQYLVWLGPSDDAVKFLFPIFVEFCIEEFPDEIKRFRAMIESADLTKPHTWFPFA 289
           C  DVA+YL  LGP D AVKFLFPIFVEFC+EEFPDEIKRFR+MI+SADLTKPHTWFPFA
Sbjct: 223 CTADVAKYLASLGPGDAAVKFLFPIFVEFCLEEFPDEIKRFRSMIKSADLTKPHTWFPFA 282

Query: 290 RVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLT 349
           R MKRKIIYHCGPTNSGKTYNALQR+MEAKKGIYCSPLRLLAMEVFDKVNALG+YCSL T
Sbjct: 283 RAMKRKIIYHCGPTNSGKTYNALQRYMEAKKGIYCSPLRLLAMEVFDKVNALGIYCSLHT 342

Query: 350 GQEKKLVPFSNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHL 409
           GQEKK VPFSNH +CTVEMVSTD++YDVAVIDEIQMMSD CRGYAWTRALLGL ADEIHL
Sbjct: 343 GQEKKNVPFSNHTSCTVEMVSTDDIYDVAVIDEIQMMSDPCRGYAWTRALLGLKADEIHL 402

Query: 410 CGDPSVLDVVRKICSETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREI 469
           CGDPSVL+VVRKICSETGDEL EQHYERFKPLVVEAKTLLG+L+NVRSGDCVVAFSRREI
Sbjct: 403 CGDPSVLNVVRKICSETGDELFEQHYERFKPLVVEAKTLLGELQNVRSGDCVVAFSRREI 462

Query: 470 FEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNLNIRR 529
           FEVK+AIEKHTNH CCVIYGALPPETRRQQA+LFND DNE+DVLVASDAVGMGLNLNIRR
Sbjct: 463 FEVKLAIEKHTNHRCCVIYGALPPETRRQQASLFNDPDNEYDVLVASDAVGMGLNLNIRR 522

Query: 530 VVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGLTTTLNLDDLDYLIECLKQPF 589
           VVFYSLSKYNGDKI+PVP +QVKQIAGRAGRRGS YPDGLTTTL+LDDLDYLIECLKQPF
Sbjct: 523 VVFYSLSKYNGDKIVPVPATQVKQIAGRAGRRGSRYPDGLTTTLHLDDLDYLIECLKQPF 582

Query: 590 EVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLE 649
           + +KKVGLFPFFEQVELFAGQL + T   LLEKF ENC+LDGSYFLCRHDHIKKVANML+
Sbjct: 583 DDIKKVGLFPFFEQVELFAGQLPDVTLSHLLEKFSENCQLDGSYFLCRHDHIKKVANMLQ 642

Query: 650 KVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSKNAPVSIAMGMPKGSAKNDAELL 709
           KVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYS+N PV+IAMGMPKGSA+ND+ELL
Sbjct: 643 KVQGLSLEDRFNFCFAPVNIRDPKAMYHLLRFASSYSQNLPVNIAMGMPKGSARNDSELL 702

Query: 710 DLETKHQVLSMYLWLSHQFKEEVFPYAKKAEAMATDIAELLGQSLTNANWKPESRQAGKP 769
           DLETKHQVLSMYLWLSH F EE FPY KKAE MAT IA+LLGQSL+ A WKPESRQAGKP
Sbjct: 703 DLETKHQVLSMYLWLSHHFTEETFPYVKKAETMATGIADLLGQSLSKACWKPESRQAGKP 762

Query: 770 KLHQQREDGYDRPRSIIKSYENRKRQ-----EKTSLTLHTEKIPA 809
           K  QQ+EDGY+RPRS++K ++ R+ +     EK     H+EK+ A
Sbjct: 763 K-PQQKEDGYERPRSLVKLFDERRHEKSPEHEKFPQHEHSEKVAA 806

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147834594\|emb\|CAN60906.1\| hypothetical protein VITISV_028450 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255566773\|ref\|XP_002524370.1\| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] gi\|223536331\|gb\|EEF37981.1\| ATP-dependent RNA and DNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449495319\|ref\|XP_004159798.1\| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449441634\|ref\|XP_004138587.1\| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|297805736\|ref\|XP_002870752.1\| hypothetical protein ARALYDRAFT_356016 [Arabidopsis lyrata subsp. lyrata] gi\|297316588\|gb\|EFH47011.1\| hypothetical protein ARALYDRAFT_356016 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|356550962\|ref\|XP_003543849.1\| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|15242497\|ref\|NP_198800.1\| putative ATP-dependent RNA helicase [Arabidopsis thaliana] gi\|332007099\|gb\|AED94482.1\| putative ATP-dependent RNA helicase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|10176976\|dbj\|BAB10208.1\| mitochondrial RNA helicase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356573474\|ref\|XP_003554884.1\| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		809
TAIR\|locus:2151911		776	AT5G39840 [Arabidopsis thalian	0.934	0.974	0.660	3.9e-273
UNIPROTKB\|F1PNI9		845	SUPV3L1 "Uncharacterized prote	0.723	0.692	0.405	3e-108
RGD\|1305565		776	Supv3l1 "suppressor of var1, 3	0.757	0.789	0.386	1.9e-106
UNIPROTKB\|Q8IYB8		786	SUPV3L1 "ATP-dependent RNA hel	0.662	0.681	0.416	3.1e-106
UNIPROTKB\|F1SUG1		789	SUPV3L1 "Uncharacterized prote	0.799	0.820	0.377	1.7e-105
UNIPROTKB\|E1BTJ2		796	SUPV3L1 "ATP-dependent RNA hel	0.776	0.788	0.373	2e-104
UNIPROTKB\|F1NMV4		794	SUPV3L1 "ATP-dependent RNA hel	0.776	0.790	0.374	5.3e-104
UNIPROTKB\|Q5ZJT0		794	SUPV3L1 "ATP-dependent RNA hel	0.776	0.790	0.374	5.3e-104
MGI\|MGI:2441711		779	Supv3l1 "suppressor of var1, 3	0.707	0.734	0.393	5.3e-104
TAIR\|locus:2130235		571	ATSUV3 [Arabidopsis thaliana (	0.589	0.835	0.433	3.7e-103

TAIR\|locus:2151911 AT5G39840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2626 (929.5 bits), Expect = 3.9e-273, P = 3.9e-273
 Identities = 516/781 (66%), Positives = 621/781 (79%)

Query:    20 SRVGALSSNQCFHSVGRCDKWVLEKNQFGLTFDGRKREFSASLIDTVRFHLPSGNTRF-- 77
             SRV  L S +  HS    +   L  + F    D     F +   + VR   P  + RF  
Sbjct:    15 SRVTVLFSTRNLHSFRESESRSLCNSDF----DVPTNRFCSG--NRVRIQFPWNDYRFGC 68

Query:    78 IEL-KARSFCSSVGNEGLVNNGTATKPKVEDVEQESGVNFVQGGEEDKVEVLDDYFDGSV 136
              E+ K RSF S+V N G   N        +D+E+  G       EE  +  L D  +G +
Sbjct:    69 FEIGKVRSFSSTVDNNG--EN--------DDIEESVGSESDDYDEEGLINELSDVDEG-L 117

Query:   137 ISDSTMVESVHKNSNQSVRFLHLSTRDPVEVFGELRSTEKGAKINRSDFEVLREVFRFFS 196
             ++DS + E+    S ++ R L+    DPVE++ ELR +E  +K+  S+++ L E+F FF+
Sbjct:   118 LNDSVVAETDEIGS-EAARALNDRYHDPVELYRELRGSEVRSKLQHSEWDSLHEIFGFFA 176

Query:   197 NSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQYLVWLGPSDDAVKFLFPIFV 256
              SGWAANQALA+YIGKSFFPTA  KFR +FI+KC  +V Q LV +GP+D AVKFLFP+FV
Sbjct:   177 QSGWAANQALAIYIGKSFFPTAVSKFRDFFIEKCGIEVVQDLVRVGPTDVAVKFLFPVFV 236

Query:   257 EFCIEEFPDEIKRFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFM 316
             EFCIEEFPDEIKRF++++++ADLTKP TWFPFAR MKRKI+YHCGPTNSGKTYNALQRFM
Sbjct:   237 EFCIEEFPDEIKRFKSIVDTADLTKPATWFPFARAMKRKIVYHCGPTNSGKTYNALQRFM 296

Query:   317 EAKKGIYCSPLRLLAMEVFDKVNALGVYCSLLTGQEKKLVPFSNHIACTVEMVSTDEMYD 376
             EAK G+YCSPLRLLAMEVFDKVNALG+YCSLLTGQEKK VPF+NH++CTVEMVSTDE+Y+
Sbjct:   297 EAKNGLYCSPLRLLAMEVFDKVNALGIYCSLLTGQEKKYVPFANHVSCTVEMVSTDELYE 356

Query:   377 VAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICSETGDELHEQHYE 436
             VAV+DEIQMM+D  RG+AWT+ALLGL ADEIHLCGDPSVLD+VRK+C++TGDEL E+HYE
Sbjct:   357 VAVLDEIQMMADPSRGHAWTKALLGLKADEIHLCGDPSVLDIVRKMCADTGDELVEEHYE 416

Query:   437 RFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETR 496
             RFKPLVVEAKTLLG+L+NV+SGDCVVAFSRREIFEVKMAIEKHTNH CCVIYGALPPETR
Sbjct:   417 RFKPLVVEAKTLLGELKNVKSGDCVVAFSRREIFEVKMAIEKHTNHRCCVIYGALPPETR 476

Query:   497 RQQANLFNDQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAG 556
             RQQA LFNDQ+NE+DVLVASDAVGMGLNLNIRRVVFYSL+KYNGDKI+PV  SQVKQIAG
Sbjct:   477 RQQAKLFNDQENEYDVLVASDAVGMGLNLNIRRVVFYSLNKYNGDKIVPVAASQVKQIAG 536

Query:   557 RAGRRGSIYPDGXXXXXXXXXXXXXIECLKQPFEVVKKVGLFPFFEQVELFAGQLSNYTF 616
             RAGRRGS YPDG             IECL+QPF+ V KVGLFPFFEQ+ELFA Q+ +  F
Sbjct:   537 RAGRRGSRYPDGLTTTLHLEDLNYLIECLQQPFDEVTKVGLFPFFEQIELFAAQVPDMAF 596

Query:   617 CQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCFAPVNIRDPKAMY 676
               LLE FG++CRLDGSYFLCRHDH+KKVANMLEKV+GLSLEDRFNFCFAPVNIR+P+AM+
Sbjct:   597 SNLLEHFGKHCRLDGSYFLCRHDHVKKVANMLEKVEGLSLEDRFNFCFAPVNIRNPRAMH 656

Query:   677 HLLRFASSYSKNAPVSIAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYA 736
             +L RFASSYS+N PV++AMG+PK SAK+DA+LLDLE++HQ+LSMYLWLS+QF EE FP+ 
Sbjct:   657 NLYRFASSYSQNMPVNVAMGIPKSSAKSDAQLLDLESRHQILSMYLWLSNQF-EENFPFV 715

Query:   737 KKAEAMATDIAELLGQSLTNANWKPESRQAGKPKLHQQRED-GYDRPRSIIKSYENRKRQ 795
             +K EAMAT+IAELLG+SL+ A+WK ES++  K K  Q +ED GY+RP S+IK  + RK +
Sbjct:   716 EKVEAMATNIAELLGESLSKASWKMESKEE-KVK-GQMKEDRGYERPASLIKLVKKRKDE 773

Query:   796 E 796
             +
Sbjct:   774 K 774

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005739 "mitochondrion" evidence=ISM;ISS

GO:0016817 "hydrolase activity, acting on acid anhydrides" evidence=IEA

GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA

UNIPROTKB\|F1PNI9 SUPV3L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1305565 Supv3l1 "suppressor of var1, 3-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IYB8 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SUG1 SUPV3L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BTJ2 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NMV4 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5ZJT0 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

MGI\|MGI:2441711 Supv3l1 "suppressor of var1, 3-like 1 (S. cerevisiae)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

TAIR\|locus:2130235 ATSUV3 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.13	0.824
3rd Layer	3.6.4	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00020941001	SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (767 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00010464001	SubName- Full=Chromosome chr17 scaffold_263, whole genome shotgun sequence; (563 aa)	•	0.464

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		809
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	6e-13
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	1e-11
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	1e-11
pfam12513		49	pfam12513, SUV3_C, Mitochondrial degradasome RNA h	3e-10
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	1e-09
COG1204		766	COG1204, COG1204, Superfamily II helicase [General	3e-09
COG4581		1041	COG4581, COG4581, Superfamily II RNA helicase [DNA	5e-08
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	4e-06
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	5e-06
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	4e-05
COG0514		590	COG0514, RecQ, Superfamily II DNA helicase [DNA re	6e-05
PRK02362		737	PRK02362, PRK02362, ski2-like helicase; Provisiona	9e-05
PRK01172		674	PRK01172, PRK01172, ski2-like helicase; Provisiona	0.001
PRK01172		674	PRK01172, PRK01172, ski2-like helicase; Provisiona	0.002
TIGR00614		470	TIGR00614, recQ_fam, ATP-dependent DNA helicase, R	0.002
TIGR01389		591	TIGR01389, recQ, ATP-dependent DNA helicase RecQ	0.002

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

 Score = 64.5 bits (158), Expect = 6e-13
 Identities = 25/83 (30%), Positives = 36/83 (43%), Gaps = 12/83 (14%)

Query: 481 NHHCCVIYGALPPETRRQQANLFNDQDNEFDVLVASDAVGMGLNL-NIRRVVFYSLSKYN 539
                 ++G L  E R +  + FN+   +  VLVA+D    GL+L  +  V+ Y L    
Sbjct: 11  GIKVARLHGGLSQEEREEILDKFNN--GKIKVLVATDVAERGLDLPGVDLVIIYDL---- 64

Query: 540 GDKIIPVPGSQVKQIAGRAGRRG 562
                P   +   Q  GRAGR G
Sbjct: 65  -----PWSPASYIQRIGRAGRAG 82

Length = 82

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|204947 pfam12513, SUV3_C, Mitochondrial degradasome RNA helicase subunit C terminal	Back alignment and domain information

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235032 PRK02362, PRK02362, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|100801 PRK01172, PRK01172, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|100801 PRK01172, PRK01172, ski2-like helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>gnl\|CDD\|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		809
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00110		545	helicase; Provisional	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	100.0
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0334		997	consensus RNA helicase [RNA processing and modific	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG0353		695	consensus ATP-dependent DNA helicase [General func	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.97
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.97
KOG4284		980	consensus DEAD box protein [Transcription]	99.97
PRK10689		1147	transcription-repair coupling factor; Provisional	99.97
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.97
PHA02653		675	RNA helicase NPH-II; Provisional	99.97
COG1204		766	Superfamily II helicase [General function predicti	99.97
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.96
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.96
KOG0327		397	consensus Translation initiation factor 4F, helica	99.96
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.96
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.96
COG1201		814	Lhr Lhr-like helicases [General function predictio	99.96
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.96
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	99.96
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	99.95
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	99.95
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.95
COG1202		830	Superfamily II helicase, archaea-specific [General	99.95
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	99.94
PRK14701		1638	reverse gyrase; Provisional	99.94
PRK09401		1176	reverse gyrase; Reviewed	99.94
PHA02558		501	uvsW UvsW helicase; Provisional	99.93
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.93
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	99.93
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.93
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	99.93
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.93
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.92
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.92
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.91
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.91
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.91
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.91
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.91
PRK13766		773	Hef nuclease; Provisional	99.9
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.9
COG1205		851	Distinct helicase family with a unique C-terminal	99.9
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.89
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.89
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.88
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.88
PRK04914		956	ATP-dependent helicase HepA; Validated	99.88
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.86
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.86
KOG0354		746	consensus DEAD-box like helicase [General function	99.85
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.85
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	99.85
PRK05580		679	primosome assembly protein PriA; Validated	99.85
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	99.84
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.84
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.84
PRK09694		878	helicase Cas3; Provisional	99.82
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.79
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.78
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.76
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.75
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.71
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.71
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.68
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.64
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.6
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.6
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.59
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.58
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.56
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.54
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.52
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.48
PRK05298		652	excinuclease ABC subunit B; Provisional	99.48
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.47
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.45
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.42
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.42
COG4096		875	HsdR Type I site-specific restriction-modification	99.37
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.34
PF12513		49	SUV3_C: Mitochondrial degradasome RNA helicase sub	99.33
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.24
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.22
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.16
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.14
KOG1123		776	consensus RNA polymerase II transcription initiati	99.12
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.1
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.09
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	98.95
smart00487		201	DEXDc DEAD-like helicases superfamily.	98.93
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	98.93
CHL00122		870	secA preprotein translocase subunit SecA; Validate	98.86
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	98.84
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	98.83
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	98.82
KOG0387		923	consensus Transcription-coupled repair protein CSB	98.8
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	98.79
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	98.76
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	98.76
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	98.75
PRK14873		665	primosome assembly protein PriA; Provisional	98.69
COG4889		1518	Predicted helicase [General function prediction on	98.68
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	98.6
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	98.54
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.51
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.38
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	98.29
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	98.19
KOG1002		791	consensus Nucleotide excision repair protein RAD16	98.19
COG0610		962	Type I site-specific restriction-modification syst	98.03
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	97.7
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	97.66
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	97.6
KOG4439		901	consensus RNA polymerase II transcription terminat	97.4
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	97.32
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	97.31
PF13245		76	AAA_19: Part of AAA domain	97.21
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	96.99
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	96.96
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	96.92
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	96.88
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	96.88
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	96.77
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	96.63
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	96.5
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	96.42
PRK10875		615	recD exonuclease V subunit alpha; Provisional	96.35
PRK10536		262	hypothetical protein; Provisional	96.33
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	96.3
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	96.23
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	96.19
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	96.14
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	96.1
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	96.1
smart00382		148	AAA ATPases associated with a variety of cellular	96.08
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	96.05
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.04
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	95.95
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	95.93
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	95.92
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	95.74
PRK04296		190	thymidine kinase; Provisional	95.74
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	95.42
PRK06526		254	transposase; Provisional	95.27
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	95.25
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	95.17
KOG1803		649	consensus DNA helicase [Replication, recombination	95.13
TIGR00376		637	DNA helicase, putative. The gene product may repre	95.13
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.11
PRK12377		248	putative replication protein; Provisional	95.09
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	95.07
PRK08181		269	transposase; Validated	94.98
PRK07952		244	DNA replication protein DnaC; Validated	94.94
PRK08727		233	hypothetical protein; Validated	94.91
KOG2340		698	consensus Uncharacterized conserved protein [Funct	94.89
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	94.7
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	94.69
PF13173		128	AAA_14: AAA domain	94.65
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	94.54
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	94.51
PRK06921		266	hypothetical protein; Provisional	94.5
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	94.42
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	94.02
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	93.98
PRK15483		986	type III restriction-modification system StyLTI en	93.96
PRK14974		336	cell division protein FtsY; Provisional	93.96
COG3973		747	Superfamily I DNA and RNA helicases [General funct	93.78
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	93.68
PRK08084		235	DNA replication initiation factor; Provisional	93.65
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	93.51
PRK06835		329	DNA replication protein DnaC; Validated	93.36
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	93.19
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	93.1
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	93.02
PRK08116		268	hypothetical protein; Validated	92.82
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	92.78
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	92.75
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	92.66
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	92.61
PRK06893		229	DNA replication initiation factor; Validated	92.47
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	92.39
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	92.34
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	92.29
KOG1805		1100	consensus DNA replication helicase [Replication, r	92.28
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	92.15
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	91.84
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	91.81
PRK13851		344	type IV secretion system protein VirB11; Provision	91.7
PRK13889		988	conjugal transfer relaxase TraA; Provisional	91.58
PRK05642		234	DNA replication initiation factor; Validated	91.5
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	91.42
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	91.37
PRK13826		1102	Dtr system oriT relaxase; Provisional	91.32
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	91.26
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	91.26
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	91.22
PRK08903		227	DnaA regulatory inactivator Hda; Validated	91.19
PHA02544		316	44 clamp loader, small subunit; Provisional	91.16
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	91.04
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	90.88
PRK11823		446	DNA repair protein RadA; Provisional	90.87
PF13555		62	AAA_29: P-loop containing region of AAA domain	90.53
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	90.45
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	90.45
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	90.41
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	90.26
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	90.21
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	90.15
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	90.13
PF13871		278	Helicase_C_4: Helicase_C-like	90.01
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	89.98
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	89.97
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	89.96
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	89.86
PRK00149		450	dnaA chromosomal replication initiation protein; R	89.81
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	89.75
PRK13833		323	conjugal transfer protein TrbB; Provisional	89.75
PF00004		132	AAA: ATPase family associated with various cellula	89.63
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	89.41
PRK13897		606	type IV secretion system component VirD4; Provisio	89.4
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	89.29
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	89.24
PRK11054		684	helD DNA helicase IV; Provisional	89.23
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	89.13
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	89.05
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	89.02
PHA03311		828	helicase-primase subunit BBLF4; Provisional	88.93
COG1702		348	PhoH Phosphate starvation-inducible protein PhoH,	88.83
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	88.78
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	88.77
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	88.75
PHA03333		752	putative ATPase subunit of terminase; Provisional	88.68
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	88.67
PRK04328		249	hypothetical protein; Provisional	88.57
COG2256		436	MGS1 ATPase related to the helicase subunit of the	88.54
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	88.4
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	88.39
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	88.31
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	88.28
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	88.21
PRK00411		394	cdc6 cell division control protein 6; Reviewed	88.15
PRK08533		230	flagellar accessory protein FlaH; Reviewed	87.92
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	87.62
PRK04195		482	replication factor C large subunit; Provisional	87.59
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	87.52
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	87.31
PRK12422		445	chromosomal replication initiation protein; Provis	87.23
PRK05973		237	replicative DNA helicase; Provisional	87.08
PLN03025		319	replication factor C subunit; Provisional	87.07
PRK10436		462	hypothetical protein; Provisional	86.98
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	86.83
PTZ00293		211	thymidine kinase; Provisional	86.75
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	86.71
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	86.69
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	86.67
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	86.64
PRK09183		259	transposase/IS protein; Provisional	86.64
PRK14087		450	dnaA chromosomal replication initiation protein; P	86.54
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	86.51
PRK13822		641	conjugal transfer coupling protein TraG; Provision	86.5
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	86.42
PF10412		386	TrwB_AAD_bind: Type IV secretion-system coupling p	86.36
PRK12402		337	replication factor C small subunit 2; Reviewed	86.31
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	86.29
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	86.05
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	85.97
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	85.91
COG1221		403	PspF Transcriptional regulators containing an AAA-	85.83
TIGR00595		505	priA primosomal protein N'. All proteins in this f	85.82
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	85.8
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	85.71
PRK13850		670	type IV secretion system protein VirD4; Provisiona	85.68
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	85.59
PF12846		304	AAA_10: AAA-like domain	85.57
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	85.46
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	85.44
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	85.43
TIGR00064		272	ftsY signal recognition particle-docking protein F	85.29
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	85.19
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	85.17
PRK05580		679	primosome assembly protein PriA; Validated	85.15
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	85.1
PRK10416		318	signal recognition particle-docking protein FtsY;	85.1
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	85.08
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	84.97
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	84.94
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	84.76
cd01127		410	TrwB Bacterial conjugation protein TrwB, ATP bindi	84.74
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	84.72
cd00544		169	CobU Adenosylcobinamide kinase / adenosylcobinamid	84.56
TIGR02767		623	TraG-Ti Ti-type conjugative transfer system protie	84.54
PHA00350		399	putative assembly protein	84.51
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	84.41
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	84.41
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	84.37
PHA03368		738	DNA packaging terminase subunit 1; Provisional	84.24
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	84.2
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	84.19
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	84.07
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	83.9
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	83.88
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	83.74
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	83.62
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	83.4
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	83.19
PTZ00112		1164	origin recognition complex 1 protein; Provisional	83.07
COG3587		985	Restriction endonuclease [Defense mechanisms]	82.96
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	82.88
PRK10867		433	signal recognition particle protein; Provisional	82.85
PRK13342		413	recombination factor protein RarA; Reviewed	82.78
PRK14729		300	miaA tRNA delta(2)-isopentenylpyrophosphate transf	82.7
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	82.65
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	82.56
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	82.47
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	82.47
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	82.25
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	82.24
TIGR02237		209	recomb_radB DNA repair and recombination protein R	82.2
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	82.19
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	82.18
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	82.09
PRK06067		234	flagellar accessory protein FlaH; Validated	82.08
PRK13700		732	conjugal transfer protein TraD; Provisional	81.96
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	81.91
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	81.66
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	81.52
PF01745		233	IPT: Isopentenyl transferase; InterPro: IPR002648	81.47
PRK05800		170	cobU adenosylcobinamide kinase/adenosylcobinamide-	81.43
TIGR02533		486	type_II_gspE general secretory pathway protein E.	81.31
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	81.2
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	81.08
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	81.01
PLN02165		334	adenylate isopentenyltransferase	80.94
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	80.75
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	80.75
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	80.73
PRK14086		617	dnaA chromosomal replication initiation protein; P	80.64
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	80.62
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	80.53
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	80.46
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	80.39
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	80.24
PRK00771		437	signal recognition particle protein Srp54; Provisi	80.19
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	80.06
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	80.03

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=1.1e-96  Score=802.35  Aligned_cols=598  Identities=48%  Similarity=0.807  Sum_probs=551.7

Q ss_pred             HHHhhcchhhhhhhhhhhcCCCCCCChhHHHHHHhhhcCCChhhh-hH--hhcCCChhhhhhhhhhhHhhhhccCcHHHH
Q 003587          192 FRFFSNSGWAANQALAVYIGKSFFPTAAGKFRSYFIKKCPDDVAQ-YL--VWLGPSDDAVKFLFPIFVEFCIEEFPDEIK  268 (809)
Q Consensus       192 l~~f~~~~~~~~~~~~~~i~~~~~p~~~~~f~~~~~~~~~~~~~~-~l--~~~~~~~~~~~~llp~f~~~~~~~f~~~l~  268 (809)
                      +..|.+++.........++....++..+.+|+.++.......+.. .+  .++.........++|.|..+++..|| .+.
T Consensus        87 l~~~~~rk~~~~l~~~~g~~~~~~~~~~~sf~~~~~~~~~l~~~~l~i~~~di~~g~~~~~~lfp~f~~~~k~~fp-~l~  165 (700)
T KOG0953|consen   87 LDKFQVRKDWTSLPSVYGFDLPLFPAAFISFRIYCNKSEFLDVDSLHILTNDIRKGAKDIDFLFPFFLRHAKQEFP-ELT  165 (700)
T ss_pred             HHHHHHhHHHHhhccccccccccchhhhHHHHHHhcchhccccchhhhhhhhhhcCCCchhhhhhHHHHHHHHHhc-ccc
Confidence            334555554444555566777889999999999987776665542 22  36667777778899999999999999 677


Q ss_pred             HHHHHHHhCCCCCCCccchhHHhhCCCeEEEEcCCCChHHHHHHHHHHcCCcEEEEcccHhHHHHHHHHHHhcCCceeee
Q 003587          269 RFRAMIESADLTKPHTWFPFARVMKRKIIYHCGPTNSGKTYNALQRFMEAKKGIYCSPLRLLAMEVFDKVNALGVYCSLL  348 (809)
Q Consensus       269 ~i~~~l~~~g~~~Pt~~~p~~~~l~grdviv~apTGSGKTl~~L~~L~~~~~~LvlsPtR~La~Q~~~~l~~~g~~~~l~  348 (809)
                      +..+.....+++.|..|||.+|.+.++.++++|||+||||+-+|+.+...++++|+.|+|.||.++++++++.|++|.++
T Consensus       166 ~~Ddl~~isDLt~P~~WyP~AR~~~RkIi~H~GPTNSGKTy~ALqrl~~aksGvycGPLrLLA~EV~~r~na~gipCdL~  245 (700)
T KOG0953|consen  166 RMDDLKKISDLTNPANWYPEARKIRRKIIMHVGPTNSGKTYRALQRLKSAKSGVYCGPLRLLAHEVYDRLNALGIPCDLL  245 (700)
T ss_pred             cchhhhhhhccCCCcccCchhHhhhheEEEEeCCCCCchhHHHHHHHhhhccceecchHHHHHHHHHHHhhhcCCCcccc
Confidence            77777788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccccccccc----CcceeeeeeecccCCcccEEEEecccccccccchhHHHHHHhhcccccccccCCchHHHHHHHHhh
Q 003587          349 TGQEKKLVPF----SNHIACTVEMVSTDEMYDVAVIDEIQMMSDACRGYAWTRALLGLMADEIHLCGDPSVLDVVRKICS  424 (809)
Q Consensus       349 ~g~~~~~~~~----~~~i~~tie~lt~~rlv~~vVIDEAH~i~d~~~g~~~~~ill~l~~~~i~l~~s~~~~~li~~l~~  424 (809)
                      ||++......    +.++.||+||++....+++.||||+|+|.|..+||+|+++++|+.++++|+|++|.+++++++++.
T Consensus       246 TGeE~~~~~~~~~~a~hvScTVEM~sv~~~yeVAViDEIQmm~Dp~RGwAWTrALLGl~AdEiHLCGepsvldlV~~i~k  325 (700)
T KOG0953|consen  246 TGEERRFVLDNGNPAQHVSCTVEMVSVNTPYEVAVIDEIQMMRDPSRGWAWTRALLGLAADEIHLCGEPSVLDLVRKILK  325 (700)
T ss_pred             ccceeeecCCCCCcccceEEEEEEeecCCceEEEEehhHHhhcCcccchHHHHHHHhhhhhhhhccCCchHHHHHHHHHh
Confidence            9999886654    889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCceEEeeccccchhhHhHHHHHHHHHhcCCCCEEEEechhHHHHHHHHHHHhcCCeEEEEeCCCCHHHHHHHHHHhh
Q 003587          425 ETGDELHEQHYERFKPLVVEAKTLLGDLRNVRSGDCVVAFSRREIFEVKMAIEKHTNHHCCVIYGALPPETRRQQANLFN  504 (809)
Q Consensus       425 ~~~~~~~~~~~~r~~~l~~~~k~ll~~l~~~~~g~~II~fsrk~~~~l~~~L~~~~g~~v~~lhg~l~~~~R~~~~~~F~  504 (809)
                      .+++++.+..|+|+.|+.++. .+++.+.+..+|+|||+||++++..+...+++..+.+|+++||+|||+.|.++...|+
T Consensus       326 ~TGd~vev~~YeRl~pL~v~~-~~~~sl~nlk~GDCvV~FSkk~I~~~k~kIE~~g~~k~aVIYGsLPPeTr~aQA~~FN  404 (700)
T KOG0953|consen  326 MTGDDVEVREYERLSPLVVEE-TALGSLSNLKPGDCVVAFSKKDIFTVKKKIEKAGNHKCAVIYGSLPPETRLAQAALFN  404 (700)
T ss_pred             hcCCeeEEEeecccCcceehh-hhhhhhccCCCCCeEEEeehhhHHHHHHHHHHhcCcceEEEecCCCCchhHHHHHHhC
Confidence            999999999999999999887 7889999999999999999999999999999987778999999999999999999999


Q ss_pred             cCCCCeEEEEecccccccccccccEEEEcCCCCCCCCCcccCCHhHHHHHHcccCCCCCCCCceEEEEEecccHHHHHHH
Q 003587          505 DQDNEFDVLVASDAVGMGLNLNIRRVVFYSLSKYNGDKIIPVPGSQVKQIAGRAGRRGSIYPDGLTTTLNLDDLDYLIEC  584 (809)
Q Consensus       505 ~~~g~~~ILVATdal~~GIDipV~~VI~~d~~K~dg~~~~P~s~~~y~Qr~GRAGR~G~~~~~G~~i~~~~~d~~~l~~~  584 (809)
                      +|+++++|||||||+|||+|++|++||++++.||+|....|.+.++..|++|||||.|..++.|.+++|..+|...+++.
T Consensus       405 d~~~e~dvlVAsDAIGMGLNL~IrRiiF~sl~Kysg~e~~~it~sqikQIAGRAGRf~s~~~~G~vTtl~~eDL~~L~~~  484 (700)
T KOG0953|consen  405 DPSNECDVLVASDAIGMGLNLNIRRIIFYSLIKYSGRETEDITVSQIKQIAGRAGRFGSKYPQGEVTTLHSEDLKLLKRI  484 (700)
T ss_pred             CCCCccceEEeecccccccccceeEEEEeecccCCcccceeccHHHHHHHhhcccccccCCcCceEEEeeHhhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCchHHHHhcCCCcHHHHHHHHhcCccchHHHHHHHHhhhcccCCccccCCcchHHHHHHHHHHhcCCCccccccccC
Q 003587          585 LKQPFEVVKKVGLFPFFEQVELFAGQLSNYTFCQLLEKFGENCRLDGSYFLCRHDHIKKVANMLEKVQGLSLEDRFNFCF  664 (809)
Q Consensus       585 l~~~~~~~~~~~~~p~~~~l~~~~~~~~~~~~~~ll~~f~e~~~~~~~~~~c~~~~~~~~a~~L~~~~~l~l~d~~~~c~  664 (809)
                      |..+.+++..++++|+.++++.|+.++++..++.|++.|...++.++.|++|+.++.+.+|.+|++++ |++.|++.||.
T Consensus       485 l~~p~epi~~agl~pt~eqie~fa~~~Pd~t~snLld~f~~~~~~~~~fflc~~~~~k~va~liehi~-L~l~dr~~fc~  563 (700)
T KOG0953|consen  485 LKRPVEPIKNAGLWPTDEQIELFAYHLPDATPSNLLDIFVKLCEVDGLFFLCNLDDFKFVAELIEHIE-LPLKDRYKFCT  563 (700)
T ss_pred             HhCCchHHHhccCCccHHHHHHHHHhCCCccHHHHHHHHHHHHccCCceEEecchhHHHHHHHHHhCC-cchhhhheeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999 99999999999


Q ss_pred             CCCCCcchHHHHHHHHHHhhccCCceEE-----eecCCCCCCCCchhhHHHHHhhhhhhhHhHHhhccCCCCCCCCHHHH
Q 003587          665 APVNIRDPKAMYHLLRFASSYSKNAPVS-----IAMGMPKGSAKNDAELLDLETKHQVLSMYLWLSHQFKEEVFPYAKKA  739 (809)
Q Consensus       665 ~P~~~~~~~~~~~~~~~~~~~~~~~~v~-----il~g~~~~~~~~~~~l~~le~~h~~l~~y~wls~rf~~~~f~~~~~~  739 (809)
                      +|++..++.+++++++||+.|+.++++.     ..+|+|...+++..+|.+||++|++|++|+|||+||| ++|||.+.|
T Consensus       564 aPvnk~~p~v~~~f~kfa~~~s~~~~l~~~~l~~~~~~p~~~p~t~~~L~~LEs~h~il~lYmWlS~Rfp-d~fpd~~~v  642 (700)
T KOG0953|consen  564 APVNKKMPRVCSAFLKFARQYSQNEPLTFLWLKFNLGWPNKIPKTIYELEDLESLHDILDLYMWLSNRFP-DMFPDAESV  642 (700)
T ss_pred             CcccccCchHHHHHHHHHHHHhcCCcccHHHHHHhhcCCCCCCccHHHHHHHHHHHHHHHHHHHHHhhhh-hhccChHHH
Confidence            9999999999999999999999999999     5689999999999999999999999999999999999 999999999


Q ss_pred             HHHHHHHHHHHHHHHhhcCCchhhhhccCCcccccCCCCCcchhhhHHHHHHhhh
Q 003587          740 EAMATDIAELLGQSLTNANWKPESRQAGKPKLHQQREDGYDRPRSIIKSYENRKR  794 (809)
Q Consensus       740 ~~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  794 (809)
                      ++++..+..+|.+.+.++.|..++...-+-+-..+.+-+++||-++.|. +.+.+
T Consensus       643 rd~~~~ld~ii~egv~~~~k~~~~~e~~~~~g~~~~s~rr~r~~k~p~~-~~~~~  696 (700)
T KOG0953|consen  643 RDLKKELDEIIQEGVSKLTKLLKAHETFSTGGQSKSSRRRERPAKLPKL-RKRLD  696 (700)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhhcCCCccccccchhcccccCcccCcch-hhhhh
Confidence            9999999999999999999998877544232223444778888888877 54443

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PF12513 SUV3_C: Mitochondrial degradasome RNA helicase subunit C terminal; InterPro: IPR022192 This domain family is found in bacteria and eukaryotes, and is approximately 50 amino acids in length	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PHA03311 helicase-primase subunit BBLF4; Provisional	Back alignment and domain information

>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK13822 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK13850 type IV secretion system protein VirD4; Provisional	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU)	Back alignment and domain information

>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG	Back alignment and domain information

>PHA00350 putative assembly protein	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK13700 conjugal transfer protein TraD; Provisional	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid []	Back alignment and domain information

>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN02165 adenylate isopentenyltransferase	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		809
3rc8_A		677	Human Mitochondrial Helicase Suv3 In Complex With S		1e-116
3rc3_A		677	Human Mitochondrial Helicase Suv3 Length = 677		1e-112
4a4z_A		997	Crystal Structure Of The S. Cerevisiae Dexh Helicas		4e-06
2xgj_A		1010	Structure Of Mtr4, A Dexh Helicase Involved In Nucl		2e-05
3l9o_A		1108	Crystal Structure Of Mtr4, A Co-Factor Of The Nucle		2e-05
2p6r_A		702	Crystal Structure Of Superfamily 2 Helicase Hel308		5e-04

>pdb|3RC8|A Chain A, Human Mitochondrial Helicase Suv3 In Complex With Short Rna Fragment Length = 677