Citrus Sinensis ID: 005511

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV
cccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHccccccccccccEEEEEccHHHcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHccccccccccccccccccccccccHHHccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHcHHHHHccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHcHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccEEEEEEccccccHHHHHHHHHHHHcccccccEEccccccccHHHHHHccccccccccccccccHHHHHccccccEEEcHHHcccccHHHHHHHHHHccccccccccccccccccEEEEcccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEccccccccccccccccc
ccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccHHHcccEEEEEEHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHEccccHHHHHHHHHHHHHHHHcccccEcccccHHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEcHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHcccHccEEEEcHHHHHHHccHHHHcccccccccccccccccHHHcccccEEEEEHHHHHHcHHHHHHHHHHHHccccccccccEEEcccEEEEEEccccHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHHccHHHHHHHcHEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEEcHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEcccccccccccccccc
mvgesteavgagvgggssgnkmptleeYGTNLTKlaeegkldpvvgrqpQIERVVQILGrrtknnpcligepgvgKTAIAEGLAQriasgdvpdtiegkkVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAanilkpslargelqciGATTLDEYRKHiekdpalerrfqpvkvpepsvdETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKneavrgqdfekageLRDREMDLKAQISALVDKGKemskaeteagdvgpvvtEVDIQHIVSAwtgipvekvstdESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARvglknpnrpiasfifsgptgvgkSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSkligsppgyvgyteggqlteavrrrpytVVLFDEIEKAHPDVFNMMLQILedgrltdskgrtvdfKNTLLIMTSNvgssviekggrrigfdldydekdssynRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVeegynpsygarpLRRAIMRLLEDSMAEKMLAREIkegdsvivdvdsdgnvtvlngssgapesladplpvv
mvgesteavgagvgggssgnkmpTLEEYGTNLTKLAEegkldpvvgrqpqIERVVQilgrrtknnpcligepGVGKTAIAEGLAQriasgdvpdtiegkkvitldmgllvagTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEkdpalerrfqpvkvpepsvdetIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQitkekneavrgqdfekagelrdremDLKAQISALVDKGKEMSKAeteagdvgpvvTEVDIQHIvsawtgipvekvstdeSDRLLKMEETlhkrvigqdeavKAISRAIRRarvglknpnrpiasfifsgptgvGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSkligsppgyvGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEdgrltdskgRTVDFkntllimtsnvgssviekggrrigfdldydekdssynrIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEvfdrlktkdielqvterfrervveegynpsygarplrRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVlngssgapesladplpvv
MvgesteavgagvgggssgNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLigagaaegaidaaniLKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQvterfrervveeGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEgdsvivdvdsdgnvTVLNGSSGAPESLADPLPVV
*******************************************VVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIE******************VDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEA**************************************************************************VGPVVTEVDIQHIVSAWTGIPVEKVS*******L***ETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLE****************SVIVDV**************************
***************************YGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRL*************KELRQITK**N**VRGQDFEKAGELRDR******************************VVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR********************VTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGN*********************
**************GGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVD*************DVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV
*********************MPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALVDKGKEMSK******DVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSS*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYxxxxxxxxxxxxxxxxxxxxxILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGSRVRLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxQDFEKAGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
P31541926 ATP-dependent Clp proteas N/A no 0.998 0.747 0.938 0.0
Q9FI56929 Chaperone protein ClpC1, yes no 0.997 0.743 0.931 0.0
P31542923 ATP-dependent Clp proteas N/A no 0.998 0.749 0.945 0.0
P35100922 Chaperone protein ClpC, c N/A no 0.998 0.750 0.924 0.0
Q7F9I1918 Chaperone protein ClpC1, yes no 0.998 0.753 0.920 0.0
Q2QVG9919 Chaperone protein ClpC2, yes no 0.992 0.748 0.915 0.0
P46523874 ATP-dependent Clp proteas N/A no 0.994 0.788 0.900 0.0
Q9SXJ7952 Chaperone protein ClpC2, no no 1.0 0.727 0.876 0.0
Q53LY0932 Chaperone protein ClpC3, no no 0.988 0.734 0.778 0.0
Q1XDF4821 ATP-dependent Clp proteas N/A no 0.972 0.820 0.731 0.0
>sp|P31541|CLPAA_SOLLC ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic OS=Solanum lycopersicum GN=CD4A PE=3 SV=1 Back     alignment and function desciption
 Score = 1315 bits (3402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/694 (93%), Positives = 672/694 (96%), Gaps = 2/694 (0%)

Query: 1   MVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGR 60
           MVGES+EAVGA VGGG+SG KMPTLEEYGTNLTKLAEEGKLDPVVGRQ QIERV QILGR
Sbjct: 233 MVGESSEAVGASVGGGTSGLKMPTLEEYGTNLTKLAEEGKLDPVVGRQAQIERVTQILGR 292

Query: 61  RTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFE 120
           RTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFE
Sbjct: 293 RTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFE 352

Query: 121 ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLD 180
           ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKP+LARGELQCIGATTLD
Sbjct: 353 ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLD 412

Query: 181 EYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLS 240
           EYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKL YTDEA+ +AA+LS
Sbjct: 413 EYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLHYTDEAIEAAAKLS 472

Query: 241 YQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEK 300
           +QYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEK
Sbjct: 473 HQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEK 532

Query: 301 AGELRDREMDLKAQISALVDKGKEMSKAETEAGDV-GPVVTEVDIQHIVSAWTGIPVEKV 359
           AGELRDREMDLKAQISAL+DK KE SKAE+EAGD  GP+VTE DIQHIVS+WTGIPVEKV
Sbjct: 533 AGELRDREMDLKAQISALIDKNKEKSKAESEAGDAAGPIVTEADIQHIVSSWTGIPVEKV 592

Query: 360 STDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGK 419
           STDESDRLLKMEETLH RVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGK
Sbjct: 593 STDESDRLLKMEETLHTRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGK 652

Query: 420 SELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPY 479
           SELAK+LA YYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPY
Sbjct: 653 SELAKSLATYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPY 712

Query: 480 TVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR 539
           TVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR
Sbjct: 713 TVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRR 772

Query: 540 IGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLK 599
           IGFDLD+DEKDSSYNRIKSLVTEELKQYFRPEFLNRL EMIVFRQLTKLEVKEIADIMLK
Sbjct: 773 IGFDLDFDEKDSSYNRIKSLVTEELKQYFRPEFLNRLSEMIVFRQLTKLEVKEIADIMLK 832

Query: 600 EVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKE 659
           EVF RLK K+IELQVTERFR+RVV+EGYNPSYGARPLRRAIMRLLEDSMAEKMLA EIKE
Sbjct: 833 EVFVRLKNKEIELQVTERFRDRVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAGEIKE 892

Query: 660 GDSVIVDVDSDGNVTVLNGSSGAPESLADPLPVV 693
           GDSVIVDVDSDGNVTVLNG+SGAP   A P P++
Sbjct: 893 GDSVIVDVDSDGNVTVLNGTSGAPSDSA-PEPIL 925
May interact with a clpP-like protease involved in degradation of denatured proteins in the chloroplast.
Solanum lycopersicum (taxid: 4081)
>sp|Q9FI56|CLPC1_ARATH Chaperone protein ClpC1, chloroplastic OS=Arabidopsis thaliana GN=CLPC1 PE=1 SV=1 Back     alignment and function description
>sp|P31542|CLPAB_SOLLC ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4B, chloroplastic OS=Solanum lycopersicum GN=CD4B PE=3 SV=1 Back     alignment and function description
>sp|P35100|CLPC_PEA Chaperone protein ClpC, chloroplastic OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|Q7F9I1|CLPC1_ORYSJ Chaperone protein ClpC1, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC1 PE=2 SV=2 Back     alignment and function description
>sp|Q2QVG9|CLPC2_ORYSJ Chaperone protein ClpC2, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC2 PE=2 SV=2 Back     alignment and function description
>sp|P46523|CLPA_BRANA ATP-dependent Clp protease ATP-binding subunit clpA homolog, chloroplastic (Fragment) OS=Brassica napus GN=CLPA PE=2 SV=1 Back     alignment and function description
>sp|Q9SXJ7|CLPC2_ARATH Chaperone protein ClpC2, chloroplastic OS=Arabidopsis thaliana GN=CLPC2 PE=2 SV=1 Back     alignment and function description
>sp|Q53LY0|CLPC3_ORYSJ Chaperone protein ClpC3, chloroplastic OS=Oryza sativa subsp. japonica GN=CLPC3 PE=2 SV=1 Back     alignment and function description
>sp|Q1XDF4|CLPC_PORYE ATP-dependent Clp protease ATP-binding subunit clpA homolog OS=Porphyra yezoensis GN=clpC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
356516495 922 PREDICTED: chaperone protein ClpC, chlor 0.998 0.750 0.955 0.0
356508861 922 PREDICTED: chaperone protein ClpC, chlor 0.998 0.750 0.952 0.0
255540075 924 ATP-dependent clp protease, putative [Ri 1.0 0.75 0.952 0.0
307136002 929 ATP-dependent clp protease [Cucumis melo 0.998 0.744 0.971 0.0
449440498 929 PREDICTED: chaperone protein ClpC, chlor 0.998 0.744 0.968 0.0
225456471 923 PREDICTED: ATP-dependent Clp protease AT 0.998 0.749 0.963 0.0
449470390 924 PREDICTED: chaperone protein ClpC, chlor 0.998 0.748 0.963 0.0
147866973 890 hypothetical protein VITISV_010724 [Viti 0.971 0.756 0.964 0.0
356513459 919 PREDICTED: chaperone protein ClpC, chlor 0.998 0.752 0.939 0.0
399212 926 RecName: Full=ATP-dependent Clp protease 0.998 0.747 0.938 0.0
>gi|356516495|ref|XP_003526929.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
 Score = 1341 bits (3470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/692 (95%), Positives = 677/692 (97%)

Query: 1   MVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGR 60
           MVGES ++V A VG GSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERV QILGR
Sbjct: 231 MVGESADSVTATVGSGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVTQILGR 290

Query: 61  RTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFE 120
           RTKNNPCLIGEPGVGKTAIAEGLAQRIA+GDVP+TIEGKKVITLDMGLLVAGTKYRGEFE
Sbjct: 291 RTKNNPCLIGEPGVGKTAIAEGLAQRIANGDVPETIEGKKVITLDMGLLVAGTKYRGEFE 350

Query: 121 ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLD 180
           ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKP+LARGELQCIGATTLD
Sbjct: 351 ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLD 410

Query: 181 EYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLS 240
           EYRKHIEKDPALERRFQPVKVPEP+VDETIQILKGLRERYEIHHKLRYTDEALV+AAQLS
Sbjct: 411 EYRKHIEKDPALERRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEALVAAAQLS 470

Query: 241 YQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEK 300
           YQYISDRFLPDKAIDLIDEAGSRVRL+HAQLPEEAREL+KE+RQI KEK EAVR QDFEK
Sbjct: 471 YQYISDRFLPDKAIDLIDEAGSRVRLQHAQLPEEARELDKEVRQIIKEKEEAVRNQDFEK 530

Query: 301 AGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVS 360
           AGELRDREMDLKAQIS LV+KGKEMSKAETEAGD GP+VTE DIQHIVS+WTGIPVEKVS
Sbjct: 531 AGELRDREMDLKAQISTLVEKGKEMSKAETEAGDEGPIVTEADIQHIVSSWTGIPVEKVS 590

Query: 361 TDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKS 420
           TDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKS
Sbjct: 591 TDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKS 650

Query: 421 ELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYT 480
           ELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYT
Sbjct: 651 ELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYT 710

Query: 481 VVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRI 540
           VVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGR+I
Sbjct: 711 VVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRKI 770

Query: 541 GFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKE 600
           GFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKE
Sbjct: 771 GFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKE 830

Query: 601 VFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEG 660
           VFDRLK KDIELQVTERFR+RVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEG
Sbjct: 831 VFDRLKVKDIELQVTERFRDRVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEG 890

Query: 661 DSVIVDVDSDGNVTVLNGSSGAPESLADPLPV 692
           DSVIVDVDSDGNV VLNGSSGAPESL + LPV
Sbjct: 891 DSVIVDVDSDGNVIVLNGSSGAPESLPETLPV 922

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356508861|ref|XP_003523172.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 1 [Glycine max] gi|356508863|ref|XP_003523173.1| PREDICTED: chaperone protein ClpC, chloroplastic-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255540075|ref|XP_002511102.1| ATP-dependent clp protease, putative [Ricinus communis] gi|223550217|gb|EEF51704.1| ATP-dependent clp protease, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|307136002|gb|ADN33858.1| ATP-dependent clp protease [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449440498|ref|XP_004138021.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225456471|ref|XP_002284518.1| PREDICTED: ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449470390|ref|XP_004152900.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis sativus] gi|449505877|ref|XP_004162592.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147866973|emb|CAN78847.1| hypothetical protein VITISV_010724 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356513459|ref|XP_003525431.1| PREDICTED: chaperone protein ClpC, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|399212|sp|P31541.1|CLPAA_SOLLC RecName: Full=ATP-dependent Clp protease ATP-binding subunit clpA homolog CD4A, chloroplastic; Flags: Precursor gi|170433|gb|AAA34160.1| ATP-dependent protease (CD4A) [Solanum lycopersicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
TAIR|locus:2157383929 CLPC1 "CLPC homologue 1" [Arab 0.971 0.724 0.883 3.1e-312
TAIR|locus:2099433952 HSP93-III [Arabidopsis thalian 0.972 0.707 0.836 1.3e-297
UNIPROTKB|Q3A9N1811 CHY_2348 "Negative regulator o 0.909 0.776 0.613 7.5e-208
TIGR_CMR|CHY_2348811 CHY_2348 "negative regulator o 0.909 0.776 0.613 7.5e-208
UNIPROTKB|Q81VV9811 BAS0081 "Negative regulator of 0.906 0.774 0.583 2.6e-198
TIGR_CMR|BA_0080811 BA_0080 "negative regulator of 0.906 0.774 0.583 2.6e-198
UNIPROTKB|Q724I0820 LMOf2365_0244 "ClpC ATPase" [L 0.904 0.764 0.570 1.5e-193
UNIPROTKB|P0A522848 clpC "Probable ATP-dependent C 0.896 0.732 0.573 3.2e-191
TIGR_CMR|DET_0057824 DET_0057 "ATP-dependent Clp pr 0.906 0.762 0.549 1.3e-187
TIGR_CMR|DET_1413812 DET_1413 "chaperone ClpB" [Deh 0.911 0.778 0.541 1.4e-183
TAIR|locus:2157383 CLPC1 "CLPC homologue 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2995 (1059.4 bits), Expect = 3.1e-312, P = 3.1e-312
 Identities = 598/677 (88%), Positives = 619/677 (91%)

Query:    20 NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAI 79
             NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAI
Sbjct:   252 NKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAI 311

Query:    80 AEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILF 139
             AEGLAQRIASGDVP+TIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEI+QSDEIILF
Sbjct:   312 AEGLAQRIASGDVPETIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIRQSDEIILF 371

Query:   140 IDEVHTLXXXXXXXXXXXXXXXLKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPV 199
             IDEVHTL               LKP+LARGELQCIGATTLDEYRKHIEKDPALERRFQPV
Sbjct:   372 IDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLDEYRKHIEKDPALERRFQPV 431

Query:   200 KVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDE 259
             KVPEP+VDETIQILKGLRERYEIHHKLRYTDE+LV+AAQLSYQYISDRFLPDKAIDLIDE
Sbjct:   432 KVPEPTVDETIQILKGLRERYEIHHKLRYTDESLVAAAQLSYQYISDRFLPDKAIDLIDE 491

Query:   260 AGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKAQISALV 319
             AGSRVRLRHAQ+PEEARELEKELRQITKEKNEAVRGQDFEKAG LRDRE++L+A++SA+ 
Sbjct:   492 AGSRVRLRHAQVPEEARELEKELRQITKEKNEAVRGQDFEKAGTLRDREIELRAEVSAIQ 551

Query:   320 DKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVI 379
              KGKEMSKAE+E G+ GP+VTE DIQHIVS+WTGIPVEKVSTDESDRLLKMEETLHKR+I
Sbjct:   552 AKGKEMSKAESETGEEGPMVTESDIQHIVSSWTGIPVEKVSTDESDRLLKMEETLHKRII 611

Query:   380 GQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIR 439
             GQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIR
Sbjct:   612 GQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIR 671

Query:   440 LDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMML 499
             LDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMML
Sbjct:   672 LDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMML 731

Query:   500 QILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSL 559
             QILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSL
Sbjct:   732 QILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSL 791

Query:   560 VTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQXXXXXX 619
             VTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADI+LKEVF+RLK K+IELQ      
Sbjct:   792 VTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADILLKEVFERLKKKEIELQVTERFK 851

Query:   620 XXXXXXGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEXXXXXXXXXXXXXXTVLNGS 679
                   GYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKE              TVLNG 
Sbjct:   852 ERVVDEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDAEGNVTVLNGG 911

Query:   680 SGAP----ESLADPLPV 692
             SG P    E   D LPV
Sbjct:   912 SGTPTTSLEEQEDSLPV 928
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004518 "nuclease activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006289 "nucleotide-excision repair" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0019538 "protein metabolic process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009532 "plastid stroma" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009658 "chloroplast organization" evidence=IMP
GO:0031897 "Tic complex" evidence=TAS
GO:0045037 "protein import into chloroplast stroma" evidence=IMP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IMP
GO:0045036 "protein targeting to chloroplast" evidence=IMP
GO:0005829 "cytosol" evidence=RCA
GO:0009706 "chloroplast inner membrane" evidence=IDA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0034660 "ncRNA metabolic process" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0042793 "transcription from plastid promoter" evidence=RCA
GO:0009536 "plastid" evidence=IDA
GO:0004176 "ATP-dependent peptidase activity" evidence=IDA
TAIR|locus:2099433 HSP93-III [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3A9N1 CHY_2348 "Negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2348 CHY_2348 "negative regulator of genetic competence clpC/mecB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q81VV9 BAS0081 "Negative regulator of genetic competence ClpC/MecB" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0080 BA_0080 "negative regulator of genetic competence ClpC/MecB" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q724I0 LMOf2365_0244 "ClpC ATPase" [Listeria monocytogenes serotype 4b str. F2365 (taxid:265669)] Back     alignment and assigned GO terms
UNIPROTKB|P0A522 clpC "Probable ATP-dependent Clp protease ATP-binding subunit" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0057 DET_0057 "ATP-dependent Clp protease, ATP-binding subunit ClpC" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1413 DET_1413 "chaperone ClpB" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P24428CLPC_MYCLENo assigned EC number0.58170.91340.7464yesno
Q7F9I1CLPC1_ORYSJNo assigned EC number0.92050.99850.7538yesno
Q7CU92CLPB_AGRT5No assigned EC number0.52270.91770.7276yesno
Q2YSD6CLPC_STAABNo assigned EC number0.58650.92920.7872yesno
P35100CLPC_PEANo assigned EC number0.92480.99850.7505N/Ano
P51332CLPC_PORPUNo assigned EC number0.73000.97250.8209N/Ano
Q98G96CLPB_RHILONo assigned EC number0.51380.92920.7419yesno
Q9FI56CLPC1_ARATHNo assigned EC number0.93100.99710.7438yesno
Q74FF1CLPB_GEOSLNo assigned EC number0.52100.92640.7421yesno
P31542CLPAB_SOLLCNo assigned EC number0.94510.99850.7497N/Ano
P31541CLPAA_SOLLCNo assigned EC number0.93800.99850.7473N/Ano
Q2G0P5CLPC_STAA8No assigned EC number0.58340.92920.7872yesno
Q1XDF4CLPC_PORYENo assigned EC number0.73150.97250.8209N/Ano
Q9TM05CLPC_CYACANo assigned EC number0.71210.97540.7915N/Ano
P37571CLPC_BACSUNo assigned EC number0.59670.94800.8111yesno
Q9RA63CLPB_THET8No assigned EC number0.55170.92200.7482yesno
P0A522CLPC_MYCTUNo assigned EC number0.58550.91480.7476yesno
P0A523CLPC_MYCBONo assigned EC number0.58550.91480.7476yesno
Q72IK9CLPB_THET2No assigned EC number0.55170.92200.7482yesno
Q2QVG9CLPC2_ORYSJNo assigned EC number0.91580.99270.7486yesno
Q8NXY8CLPC_STAAWNo assigned EC number0.58190.92920.7872yesno
Q99W78CLPC_STAAMNo assigned EC number0.58340.92920.7872yesno
Q4L3I4CLPC_STAHJNo assigned EC number0.59230.93210.7839yesno
Q7X2S8CLPB_MEIRUNo assigned EC number0.53120.90040.7306yesno
P46523CLPA_BRANANo assigned EC number0.90080.99420.7883N/Ano
Q8EU05CLPB_OCEIHNo assigned EC number0.60500.95520.8182yesno
Q8CQ88CLPC_STAESNo assigned EC number0.58950.92920.7882yesno
Q7A797CLPC_STAANNo assigned EC number0.58340.92920.7872yesno
Q6GJE4CLPC_STAARNo assigned EC number0.58340.92920.7872yesno
P0C281CLPC_STAACNo assigned EC number0.58340.92920.7872yesno
O78410CLPC_GUITHNo assigned EC number0.75540.92060.7789yesno
Q5HRM8CLPC_STAEQNo assigned EC number0.58950.92920.7882yesno
Q49V34CLPC_STAS1No assigned EC number0.59410.92920.7853yesno
Q6GBW3CLPC_STAASNo assigned EC number0.58340.92920.7872yesno
Q7N788CLPB_PHOLLNo assigned EC number0.51700.91340.7386yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.691
3rd Layer3.6.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.0
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 0.0
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone 0.0
PRK10865857 PRK10865, PRK10865, protein disaggregation chapero 0.0
TIGR02639730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.0
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp 0.0
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 3e-97
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 3e-88
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-bin 2e-83
pfam1043181 pfam10431, ClpB_D2-small, C-terminal, D2-small dom 9e-27
smart0108690 smart01086, ClpB_D2-small, C-terminal, D2-small do 3e-25
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 5e-21
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 7e-18
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-14
pfam00004131 pfam00004, AAA, ATPase family associated with vari 6e-14
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 1e-11
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 3e-10
smart00382148 smart00382, AAA, ATPases associated with a variety 2e-09
TIGR02902 531 TIGR02902, spore_lonB, ATP-dependent protease LonB 3e-07
pfam00004131 pfam00004, AAA, ATPase family associated with vari 4e-06
pfam0215136 pfam02151, UVR, UvrB/uvrC motif 4e-06
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 2e-05
PRK05298652 PRK05298, PRK05298, excinuclease ABC subunit B; Pr 6e-05
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 7e-05
pfam13401124 pfam13401, AAA_22, AAA domain 1e-04
TIGR02397355 TIGR02397, dnaX_nterm, DNA polymerase III, subunit 1e-04
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 2e-04
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 2e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 2e-04
pfam13401124 pfam13401, AAA_22, AAA domain 5e-04
pfam13191154 pfam13191, AAA_16, AAA ATPase domain 7e-04
TIGR02640262 TIGR02640, gas_vesic_GvpN, gas vesicle protein Gvp 0.001
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.001
PRK13342413 PRK13342, PRK13342, recombination factor protein R 0.002
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 0.002
TIGR00678188 TIGR00678, holB, DNA polymerase III, delta' subuni 0.002
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.003
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.003
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excisio 0.003
PRK05896 605 PRK05896, PRK05896, DNA polymerase III subunits ga 0.004
>gnl|CDD|214361 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information 
 Score = 1113 bits (2882), Expect = 0.0
 Identities = 483/677 (71%), Positives = 578/677 (85%), Gaps = 8/677 (1%)

Query: 1   MVGESTEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGR 60
           ++GE  EA+   +G   S +K PTLEE+GTNLTK A +G LDPV+GR+ +IERV+QILGR
Sbjct: 141 LIGEIIEAI---LGAEQSRSKTPTLEEFGTNLTKEAIDGNLDPVIGREKEIERVIQILGR 197

Query: 61  RTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFE 120
           RTKNNP LIGEPGVGKTAIAEGLAQRI + DVPD +E K VITLD+GLL+AGTKYRGEFE
Sbjct: 198 RTKNNPILIGEPGVGKTAIAEGLAQRIVNRDVPDILEDKLVITLDIGLLLAGTKYRGEFE 257

Query: 121 ERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLD 180
           ERLK++ +EI++++ IIL IDEVHTLIGAGAAEGAIDAANILKP+LARGELQCIGATTLD
Sbjct: 258 ERLKRIFDEIQENNNIILVIDEVHTLIGAGAAEGAIDAANILKPALARGELQCIGATTLD 317

Query: 181 EYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLS 240
           EYRKHIEKDPALERRFQPV V EPSV+ETI+IL GLR RYE HH L  +D+AL +AA+LS
Sbjct: 318 EYRKHIEKDPALERRFQPVYVGEPSVEETIEILFGLRSRYEKHHNLSISDKALEAAAKLS 377

Query: 241 YQYISDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEK 300
            QYI+DRFLPDKAIDL+DEAGSRVRL +++LP  AREL+KELR+I K+K+EA+R QDFE 
Sbjct: 378 DQYIADRFLPDKAIDLLDEAGSRVRLINSRLPPAARELDKELREILKDKDEAIREQDFET 437

Query: 301 AGELRDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVS 360
           A +LRDREM+++AQI+A+     +  K E E     PVVTE DI  IVSAWTGIPV K++
Sbjct: 438 AKQLRDREMEVRAQIAAI----IQSKKTEEEKRLEVPVVTEEDIAEIVSAWTGIPVNKLT 493

Query: 361 TDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKS 420
             ES++LL MEETLHKR+IGQDEAV A+S+AIRRARVGLKNPNRPIASF+FSGPTGVGK+
Sbjct: 494 KSESEKLLHMEETLHKRIIGQDEAVVAVSKAIRRARVGLKNPNRPIASFLFSGPTGVGKT 553

Query: 421 ELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYT 480
           EL KALA+Y+FGSE+AMIRLDMSE+ME+HTVSKLIGSPPGYVGY EGGQLTEAVR++PYT
Sbjct: 554 ELTKALASYFFGSEDAMIRLDMSEYMEKHTVSKLIGSPPGYVGYNEGGQLTEAVRKKPYT 613

Query: 481 VVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRI 540
           VVLFDEIEKAHPD+FN++LQIL+DGRLTDSKGRT+DFKNTL+IMTSN+GS VIE     +
Sbjct: 614 VVLFDEIEKAHPDIFNLLLQILDDGRLTDSKGRTIDFKNTLIIMTSNLGSKVIETNSGGL 673

Query: 541 GFDL-DYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLK 599
           GF+L +    +  Y R+ +LV EELKQ+FRPEFLNRLDE+IVFRQLTK +V EIA+IMLK
Sbjct: 674 GFELSENQLSEKQYKRLSNLVNEELKQFFRPEFLNRLDEIIVFRQLTKNDVWEIAEIMLK 733

Query: 600 EVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKE 659
            +F RL  + I+L+VTER +  ++EEGYNP YGARPLRRAIMRLLED +AE++L+ +IK 
Sbjct: 734 NLFKRLNEQGIQLEVTERIKTLLIEEGYNPLYGARPLRRAIMRLLEDPLAEEVLSFKIKP 793

Query: 660 GDSVIVDVDSDGNVTVL 676
           GD +IVDV+ +  V +L
Sbjct: 794 GDIIIVDVNDEKEVKIL 810

Length = 821
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234173 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|204486 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|198154 smart01086, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|145355 pfam02151, UVR, UvrB/uvrC motif Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|235395 PRK05298, PRK05298, excinuclease ABC subunit B; Provisional Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|233847 TIGR02397, dnaX_nterm, DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|221970 pfam13191, AAA_16, AAA ATPase domain Back     alignment and domain information
>gnl|CDD|131688 TIGR02640, gas_vesic_GvpN, gas vesicle protein GvpN Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|233087 TIGR00678, holB, DNA polymerase III, delta' subunit Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223630 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|235638 PRK05896, PRK05896, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 100.0
CHL00095821 clpC Clp protease ATP binding subunit 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 100.0
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 100.0
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.98
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 99.97
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.96
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.96
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.96
COG2204464 AtoC Response regulator containing CheY-like recei 99.94
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.94
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.94
CHL00195489 ycf46 Ycf46; Provisional 99.93
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.93
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.93
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.92
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.92
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.92
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.92
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.92
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.91
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.91
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.91
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.91
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.9
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.9
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.9
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.9
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.9
CHL00195489 ycf46 Ycf46; Provisional 99.89
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.89
CHL00181287 cbbX CbbX; Provisional 99.89
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.89
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.88
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.88
PRK03992389 proteasome-activating nucleotidase; Provisional 99.87
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.87
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.87
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.87
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.87
COG1221403 PspF Transcriptional regulators containing an AAA- 99.87
PRK11608326 pspF phage shock protein operon transcriptional ac 99.87
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.86
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.86
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.86
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.86
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.86
KOG2028554 consensus ATPase related to the helicase subunit o 99.86
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.86
PRK15424538 propionate catabolism operon regulatory protein Pr 99.86
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.86
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.86
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.86
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.86
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.85
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.85
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.85
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.85
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.85
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.85
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.85
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.85
CHL00176638 ftsH cell division protein; Validated 99.84
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.84
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.84
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.84
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.84
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.84
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 99.84
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.83
PLN03025319 replication factor C subunit; Provisional 99.83
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.83
CHL00181287 cbbX CbbX; Provisional 99.83
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.83
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.83
PRK13342413 recombination factor protein RarA; Reviewed 99.83
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.83
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.82
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.82
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.82
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.82
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 99.82
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.82
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.82
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.82
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.82
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.81
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.81
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.81
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.81
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.8
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.8
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.8
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.8
CHL002062281 ycf2 Ycf2; Provisional 99.8
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.8
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.79
PRK13341725 recombination factor protein RarA/unknown domain f 99.79
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 99.79
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.79
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.79
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.79
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.78
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.78
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.78
PRK15115444 response regulator GlrR; Provisional 99.78
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.78
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.78
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.78
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.78
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.77
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.77
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.77
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.76
PRK04195482 replication factor C large subunit; Provisional 99.76
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.76
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.76
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.76
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.76
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.76
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 99.75
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.75
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.75
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.75
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.75
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.75
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.75
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.75
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.75
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.74
PRK12402337 replication factor C small subunit 2; Reviewed 99.74
PHA02544316 44 clamp loader, small subunit; Provisional 99.74
PRK03992389 proteasome-activating nucleotidase; Provisional 99.74
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.74
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.74
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.73
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.73
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.73
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.73
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.73
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.73
PRK04132846 replication factor C small subunit; Provisional 99.72
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.72
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.72
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.72
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.72
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.72
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.72
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.71
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.71
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.71
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.71
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.71
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.71
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.71
PLN03025319 replication factor C subunit; Provisional 99.71
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.71
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.71
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.71
CHL00176 638 ftsH cell division protein; Validated 99.7
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.7
PRK00440319 rfc replication factor C small subunit; Reviewed 99.7
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.7
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.69
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.69
KOG2028 554 consensus ATPase related to the helicase subunit o 99.69
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.69
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.69
PRK08084235 DNA replication initiation factor; Provisional 99.69
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.69
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.69
KOG2170344 consensus ATPase of the AAA+ superfamily [General 99.68
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.68
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.68
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.68
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.68
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.67
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.67
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.67
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.67
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.67
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.67
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.66
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.66
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.66
PRK13342 413 recombination factor protein RarA; Reviewed 99.66
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.66
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.66
PRK13341 725 recombination factor protein RarA/unknown domain f 99.66
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.66
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.66
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.66
PF00004132 AAA: ATPase family associated with various cellula 99.66
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.65
CHL00206 2281 ycf2 Ycf2; Provisional 99.65
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.65
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.65
PTZ001121164 origin recognition complex 1 protein; Provisional 99.64
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.64
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.64
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.63
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.63
PRK06893229 DNA replication initiation factor; Validated 99.62
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.62
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.62
PRK13531 498 regulatory ATPase RavA; Provisional 99.62
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.62
PRK07940394 DNA polymerase III subunit delta'; Validated 99.62
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.62
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.62
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.61
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.61
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.61
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.61
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.61
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.6
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.6
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.6
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.6
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.6
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.6
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.6
PRK12402337 replication factor C small subunit 2; Reviewed 99.6
PHA02544316 44 clamp loader, small subunit; Provisional 99.6
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.59
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.59
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.59
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.59
PRK00149450 dnaA chromosomal replication initiation protein; R 99.59
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.59
PRK14086617 dnaA chromosomal replication initiation protein; P 99.58
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.58
PRK05642234 DNA replication initiation factor; Validated 99.58
PRK04195 482 replication factor C large subunit; Provisional 99.58
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.58
PRK12422445 chromosomal replication initiation protein; Provis 99.58
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.57
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.57
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.57
PRK08727233 hypothetical protein; Validated 99.57
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.57
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.57
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.56
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.56
PRK14087450 dnaA chromosomal replication initiation protein; P 99.56
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK14088440 dnaA chromosomal replication initiation protein; P 99.56
PF00004132 AAA: ATPase family associated with various cellula 99.56
PHA02244383 ATPase-like protein 99.55
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.54
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 99.54
PRK09112351 DNA polymerase III subunit delta'; Validated 99.54
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.54
PRK07399314 DNA polymerase III subunit delta'; Validated 99.54
PRK07471365 DNA polymerase III subunit delta'; Validated 99.54
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.54
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.54
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 99.54
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.53
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.53
COG0714329 MoxR-like ATPases [General function prediction onl 99.53
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.52
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.52
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.52
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.52
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.52
PRK00440319 rfc replication factor C small subunit; Reviewed 99.51
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.51
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.51
PRK09112351 DNA polymerase III subunit delta'; Validated 99.51
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.51
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.5
PF07726131 AAA_3: ATPase family associated with various cellu 99.49
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.49
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.48
PRK07471365 DNA polymerase III subunit delta'; Validated 99.48
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.48
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.48
CHL00095821 clpC Clp protease ATP binding subunit 99.48
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.47
PRK10865857 protein disaggregation chaperone; Provisional 99.47
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.47
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.47
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.46
PRK06893229 DNA replication initiation factor; Validated 99.46
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.46
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.46
PRK05564313 DNA polymerase III subunit delta'; Validated 99.46
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.46
PRK05564313 DNA polymerase III subunit delta'; Validated 99.46
PRK08058329 DNA polymerase III subunit delta'; Validated 99.45
COG0593408 DnaA ATPase involved in DNA replication initiation 99.45
PRK06871325 DNA polymerase III subunit delta'; Validated 99.45
PRK08084235 DNA replication initiation factor; Provisional 99.44
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.44
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.44
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.43
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.43
PRK09087226 hypothetical protein; Validated 99.43
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 99.43
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.42
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.42
PRK13765 637 ATP-dependent protease Lon; Provisional 99.42
PRK08769319 DNA polymerase III subunit delta'; Validated 99.42
PRK07399314 DNA polymerase III subunit delta'; Validated 99.42
PRK06620214 hypothetical protein; Validated 99.41
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.41
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.41
PRK06090319 DNA polymerase III subunit delta'; Validated 99.41
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 99.4
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 99.4
PRK08727233 hypothetical protein; Validated 99.39
smart00350509 MCM minichromosome maintenance proteins. 99.39
PRK05707328 DNA polymerase III subunit delta'; Validated 99.39
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.38
KOG1969877 consensus DNA replication checkpoint protein CHL12 99.38
PRK08058329 DNA polymerase III subunit delta'; Validated 99.38
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.37
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.37
PRK07993334 DNA polymerase III subunit delta'; Validated 99.37
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.36
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.36
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.35
PRK06964342 DNA polymerase III subunit delta'; Validated 99.35
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.35
PRK05642234 DNA replication initiation factor; Validated 99.34
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.34
PRK13531498 regulatory ATPase RavA; Provisional 99.33
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.33
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.32
PRK09862506 putative ATP-dependent protease; Provisional 99.32
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.31
PRK04132846 replication factor C small subunit; Provisional 99.31
PRK12422445 chromosomal replication initiation protein; Provis 99.31
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 99.31
COG0470325 HolB ATPase involved in DNA replication [DNA repli 99.3
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.3
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 99.29
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.28
PRK05707328 DNA polymerase III subunit delta'; Validated 99.27
PRK00149450 dnaA chromosomal replication initiation protein; R 99.27
PRK07993334 DNA polymerase III subunit delta'; Validated 99.27
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.26
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 99.26
COG0714329 MoxR-like ATPases [General function prediction onl 99.26
PRK08769319 DNA polymerase III subunit delta'; Validated 99.25
PHA02244383 ATPase-like protein 99.24
PRK14088440 dnaA chromosomal replication initiation protein; P 99.24
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 99.23
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.23
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.23
PRK14086617 dnaA chromosomal replication initiation protein; P 99.23
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.22
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.22
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.22
PRK08699325 DNA polymerase III subunit delta'; Validated 99.2
PRK11608326 pspF phage shock protein operon transcriptional ac 99.19
PRK14087450 dnaA chromosomal replication initiation protein; P 99.19
PRK07276290 DNA polymerase III subunit delta'; Validated 99.19
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.19
PRK06871325 DNA polymerase III subunit delta'; Validated 99.19
smart00350509 MCM minichromosome maintenance proteins. 99.19
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.19
PRK05917290 DNA polymerase III subunit delta'; Validated 99.18
PRK06620214 hypothetical protein; Validated 99.18
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.18
COG2204464 AtoC Response regulator containing CheY-like recei 99.17
PRK15424538 propionate catabolism operon regulatory protein Pr 99.17
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.16
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.16
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.15
PF07726131 AAA_3: ATPase family associated with various cellu 99.15
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.15
PRK06964342 DNA polymerase III subunit delta'; Validated 99.14
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.14
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.13
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.12
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.12
PRK06090319 DNA polymerase III subunit delta'; Validated 99.12
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.11
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 99.11
PF1043181 ClpB_D2-small: C-terminal, D2-small domain, of Clp 99.11
PRK09087226 hypothetical protein; Validated 99.11
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.1
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.09
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.08
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.08
PTZ00111915 DNA replication licensing factor MCM4; Provisional 99.06
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 99.06
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.05
COG1221403 PspF Transcriptional regulators containing an AAA- 99.05
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 99.04
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.04
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.04
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 99.04
PRK05818261 DNA polymerase III subunit delta'; Validated 99.04
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.03
KOG1514767 consensus Origin recognition complex, subunit 1, a 99.01
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 99.0
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.98
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.98
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.97
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.96
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.96
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.96
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.96
PRK07132299 DNA polymerase III subunit delta'; Validated 98.95
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.94
PRK08699325 DNA polymerase III subunit delta'; Validated 98.93
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.93
PRK09862506 putative ATP-dependent protease; Provisional 98.91
PRK08116268 hypothetical protein; Validated 98.9
PRK15455 644 PrkA family serine protein kinase; Provisional 98.9
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 98.9
PRK12377248 putative replication protein; Provisional 98.89
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.88
PRK13765637 ATP-dependent protease Lon; Provisional 98.88
smart00382148 AAA ATPases associated with a variety of cellular 98.88
PRK12377248 putative replication protein; Provisional 98.87
PRK08116268 hypothetical protein; Validated 98.87
PRK05917290 DNA polymerase III subunit delta'; Validated 98.84
COG0593408 DnaA ATPase involved in DNA replication initiation 98.84
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.84
PRK07952244 DNA replication protein DnaC; Validated 98.84
KOG0480764 consensus DNA replication licensing factor, MCM6 c 98.83
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.82
smart00382148 AAA ATPases associated with a variety of cellular 98.82
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.79
PRK08181269 transposase; Validated 98.79
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.77
PF13173128 AAA_14: AAA domain 98.77
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.76
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.75
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.75
PRK07132299 DNA polymerase III subunit delta'; Validated 98.73
PRK07276290 DNA polymerase III subunit delta'; Validated 98.7
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.69
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 98.69
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 98.69
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.66
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 98.66
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.63
PRK06526254 transposase; Provisional 98.62
PRK13406584 bchD magnesium chelatase subunit D; Provisional 98.62
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.62
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.61
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.61
COG1241682 MCM2 Predicted ATPase involved in replication cont 98.61
PF13173128 AAA_14: AAA domain 98.61
PRK06581263 DNA polymerase III subunit delta'; Validated 98.61
PRK08939306 primosomal protein DnaI; Reviewed 98.59
PRK15115444 response regulator GlrR; Provisional 98.59
PRK06921266 hypothetical protein; Provisional 98.59
PRK06835329 DNA replication protein DnaC; Validated 98.58
PRK08181269 transposase; Validated 98.57
PRK06526254 transposase; Provisional 98.56
KOG0478804 consensus DNA replication licensing factor, MCM4 c 98.56
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.55
PRK07952244 DNA replication protein DnaC; Validated 98.55
PRK06835329 DNA replication protein DnaC; Validated 98.54
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.53
PF05729166 NACHT: NACHT domain 98.53
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 98.52
PRK09183259 transposase/IS protein; Provisional 98.5
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.5
PRK05818261 DNA polymerase III subunit delta'; Validated 98.47
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.45
PHA00729226 NTP-binding motif containing protein 98.44
PRK08939306 primosomal protein DnaI; Reviewed 98.43
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.42
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.42
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.39
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 98.39
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.38
PRK09183259 transposase/IS protein; Provisional 98.36
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.35
PF05729166 NACHT: NACHT domain 98.35
KOG0477854 consensus DNA replication licensing factor, MCM2 c 98.35
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 98.35
KOG0482721 consensus DNA replication licensing factor, MCM7 c 98.34
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.34
PRK06921266 hypothetical protein; Provisional 98.34
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.3
KOG2228408 consensus Origin recognition complex, subunit 4 [R 98.3
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.28
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 98.28
PRK06851367 hypothetical protein; Provisional 98.25
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.6e-96  Score=793.70  Aligned_cols=634  Identities=61%  Similarity=0.977  Sum_probs=586.6

Q ss_pred             CCCCCCCCCccHHHHHhhhhhhhhcCCCCCccCCHHHHHHHHHHHhcCCCCCeEEECCCCChHHHHHHHHHHHHhcCCCC
Q 005511           14 GGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGLAQRIASGDVP   93 (693)
Q Consensus        14 ~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~iiG~~~~~~~l~~~l~~~~~~~vLl~Gp~GtGKT~la~~la~~l~~~~~~   93 (693)
                      .+..+....+.|++|+.++++.+|.+.+|++|||+++++++.++|.+..++|.+|+|+||+|||.++..+|+++.++.+|
T Consensus       142 ~~~~~~~~~~~L~~y~~dlt~~Ar~gklDPvIGRd~EI~r~iqIL~RR~KNNPvLiGEpGVGKTAIvEGLA~rIv~g~VP  221 (786)
T COG0542         142 DSKNAEEDQDALEKYTRDLTELAREGKLDPVIGRDEEIRRTIQILSRRTKNNPVLVGEPGVGKTAIVEGLAQRIVNGDVP  221 (786)
T ss_pred             CCcccccchhhHHHHhhhhHHHHhcCCCCCCcChHHHHHHHHHHHhccCCCCCeEecCCCCCHHHHHHHHHHHHhcCCCC
Confidence            33444555688999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCceEEEEeccccccCCcccchHHHHHHHHHHHHHhCCCeEEEEeccchhhhCCCCCC-hHhHHHHHhhhhcCCCcE
Q 005511           94 DTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEG-AIDAANILKPSLARGELQ  172 (693)
Q Consensus        94 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~~l~~~~~~~~~~~~~vL~iDEid~l~~~~~~~~-~~~~~~~L~~~l~~~~v~  172 (693)
                      ..+.+.+++.++++.+.+|++|+|+++++++.+++.+.+..+.||||||+|.+.+.+...+ +.++.|+|++.|.+|++.
T Consensus       222 ~~L~~~~i~sLD~g~LvAGakyRGeFEeRlk~vl~ev~~~~~vILFIDEiHtiVGAG~~~G~a~DAaNiLKPaLARGeL~  301 (786)
T COG0542         222 ESLKDKRIYSLDLGSLVAGAKYRGEFEERLKAVLKEVEKSKNVILFIDEIHTIVGAGATEGGAMDAANLLKPALARGELR  301 (786)
T ss_pred             HHHcCCEEEEecHHHHhccccccCcHHHHHHHHHHHHhcCCCeEEEEechhhhcCCCcccccccchhhhhHHHHhcCCeE
Confidence            9999999999999999999999999999999999999988899999999999999887766 588999999999999999


Q ss_pred             EEEEechHHHHhhhhcCHHHhccCCccccCCCCHHHHHHHHHHHHHhHhhhcCcccChHHHHHHHHhhhhhhcccCCchh
Q 005511          173 CIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDK  252 (693)
Q Consensus       173 vI~~t~~~~~~~~~~l~~~l~~Rf~~i~~~~p~~~e~~~il~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~  252 (693)
                      +|++|+..+|.+++.-|++|.|||+.|.+..|+.++...||+.+.++|+.+|++.|+++++.+++.++.+|+.++++|++
T Consensus       302 ~IGATT~~EYRk~iEKD~AL~RRFQ~V~V~EPs~e~ti~ILrGlk~~yE~hH~V~i~D~Al~aAv~LS~RYI~dR~LPDK  381 (786)
T COG0542         302 CIGATTLDEYRKYIEKDAALERRFQKVLVDEPSVEDTIAILRGLKERYEAHHGVRITDEALVAAVTLSDRYIPDRFLPDK  381 (786)
T ss_pred             EEEeccHHHHHHHhhhchHHHhcCceeeCCCCCHHHHHHHHHHHHHHHHHccCceecHHHHHHHHHHHHhhcccCCCCch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHhhHHHHhhcCCcHHHHHHHHHHHHHHHHHHHHhcCcchHHHhhhHHHHHHHHH-HHHHHHhhhhhhhHhhhh
Q 005511          253 AIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLKA-QISALVDKGKEMSKAETE  331 (693)
Q Consensus       253 ~~~ll~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  331 (693)
                      |++++++|+++.++... .|.+++.++..+.++..+.+...+.+| +.+.........++. .+....   ++..     
T Consensus       382 AIDLiDeA~a~~~l~~~-~p~~l~~~~~~~~~l~~e~~~~~~e~~-~~~k~~~~~~~~~~~~~~~~~~---~~~~-----  451 (786)
T COG0542         382 AIDLLDEAGARVRLEID-KPEELDELERELAQLEIEKEALEREQD-EKEKKLIDEIIKLKEGRIPELE---KELE-----  451 (786)
T ss_pred             HHHHHHHHHHHHHhccc-CCcchhHHHHHHHHHHHHHHHHhhhhh-HHHHHHHHHHHHHhhhhhhhHH---HHHh-----
Confidence            99999999999999888 999999999999999999988888887 333333333333332 111111   1110     


Q ss_pred             cCCCCCccCHhHHHHHHHHHhCCCccCCCcchhHHHHHHHHHHhccccChHHHHHHHHHHHHHHhhcCCCCCCCceEEEE
Q 005511          332 AGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIF  411 (693)
Q Consensus       332 ~~~~~~~v~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~v~g~~~~~~~l~~~~~~~~~~~~~~~~~~~~iLl  411 (693)
                          . .|+.++|..+++.|+|+|..++...+.+.+.++++.|.+.|+||+.+++.+.+++++.+.|+..|++|.+++||
T Consensus       452 ----~-~v~~~~Ia~vv~~~TgIPv~~l~~~e~~kll~le~~L~~rViGQd~AV~avs~aIrraRaGL~dp~rPigsFlF  526 (786)
T COG0542         452 ----A-EVDEDDIAEVVARWTGIPVAKLLEDEKEKLLNLERRLKKRVIGQDEAVEAVSDAIRRARAGLGDPNRPIGSFLF  526 (786)
T ss_pred             ----h-ccCHHHHHHHHHHHHCCChhhhchhhHHHHHHHHHHHhcceeChHHHHHHHHHHHHHHhcCCCCCCCCceEEEe
Confidence                1 19999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCCcHHHHHHHHHHHhcCCCcceeeeccccccchhhhhhhcCCCCCCcCcCccchhhHHHHcCCCEEEEEccCcccC
Q 005511          412 SGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAH  491 (693)
Q Consensus       412 ~Gp~GtGKt~lA~~la~~l~~~~~~~~~~~~~~~~~~~~~~~l~g~~~~~~g~~~~~~l~~~~~~~~~~vl~iDEid~l~  491 (693)
                      .||+|+|||.+|++||..+|+...+++++|||+|.+++++++|+|+|+||||+.+++.|+++++..|++||+||||+|++
T Consensus       527 ~GPTGVGKTELAkaLA~~Lfg~e~aliR~DMSEy~EkHsVSrLIGaPPGYVGyeeGG~LTEaVRr~PySViLlDEIEKAH  606 (786)
T COG0542         527 LGPTGVGKTELAKALAEALFGDEQALIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGGQLTEAVRRKPYSVILLDEIEKAH  606 (786)
T ss_pred             eCCCcccHHHHHHHHHHHhcCCCccceeechHHHHHHHHHHHHhCCCCCCceeccccchhHhhhcCCCeEEEechhhhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcceeeCCCCCeeecCCeEEEEecCCChhhhhhcccccccccCcCcccchHHHHHHHHHHHHhhcCchh
Q 005511          492 PDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPE  571 (693)
Q Consensus       492 ~~~~~~Ll~~le~~~~~~~~~~~~~~~~~~iI~~tn~~~~~i~~~~~~~~f~~~~~~~~~~~~~l~~~~~~~l~~~~~~~  571 (693)
                      |+++|.||++|++|++++..|+++++.|++||+|||.|+..+.....   +     .....+..++..+...+++.|+|+
T Consensus       607 pdV~nilLQVlDdGrLTD~~Gr~VdFrNtiIImTSN~Gs~~i~~~~~---~-----~~~~~~~~~~~~v~~~l~~~F~PE  678 (786)
T COG0542         607 PDVFNLLLQVLDDGRLTDGQGRTVDFRNTIIIMTSNAGSEEILRDAD---G-----DDFADKEALKEAVMEELKKHFRPE  678 (786)
T ss_pred             HHHHHHHHHHhcCCeeecCCCCEEecceeEEEEecccchHHHHhhcc---c-----cccchhhhHHHHHHHHHHhhCCHH
Confidence            99999999999999999999999999999999999999987764411   1     112335567778889999999999


Q ss_pred             HhhccCcEEEcCCCCHHHHHHHHHHHHHHHHHHHhcCCCeEEeCHHHHHHHHHhccCCCCCcchHHHHHHHHHHHHHHHH
Q 005511          572 FLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEK  651 (693)
Q Consensus       572 l~~R~~~~v~f~~l~~~~~~~i~~~~l~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~g~r~l~~~i~~~i~~~l~~~  651 (693)
                      |++|+|.+|+|.||+.+++.+|++..|.++..++..+++.+++++++.++|++.+|.+.||+|+|++.|++.+..+|++.
T Consensus       679 FLNRid~II~F~~L~~~~l~~Iv~~~L~~l~~~L~~~~i~l~~s~~a~~~l~~~gyd~~~GARpL~R~Iq~~i~~~La~~  758 (786)
T COG0542         679 FLNRIDEIIPFNPLSKEVLERIVDLQLNRLAKRLAERGITLELSDEAKDFLAEKGYDPEYGARPLRRAIQQEIEDPLADE  758 (786)
T ss_pred             HHhhcccEEeccCCCHHHHHHHHHHHHHHHHHHHHhCCceEEECHHHHHHHHHhccCCCcCchHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999889999999999999999999999999999999999999999999


Q ss_pred             HHhcccCCCCEEEEEEcCC
Q 005511          652 MLAREIKEGDSVIVDVDSD  670 (693)
Q Consensus       652 ~l~~~~~~~~~~~v~~~~~  670 (693)
                      +|.+.+.+|..|.|+++.+
T Consensus       759 iL~g~~~~~~~v~v~~~~~  777 (786)
T COG0542         759 ILFGKIEDGGTVKVDVDDE  777 (786)
T ss_pred             HHhcccCCCcEEEEEecCc
Confidence            9999999999999999983

>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06581 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
1qvr_A854 Crystal Structure Analysis Of Clpb Length = 854 0.0
3pxi_A758 Structure Of Meca108:clpc Length = 758 0.0
3pxg_A468 Structure Of Meca121 And Clpc1-485 Complex Length = 1e-101
4fct_A308 Crystal Structure Of The C-Terminal Domain Of Clpb 8e-99
4fcv_A311 Crystal Structure Of The C-Terminal Domain Of Clpb 8e-95
4hse_A397 Crystal Structure Of Clpb Nbd1 In Complex With Guan 4e-90
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 8e-71
1ksf_X758 Crystal Structure Of Clpa, An Hsp100 Chaperone And 3e-66
1jbk_A195 Crystal Structure Of The First Nucelotide Binding D 2e-64
2p65_A187 Crystal Structure Of The First Nucleotide Binding D 4e-56
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 3e-04
>pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 Back     alignment and structure 
Iteration: 1

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/691 (53%), Positives = 482/691 (69%), Gaps = 66/691 (9%)
Query: 24  TLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGEPGVGKTAIAEGL 83
            LE+YG +LT+LA EGKLDPV+GR  +I RV+QIL RRTKNNP LIGEPGVGKTAI EGL
Sbjct: 152 ALEQYGIDLTRLAAEGKLDPVIGRDEEIRRVIQILLRRTKNNPVLIGEPGVGKTAIVEGL 211
Query: 84  AQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLKKLMEEIKQSD-EIILFIDE 142
           AQRI  GDVP+ ++GK++++L MG L+AG KYRGEFEERLK +++E+ QS  E+ILFIDE
Sbjct: 212 AQRIVKGDVPEGLKGKRIVSLQMGSLLAGAKYRGEFEERLKAVIQEVVQSQGEVILFIDE 271
Query: 143 VHTLXXXXXXXXXXXXXXXLKPSLARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVP 202
           +HT+               LKP+LARGEL+ IGATTLDEYR+ IEKDPALERRFQPV V 
Sbjct: 272 LHTVVGAGKAEGAVDAGNMLKPALARGELRLIGATTLDEYRE-IEKDPALERRFQPVYVD 330
Query: 203 EPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYISDRFLPDKAIDLIDEAGS 262
           EP+V+ETI IL+GL+E+YE+HH +R +D A+++AA LS++YI++R LPDKAIDLIDEA +
Sbjct: 331 EPTVEETISILRGLKEKYEVHHGVRISDSAIIAAATLSHRYITERRLPDKAIDLIDEAAA 390
Query: 263 RVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGELRDREMDLK------AQIS 316
           R+R+     PEE   LE++  Q+  E+    + +D +    L+  E ++       A++ 
Sbjct: 391 RLRMALESAPEEIDALERKKLQLEIEREALKKEKDPDSQERLKAIEAEIAKLTEEIAKLR 450
Query: 317 ALVDKGKEMSK----------------------------AETEAGDVGPVVTEV------ 342
           A  ++ +E+ +                            AE   G++  +  EV      
Sbjct: 451 AEWEREREILRKLREAQHRLDEVRREIELAERQYDLNRAAELRYGELPKLEAEVEALSEK 510
Query: 343 --------------DIQHIVSAWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAI 388
                         DI  IVS WTGIPV K+   E ++LL++EE LHKRV+GQDEA++A+
Sbjct: 511 LRGARFVRLEVTEEDIAEIVSRWTGIPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAV 570
Query: 389 SRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMER 448
           + AIRRAR GLK+PNRPI SF+F GPTGVGK+ELAK LAA  F +EEAMIR+DM+E+ME+
Sbjct: 571 ADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEK 630
Query: 449 HTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLT 508
           H VS+LIG+PPGYVGY EGGQLTEAVRRRPY+V+LFDEIEKAHPDVFN++LQIL+DGRLT
Sbjct: 631 HAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLT 690
Query: 509 DSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYF 568
           DS GRTVDF+NT++I+TSN+GS +I +G           +K   Y RI+  V + L+Q+F
Sbjct: 691 DSHGRTVDFRNTVIILTSNLGSPLILEG----------LQKGWPYERIRDEVFKVLQQHF 740
Query: 569 RPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDRLKTKDIELQXXXXXXXXXXXXGYN 628
           RPEFLNRLDE++VFR LTK ++++I +I L  +  RL  K I L+            GY+
Sbjct: 741 RPEFLNRLDEIVVFRPLTKEQIRQIVEIQLSYLRARLAEKRISLELTEAAKDFLAERGYD 800
Query: 629 PSYGARPLRRAIMRLLEDSMAEKMLAREIKE 659
           P +GARPLRR I R LE  +A+K+LA E+KE
Sbjct: 801 PVFGARPLRRVIQRELETPLAQKILAGEVKE 831
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|3PXG|A Chain A, Structure Of Meca121 And Clpc1-485 Complex Length = 468 Back     alignment and structure
>pdb|4FCT|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 308 Back     alignment and structure
>pdb|4FCV|A Chain A, Crystal Structure Of The C-Terminal Domain Of Clpb Length = 311 Back     alignment and structure
>pdb|4HSE|A Chain A, Crystal Structure Of Clpb Nbd1 In Complex With Guanidinium Chloride And Adp Length = 397 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 Back     alignment and structure
>pdb|1JBK|A Chain A, Crystal Structure Of The First Nucelotide Binding Domain Of Clpb Length = 195 Back     alignment and structure
>pdb|2P65|A Chain A, Crystal Structure Of The First Nucleotide Binding Domain Of Chaperone Clpb1, Putative, (Pv089580) From Plasmodium Vivax Length = 187 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 0.0
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 0.0
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 0.0
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 0.0
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 0.0
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 1e-112
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 1e-105
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 3e-80
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-08
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 1e-07
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 2e-06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 1e-05
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 2e-05
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 5e-05
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 7e-05
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 8e-05
2chg_A226 Replication factor C small subunit; DNA-binding pr 3e-04
2chq_A319 Replication factor C small subunit; DNA-binding pr 4e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 4e-04
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 6e-04
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 6e-04
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 7e-04
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 7e-04
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 8e-04
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Length = 758 Back     alignment and structure
 Score = 1095 bits (2834), Expect = 0.0
 Identities = 367/669 (54%), Positives = 473/669 (70%), Gaps = 61/669 (9%)

Query: 5   STEAVGAGVGGGSSGNKMPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKN 64
            +   G+   G +S    PTL+    +LT +A+E  LDPV+GR  +I+RV+++L RRTKN
Sbjct: 143 GSNETGSSAAGTNSNANTPTLDSLARDLTAIAKEDSLDPVIGRSKEIQRVIEVLSRRTKN 202

Query: 65  NPCLIGEPGVGKTAIAEGLAQRIASGDVPDTIEGKKVITLDMGLLVAGTKYRGEFEERLK 124
           NP LIGEPGVGKTAIAEGLAQ+I + +VP+ +  K+V+TLDMG     TKYRGEFE+RLK
Sbjct: 203 NPVLIGEPGVGKTAIAEGLAQQIINNEVPEILRDKRVMTLDMG-----TKYRGEFEDRLK 257

Query: 125 KLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPSLARGELQCIGATTLDEYRK 184
           K+M+EI+Q+  IILFID             AIDA+NILKPSLARGELQCIGATTLDEYRK
Sbjct: 258 KVMDEIRQAGNIILFID------------AAIDASNILKPSLARGELQCIGATTLDEYRK 305

Query: 185 HIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRYTDEALVSAAQLSYQYI 244
           +IEKD ALERRFQP++V +PSVDE+IQIL+GLR+RYE HH++  TD+A+ +A +LS +YI
Sbjct: 306 YIEKDAALERRFQPIQVDQPSVDESIQILQGLRDRYEAHHRVSITDDAIEAAVKLSDRYI 365

Query: 245 SDRFLPDKAIDLIDEAGSRVRLRHAQLPEEARELEKELRQITKEKNEAVRGQDFEKAGEL 304
           SDRFLPDKAIDLIDEAGS+VRLR    P   +ELE++L ++ KEK+ AV+ Q+FEKA  L
Sbjct: 366 SDRFLPDKAIDLIDEAGSKVRLRSFTTPPNLKELEQKLDEVRKEKDAAVQSQEFEKAASL 425

Query: 305 RDREMDLKAQISALVDKGKEMSKAETEAGDVGPVVTEVDIQHIVSAWTGIPVEKVSTDES 364
           RD E  L+ Q+       KE    E         VT  DI  +VS+WTG+PV K++  E+
Sbjct: 426 RDTEQRLREQVEDTKKSWKEKQGQEN------SEVTVDDIAMVVSSWTGVPVSKIAQTET 479

Query: 365 DRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAK 424
           D+LL ME  LH RVIGQDEAV A+++A+RRAR GLK+P RPI SFIF GPTGVGK+ELA+
Sbjct: 480 DKLLNMENILHSRVIGQDEAVVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELAR 539

Query: 425 ALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLF 484
           ALA   FG EE+MIR+DMSE+ME+H+ S              GGQLTE VRR+PY+VVL 
Sbjct: 540 ALAESIFGDEESMIRIDMSEYMEKHSTS--------------GGQLTEKVRRKPYSVVLL 585

Query: 485 DEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDL 544
           D IEKAHPDVFN++LQ+LEDGRLTDSKGRTVDF+NT+LIMTSNVG+              
Sbjct: 586 DAIEKAHPDVFNILLQVLEDGRLTDSKGRTVDFRNTILIMTSNVGA-------------- 631

Query: 545 DYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEIADIMLKEVFDR 604
                       K  V  ELK+ FRPEF+NR+DE+IVF  L K  + EI  +M  ++  R
Sbjct: 632 ----------SEKDKVMGELKRAFRPEFINRIDEIIVFHSLEKKHLTEIVSLMSDQLTKR 681

Query: 605 LKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVI 664
           LK +D+ +++T+  + +V EEG +  YGARPLRRAI + +ED ++E++L   I +G  ++
Sbjct: 682 LKEQDLSIELTDAAKAKVAEEGVDLEYGARPLRRAIQKHVEDRLSEELLRGNIHKGQHIV 741

Query: 665 VDVDSDGNV 673
           +DV+    V
Sbjct: 742 LDVEDGEFV 750
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Length = 468 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Length = 311 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Length = 195 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Length = 187 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 353 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Length = 664 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Length = 661 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Length = 250 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d1qvra3315 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus 1e-114
d1qvra2387 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus 1e-113
d1r6bx2268 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, A 1e-101
d1r6bx3315 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A 1e-95
d1jbka_195 c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia col 5e-84
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 1e-49
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-41
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 4e-41
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 2e-29
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 5e-06
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-20
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 1e-07
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 6e-19
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 9e-15
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 0.004
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 4e-13
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 2e-05
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-12
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 4e-10
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 2e-06
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 1e-09
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 8e-04
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 7e-09
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 7e-06
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 1e-07
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 1e-06
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 2e-06
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 1e-05
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 1e-04
d1e52a_56 a.2.9.1 (A:) C-terminal UvrC-binding domain of Uvr 2e-04
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-04
d1sxjc2227 c.37.1.20 (C:12-238) Replication factor C3 {Baker' 3e-04
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-04
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 0.001
d1sxjb2224 c.37.1.20 (B:7-230) Replication factor C4 {Baker's 0.002
d1iqpa2231 c.37.1.20 (A:2-232) Replication factor C {Archaeon 0.002
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 0.004
d1x6va3195 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin 0.004
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.004
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

 Score =  343 bits (881), Expect = e-114
 Identities = 196/320 (61%), Positives = 252/320 (78%), Gaps = 10/320 (3%)

Query: 354 IPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSG 413
           IPV K+   E ++LL++EE LHKRV+GQDEA++A++ AIRRAR GLK+PNRPI SF+F G
Sbjct: 1   IPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLG 60

Query: 414 PTGVGKSELAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEA 473
           PTGVGK+ELAK LAA  F +EEAMIR+DM+E+ME+H VS+LIG+PPGYVGY EGGQLTEA
Sbjct: 61  PTGVGKTELAKTLAATLFDTEEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEA 120

Query: 474 VRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVI 533
           VRRRPY+V+LFDEIEKAHPDVFN++LQIL+DGRLTDS GRTVDF+NT++I+TSN+GS +I
Sbjct: 121 VRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGRTVDFRNTVIILTSNLGSPLI 180

Query: 534 EKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEI 593
            +G +          K   Y RI+  V + L+Q+FRPEFLNRLDE++VFR LTK ++++I
Sbjct: 181 LEGLQ----------KGWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQI 230

Query: 594 ADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKML 653
            +I L  +  RL  K I L++TE  ++ + E GY+P +GARPLRR I R LE  +A+K+L
Sbjct: 231 VEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKIL 290

Query: 654 AREIKEGDSVIVDVDSDGNV 673
           A E+KEGD V VDV   G V
Sbjct: 291 AGEVKEGDRVQVDVGPAGLV 310
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 268 Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1e52a_ a.2.9.1 (A:) C-terminal UvrC-binding domain of UvrB {Escherichia coli [TaxId: 562]} Length = 56 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 227 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 224 Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 231 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 100.0
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 100.0
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 100.0
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.96
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.96
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.95
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.94
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.94
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.93
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.91
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.9
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.9
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.89
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.89
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.89
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.88
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.87
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.85
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.85
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.84
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.84
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.83
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.83
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.82
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.81
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.8
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.77
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.77
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.77
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.77
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.75
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.75
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.74
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.73
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.72
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.71
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.71
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.71
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.7
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.69
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.67
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.67
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.66
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.65
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.61
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.6
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.58
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.57
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.56
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.54
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.54
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.46
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.41
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.36
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.34
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.34
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.31
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.15
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.13
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.08
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.51
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.51
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.48
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.26
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.15
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.94
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.89
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.68
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.55
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.46
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.43
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.42
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.39
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.34
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.24
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.22
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.21
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.21
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.2
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.2
d2qy9a2211 GTPase domain of the signal recognition particle r 97.18
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.17
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.16
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.16
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.15
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.09
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.09
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.07
d1vmaa2213 GTPase domain of the signal recognition particle r 97.03
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.02
d1okkd2207 GTPase domain of the signal recognition particle r 97.01
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.0
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.0
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.99
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.99
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.98
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.97
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.97
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.96
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.96
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.95
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.94
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.94
d1okkd2207 GTPase domain of the signal recognition particle r 96.93
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.92
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.92
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.92
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.91
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.91
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.9
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.89
d2qy9a2211 GTPase domain of the signal recognition particle r 96.87
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.82
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.81
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.81
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.81
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.8
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.77
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.72
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.72
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.71
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.7
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.7
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.69
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.69
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.68
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.68
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.67
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.66
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.63
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.63
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.61
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.6
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.59
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.58
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.57
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.56
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.56
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.54
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.53
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.52
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.52
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.51
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.51
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.5
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.5
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.46
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.45
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.42
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.41
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.37
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.35
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.35
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.34
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.34
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.3
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.26
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.26
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.26
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.25
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.25
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.23
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.22
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.22
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.21
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.2
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.18
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.17
d1vmaa2213 GTPase domain of the signal recognition particle r 96.15
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.15
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.15
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.15
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.14
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.13
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.12
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 96.11
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.1
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 96.09
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.05
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.03
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.97
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.96
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.96
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.95
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.93
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.93
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.92
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.88
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.83
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.83
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 95.83
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 95.82
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.79
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.78
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.75
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.73
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 95.71
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.71
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 95.61
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.54
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 95.54
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.48
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 95.47
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.47
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.46
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.41
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 95.4
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 95.38
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 95.38
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.29
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.24
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.23
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.22
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 95.12
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.02
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.01
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.94
d2hyda1255 Putative multidrug export ATP-binding/permease pro 94.9
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.88
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.87
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.85
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.83
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.82
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.75
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.72
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.72
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.62
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.61
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.42
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.35
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.34
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.33
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.32
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.25
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 94.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.23
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.14
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 94.13
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.06
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 94.05
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.01
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 94.0
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.98
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.89
d2mysa2794 Myosin S1, motor domain {Chicken (Gallus gallus), 93.85
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.79
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.74
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 93.72
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 93.7
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.69
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.67
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.65
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.64
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 93.61
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.59
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.57
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 93.5
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.42
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.35
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 93.34
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.24
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.23
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.19
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.15
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 93.12
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.11
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1qzma_94 ATPase domain of protease Lon (La) {Escherichia co 93.03
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.03
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.03
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.92
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 92.9
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.83
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.81
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.79
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.75
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.74
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.69
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 92.67
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 92.61
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.6
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.53
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 92.49
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.49
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 92.43
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 92.41
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.37
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.31
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 92.3
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.3
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.18
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.17
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.1
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.97
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 91.97
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.94
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.92
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.91
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.8
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.79
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.74
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.73
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.71
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 91.66
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.58
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 91.57
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.56
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.55
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.53
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.51
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.39
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.39
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.32
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.27
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.26
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.22
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.18
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.97
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.94
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.91
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 90.86
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.83
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.83
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.82
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.75
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.74
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.54
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 90.49
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 90.49
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.34
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.34
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 90.29
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.28
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.25
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.25
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 90.15
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 90.06
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.02
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.01
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.99
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.99
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.96
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.95
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.94
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.91
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.9
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.88
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 89.85
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 89.85
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 89.78
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.74
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 89.72
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.71
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.67
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.62
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.61
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 89.55
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.48
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 89.43
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.4
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 89.39
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.37
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.34
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.32
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 89.32
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.29
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 89.25
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.22
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.08
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 89.05
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.92
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.87
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 88.86
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 88.86
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 88.8
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 88.7
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 88.64
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 88.59
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 88.29
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 88.29
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.16
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.1
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 88.08
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 88.02
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.99
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 87.98
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.83
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.8
d1nrjb_209 Signal recognition particle receptor beta-subunit 87.8
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 87.78
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.76
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.72
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 87.62
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.5
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.45
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.44
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 87.43
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.28
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.22
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.21
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 87.2
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.1
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 87.01
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.95
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 86.94
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 86.85
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 86.84
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 86.77
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 86.75
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 86.64
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 86.62
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.57
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.56
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 86.45
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 86.4
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.33
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 86.18
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 86.07
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 86.05
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 86.02
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 85.86
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 85.77
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 85.7
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 85.59
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 85.59
d1xpua3289 Transcription termination factor Rho, ATPase domai 85.59
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.53
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 85.49
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 85.44
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 85.43
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 85.25
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 85.21
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.0
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 84.75
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.68
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 84.41
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 84.29
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.28
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 84.25
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 84.25
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.14
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 84.08
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 84.03
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 84.0
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.88
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 83.84
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.84
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 83.83
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 83.82
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 83.67
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 83.56
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 83.52
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 83.5
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 83.48
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 83.47
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 83.37
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 83.27
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.26
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 83.25
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 83.24
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 83.13
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 83.08
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.06
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 83.01
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 82.88
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.84
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 82.52
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 82.25
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 82.0
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 81.94
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 81.91
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 81.75
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 81.72
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 81.54
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 81.47
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.17
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 80.26
d1kk8a2789 Myosin S1, motor domain {Bay scallop (Aequipecten 80.2
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 80.19
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 80.13
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ClpB, AAA+ modules
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=0  Score=353.30  Aligned_cols=309  Identities=63%  Similarity=1.024  Sum_probs=284.2

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCC
Q ss_conf             99667782035789999999852526938999999999999750278999984389995158892799999999996399
Q 005511          354 IPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGVGKSELAKALAAYYFGS  433 (693)
Q Consensus       354 ~~~~~~~~~~~~~~~~~~~~l~~~i~Gq~~~i~~l~~~i~~~~~~~~~~~~~~~~ill~Gp~GtGKt~lA~~la~~l~~~  433 (693)
                      +|+.++...+.+.+..+++.|.+.++||+++++.+..++..+..++..|.+|.+++||+||||+|||.+|+.||+.+++.
T Consensus         1 ~p~~~~~~~~~~~l~~l~~~L~~~v~GQ~~ai~~v~~~i~~~~~~l~~~~kp~~~~lf~Gp~G~GKt~lak~la~~l~~~   80 (315)
T d1qvra3           1 IPVSKLLEGEREKLLRLEEELHKRVVGQDEAIRAVADAIRRARAGLKDPNRPIGSFLFLGPTGVGKTELAKTLAATLFDT   80 (315)
T ss_dssp             CHHHHTTCCHHHHHHSHHHHHHHHSCSCHHHHHHHHHHHHHHGGGCSCSSSCSEEEEEBSCSSSSHHHHHHHHHHHHHSS
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCEEECHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCC
T ss_conf             99623558799999999999568270879999999999999865789988876699997888624899999999983588


Q ss_pred             CCCEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHCCEEECCCCC
Q ss_conf             75405533543221000110028999876767512266999809998999846742298899999997405646379998
Q 005511          434 EEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLTEAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGR  513 (693)
Q Consensus       434 ~~~~~~~~~~~~~~~~~~~~l~g~~~~~~g~~~~~~l~~~~~~~~~~vl~iDEid~l~~~~~~~Ll~~le~g~~~~~~~~  513 (693)
                      +.+++.++|++|.+.++.+.++|+++||+|+.+++.+.+.+++++++|++|||+||+++.+++.|++++++|.+++..|+
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~L~g~~~gyvG~~~~~~l~~~~~~~p~~Vvl~DEieK~~~~v~~~ll~~l~~g~~~~~~gr  160 (315)
T d1qvra3          81 EEAMIRIDMTEYMEKHAVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHPDVFNILLQILDDGRLTDSHGR  160 (315)
T ss_dssp             GGGEEEECTTTCCSSGGGGGC--------------CHHHHHHHCSSEEEEESSGGGSCHHHHHHHHHHHTTTEECCSSSC
T ss_pred             CCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEHHHHCCHHHHHHHHHHHCCCCEECCCCC
T ss_conf             75348873155454215665148999876746678489999849983799714754078999899998613834279996


Q ss_pred             EEECCCEEEEEECCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCCEEECCCCCHHHHHHH
Q ss_conf             33169769999538882566406654455567674311189999889999860176368603594787478999999999
Q 005511          514 TVDFKNTLLIMTSNVGSSVIEKGGRRIGFDLDYDEKDSSYNRIKSLVTEELKQYFRPEFLNRLDEMIVFRQLTKLEVKEI  593 (693)
Q Consensus       514 ~~~~~~~i~I~tsn~~~~~i~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~r~~~~i~f~~l~~~~~~~i  593 (693)
                      .+++++++||+|||.+...+......          ............+.+.+.|+|+|++|+|.+++|.|++.+++.+|
T Consensus       161 ~v~~~~~i~i~tsnlG~~~i~~~~~~----------~~~~~~~~~~~~~~l~~~f~pEflnRid~Ii~F~~L~~~~~~~I  230 (315)
T d1qvra3         161 TVDFRNTVIILTSNLGSPLILEGLQK----------GWPYERIRDEVFKVLQQHFRPEFLNRLDEIVVFRPLTKEQIRQI  230 (315)
T ss_dssp             CEECTTEEEEEECCTTHHHHHHHHHT----------TCCHHHHHHHHHHHHHTTSCHHHHHTCSBCCBCCCCCHHHHHHH
T ss_pred             EECCCCEEEEEECCCCHHHHHHHCCC----------CCCHHHHHHHHHHHHHHHCCHHHHHCCCEEEECCCHHHHHHHHH
T ss_conf             85375428987424576777640011----------22045556778888886238878721780543210245436899


Q ss_pred             HHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCC
Q ss_conf             9999999999983099859839889999998044988996037999999989999999870202799989999739984
Q 005511          594 ADIMLKEVFDRLKTKDIELQVTERFRERVVEEGYNPSYGARPLRRAIMRLLEDSMAEKMLAREIKEGDSVIVDVDSDGN  672 (693)
Q Consensus       594 ~~~~l~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~g~r~l~~~i~~~i~~~l~~~~~~~~~~~~~~~~i~~~~~~~  672 (693)
                      +...+..+..++...++.+.++++++++|++.+|++.+|||+|++.|++.+..++++.++.+.+.+|++|.|++++++.
T Consensus       231 ~~~~l~~l~~rl~~~~i~l~i~~~~~~~L~~~~y~~~~GAR~L~r~Ie~~i~~~La~~iL~~~~~~g~~i~i~~~~~~l  309 (315)
T d1qvra3         231 VEIQLSYLRARLAEKRISLELTEAAKDFLAERGYDPVFGARPLRRVIQRELETPLAQKILAGEVKEGDRVQVDVGPAGL  309 (315)
T ss_dssp             HHHHHHHHHHHHHTTTCEEEECHHHHHHHHHHHCBTTTBTSTHHHHHHHHTHHHHHHHHHHTSSCSSCEEEEECCTTSC
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCEE
T ss_conf             9999999999987242022066999999999488987782108999999989999999983768998999999979988
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure