Citrus Sinensis ID: 006006
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 665 | 2.2.26 [Sep-21-2011] | |||||||
| Q9ZWJ9 | 664 | Two-component response re | yes | no | 0.481 | 0.481 | 0.575 | 1e-100 | |
| Q940D0 | 690 | Two-component response re | no | no | 0.460 | 0.443 | 0.584 | 1e-100 | |
| Q8L9Y3 | 382 | Two-component response re | no | no | 0.434 | 0.756 | 0.570 | 2e-87 | |
| P62598 | 596 | Two-component response re | no | no | 0.374 | 0.417 | 0.566 | 6e-74 | |
| Q9FXD6 | 521 | Two-component response re | no | no | 0.4 | 0.510 | 0.522 | 5e-71 | |
| O49397 | 552 | Two-component response re | no | no | 0.345 | 0.416 | 0.537 | 4e-69 | |
| Q9FGT7 | 635 | Two-component response re | no | no | 0.416 | 0.436 | 0.478 | 4e-61 | |
| Q7Y0W3 | 341 | Two-component response re | N/A | no | 0.389 | 0.759 | 0.363 | 2e-41 | |
| Q7Y0W5 | 341 | Two-component response re | no | no | 0.389 | 0.759 | 0.363 | 2e-41 | |
| Q9FJ16 | 292 | Putative two-component re | no | no | 0.339 | 0.773 | 0.406 | 2e-38 |
| >sp|Q9ZWJ9|ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana GN=ARR2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 366 bits (940), Expect = e-100, Method: Compositional matrix adjust.
Identities = 198/344 (57%), Positives = 243/344 (70%), Gaps = 24/344 (6%)
Query: 7 IVQSSGGSGYGSSRAADVAVPDQFPAGLRVLVVDDDITCLRILEQMLRRCLYNVTTCSQA 66
+V G G S AA + D FPA LRVLVVDDD TCL ILE+ML CLY VT C++A
Sbjct: 1 MVNPGHGRGPDSGTAAGGSNSDPFPANLRVLVVDDDPTCLMILERMLMTCLYRVTKCNRA 60
Query: 67 AVALDILRERKGCFDVVLSDVHMPDMDGFKLLEHIGLEMDLPVI---TDGRVSAVMRGIR 123
AL +LR+ K FD+V+SDVHMPDMDGFKLLEH+GLEMDLPVI D S V++G+
Sbjct: 61 ESALSLLRKNKNGFDIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVT 120
Query: 124 HGACDYLIKPIREEELKNIWQHVVRKRWNE-NKEHENSGSLEET-------DHHKRGSDE 175
HGA DYLIKP+R E LKNIWQHVVRK+ NE N + GS+E+T H+ +D
Sbjct: 121 HGAVDYLIKPVRIEALKNIWQHVVRKKRNEWNVSEHSGGSIEDTGGDRDRQQQHREDAD- 179
Query: 176 IEYASSVNEGTEGTFKAQRKRISAKEEDDGELESDDPSTTKKPRVVWSVELHQQFVSAVN 235
+SSVNEG ++ RKR + +D G+ + +D S+ KKPRVVWSVELHQQFV+AVN
Sbjct: 180 -NNSSSVNEGNG---RSSRKRKEEEVDDQGD-DKEDSSSLKKPRVVWSVELHQQFVAAVN 234
Query: 236 QLGIDKAVPKRILELMNVPGLTRENVASHLQEINLQKFRLYLKRLNGVSQ-QGGITNSFC 294
QLG+DKAVPK+ILE+MNVPGLTRENVASH LQK+R+YL+RL GVSQ QG + +SF
Sbjct: 235 QLGVDKAVPKKILEMMNVPGLTRENVASH-----LQKYRIYLRRLGGVSQHQGNMNHSFM 289
Query: 295 APIETNV-KLGSLGRFDIQALAASGQIPPQTLAALHAELLGRPT 337
+ + L SL FD+Q+LA +GQ+PPQ+LA L A LGRPT
Sbjct: 290 TGQDQSFGPLSSLNGFDLQSLAVTGQLPPQSLAQLQAAGLGRPT 333
|
Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q940D0|ARR1_ARATH Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8L9Y3|ARR14_ARATH Two-component response regulator ARR14 OS=Arabidopsis thaliana GN=ARR14 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P62598|ARR12_ARATH Two-component response regulator ARR12 OS=Arabidopsis thaliana GN=ARR12 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9FXD6|ARR11_ARATH Two-component response regulator ARR11 OS=Arabidopsis thaliana GN=ARR11 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O49397|ARR10_ARATH Two-component response regulator ARR10 OS=Arabidopsis thaliana GN=ARR10 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FGT7|ARR18_ARATH Two-component response regulator ARR18 OS=Arabidopsis thaliana GN=ARR18 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q7Y0W3|EHD1_ORYSI Two-component response regulator EHD1 OS=Oryza sativa subsp. indica PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7Y0W5|EHD1_ORYSJ Two-component response regulator EHD1 OS=Oryza sativa subsp. japonica GN=EHD1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FJ16|APRR4_ARATH Putative two-component response regulator-like APRR4 OS=Arabidopsis thaliana GN=APRR4 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 665 | ||||||
| 255584969 | 669 | two-component sensor histidine kinase ba | 0.986 | 0.980 | 0.710 | 0.0 | |
| 359472591 | 643 | PREDICTED: two-component response regula | 0.957 | 0.990 | 0.741 | 0.0 | |
| 224111430 | 663 | type-b response regulator [Populus trich | 0.983 | 0.986 | 0.709 | 0.0 | |
| 298103720 | 663 | putative B-type response regulator 16 [P | 0.983 | 0.986 | 0.700 | 0.0 | |
| 298103718 | 671 | putative B-type response regulator 15 [P | 0.981 | 0.973 | 0.679 | 0.0 | |
| 343407540 | 654 | RRB1 type-b response regulator [Nicotian | 0.944 | 0.960 | 0.597 | 0.0 | |
| 356502390 | 633 | PREDICTED: uncharacterized protein LOC10 | 0.938 | 0.985 | 0.587 | 0.0 | |
| 297737623 | 428 | unnamed protein product [Vitis vinifera] | 0.634 | 0.985 | 0.769 | 0.0 | |
| 356519365 | 633 | PREDICTED: uncharacterized protein LOC10 | 0.920 | 0.966 | 0.575 | 0.0 | |
| 224099559 | 303 | type-b response regulator [Populus trich | 0.451 | 0.990 | 0.809 | 1e-144 |
| >gi|255584969|ref|XP_002533196.1| two-component sensor histidine kinase bacteria, putative [Ricinus communis] gi|223526994|gb|EEF29188.1| two-component sensor histidine kinase bacteria, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 962 bits (2486), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 482/678 (71%), Positives = 569/678 (83%), Gaps = 22/678 (3%)
Query: 1 MAALQRIVQS--SGGSGYGSSRA-------ADVAVPDQFPAGLRVLVVDDDITCLRILEQ 51
MAALQR+ S + S Y S + ADVAV DQFPAGLRVLVVDDD TCLRILEQ
Sbjct: 1 MAALQRVASSVSATASNYSSCKGNGVVTATADVAVSDQFPAGLRVLVVDDDTTCLRILEQ 60
Query: 52 MLRRCLYNVTTCSQAAVALDILRERKGCFDVVLSDVHMPDMDGFKLLEHIGLEMDLPVI- 110
MLRRCLY+VTTCSQA VAL++LRERKGCFDVVLSDVHMPDMDGFKLLEH+GLEMDLPVI
Sbjct: 61 MLRRCLYHVTTCSQAKVALNLLRERKGCFDVVLSDVHMPDMDGFKLLEHVGLEMDLPVIM 120
Query: 111 --TDGRVSAVMRGIRHGACDYLIKPIREEELKNIWQHVVRKRWNENKEHENSGSLEETDH 168
DGR SAVMRGIRHGACDYLIKPIREEELKNIWQHVVRK+W+ENKE E+SGSLE+ D
Sbjct: 121 MSADGRTSAVMRGIRHGACDYLIKPIREEELKNIWQHVVRKKWHENKEIEHSGSLEDNDR 180
Query: 169 HKRGSDEIEYASSVNEGTEGTFKAQRKRISAKEEDDGELESDDPSTTKKPRVVWSVELHQ 228
HKRG+++ EY SSVNEGTEG K Q++R ++K+EDDGE +SDDPST+KKPRVVWSVELHQ
Sbjct: 181 HKRGNEDAEYTSSVNEGTEGVLKGQKRRSNSKDEDDGEPDSDDPSTSKKPRVVWSVELHQ 240
Query: 229 QFVSAVNQLGIDKAVPKRILELMNVPGLTRENVASHLQEINLQKFRLYLKRLNGVSQQGG 288
QFVSAVNQLGIDKAVPKRILELMNVPGLTRENVASH LQKFRLYLKRL+GV+QQGG
Sbjct: 241 QFVSAVNQLGIDKAVPKRILELMNVPGLTRENVASH-----LQKFRLYLKRLSGVAQQGG 295
Query: 289 ITNSFCAPIETNVKLGSLGRFDIQALAASGQIPPQTLAALHAELLGRPTGNLVTAVDQPA 348
I+++FC P+++NVKL SLGRFDIQALAASGQIPPQTLAALHAEL GRPTG+LVT +DQP
Sbjct: 296 ISSTFCGPMDSNVKLNSLGRFDIQALAASGQIPPQTLAALHAELFGRPTGSLVTTMDQPT 355
Query: 349 LLQATLQGPKCIPADHGVAFGQQLVKCQSNVPENLPQSIISVDDASTGFGVWASNSLGAV 408
LLQA+ Q PKCIP +HGV FGQ +VKC S + ++ PQ+++SV++ S+G+G W SNSLG V
Sbjct: 356 LLQASRQSPKCIPVEHGVTFGQPIVKCSSGISKHFPQNMVSVEEVSSGYGAWPSNSLGTV 415
Query: 409 ASTSNLGGLNPQNGNMLMDILHQQQQKQQNQQSQQQSTLSETSRSISVQPSCLVVPSRSS 468
++NLGG+ QNGNMLMDI HQQQ++ QQ QQQ +L++ SRSI+VQPSCLVVPS+SS
Sbjct: 416 GPSTNLGGMTTQNGNMLMDIFHQQQKQ---QQPQQQQSLADPSRSINVQPSCLVVPSQSS 472
Query: 469 ASFQAGNSPASVNQSCSFNRGAVVDYSLLSSQSNNSSLNMGQISDGDIKTTAVITGYLAP 528
A FQAGNSPASVNQS +FNR V+DYSLLSSQSNNS+LN+G I +GD+KTT + GY AP
Sbjct: 473 ACFQAGNSPASVNQS-NFNRNVVIDYSLLSSQSNNSALNIGHIPEGDLKTTGAVNGYSAP 531
Query: 529 GSLSPSASSCSVTADNTSSQQVQNSNIAFRAARQVPGLVSNVGDIQGSYGAKSGEVFDLG 588
GSLSP ASSCSV AD+ +QVQN +AF A RQ+P L N+ +IQGSYG +S ++ D G
Sbjct: 532 GSLSPPASSCSVNADSGVPRQVQNPTLAFGAVRQLPALSPNIFNIQGSYGVRSDDILDQG 591
Query: 589 S-LRNHGFMGKGNCIPSRLAVDEFESPMNNLNYGNIYLDNNANKVKEEPNLEFVENAKVG 647
+N GF+GKG CIPSR AVDEFE+P +NL++G +Y++NN NKVK+EPN++F + ++VG
Sbjct: 592 PFFKNLGFVGKGTCIPSRFAVDEFETPSSNLSHGKLYVENNDNKVKQEPNIDFTDTSRVG 651
Query: 648 IPMYQQYAPNDLMSVFTD 665
IP+ QQY PNDLMSVFT+
Sbjct: 652 IPVLQQYPPNDLMSVFTE 669
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359472591|ref|XP_002281291.2| PREDICTED: two-component response regulator ARR2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224111430|ref|XP_002315852.1| type-b response regulator [Populus trichocarpa] gi|222864892|gb|EEF02023.1| type-b response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|298103720|emb|CBM42561.1| putative B-type response regulator 16 [Populus x canadensis] | Back alignment and taxonomy information |
|---|
| >gi|298103718|emb|CBM42560.1| putative B-type response regulator 15 [Populus x canadensis] | Back alignment and taxonomy information |
|---|
| >gi|343407540|gb|AEM23771.1| RRB1 type-b response regulator [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|356502390|ref|XP_003520002.1| PREDICTED: uncharacterized protein LOC100817125 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297737623|emb|CBI26824.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356519365|ref|XP_003528343.1| PREDICTED: uncharacterized protein LOC100804937 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224099559|ref|XP_002311532.1| type-b response regulator [Populus trichocarpa] gi|222851352|gb|EEE88899.1| type-b response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 665 | ||||||
| TAIR|locus:2130095 | 664 | RR2 "response regulator 2" [Ar | 0.502 | 0.503 | 0.563 | 3.7e-97 | |
| TAIR|locus:2065398 | 382 | RR14 "response regulator 14" [ | 0.436 | 0.759 | 0.578 | 2.2e-82 | |
| TAIR|locus:2040194 | 596 | RR12 "response regulator 12" [ | 0.378 | 0.422 | 0.572 | 9.9e-71 | |
| TAIR|locus:2008585 | 521 | ARR11 "response regulator 11" | 0.403 | 0.514 | 0.536 | 4.2e-69 | |
| TAIR|locus:2093668 | 690 | RR1 "response regulator 1" [Ar | 0.329 | 0.317 | 0.545 | 2.2e-57 | |
| TAIR|locus:2116587 | 552 | RR10 "response regulator 10" [ | 0.260 | 0.313 | 0.539 | 1.9e-44 | |
| UNIPROTKB|Q7Y0W3 | 341 | Q7Y0W3 "Two-component response | 0.389 | 0.759 | 0.363 | 3.6e-41 | |
| UNIPROTKB|Q7Y0W5 | 341 | EHD1 "Two-component response r | 0.389 | 0.759 | 0.363 | 3.6e-41 | |
| TAIR|locus:2155954 | 292 | APRR4 "pseudo-response regulat | 0.341 | 0.777 | 0.4 | 7.7e-38 | |
| TAIR|locus:2141020 | 535 | APRR2 [Arabidopsis thaliana (t | 0.163 | 0.203 | 0.389 | 1.5e-22 |
| TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 913 (326.5 bits), Expect = 3.7e-97, Sum P(2) = 3.7e-97
Identities = 204/362 (56%), Positives = 255/362 (70%)
Query: 21 AADVAVPDQFPAGLRVLVVDDDITCLRILEQMLRRCLYNVTTCSQAAVALDILRERKGCF 80
AA + D FPA LRVLVVDDD TCL ILE+ML CLY VT C++A AL +LR+ K F
Sbjct: 15 AAGGSNSDPFPANLRVLVVDDDPTCLMILERMLMTCLYRVTKCNRAESALSLLRKNKNGF 74
Query: 81 DVVLSDVHMPDMDGFKLLEHIGLEMDLPVI---TDGRVSAVMRGIRHGACDYLIKPIREE 137
D+V+SDVHMPDMDGFKLLEH+GLEMDLPVI D S V++G+ HGA DYLIKP+R E
Sbjct: 75 DIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRIE 134
Query: 138 ELKNIWQHVVRKRWNE-NKEHENSGSLEET----DHHKRGSDEIEY-ASSVNEGTEGTFK 191
LKNIWQHVVRK+ NE N + GS+E+T D ++ ++ + +SSVNEG G +
Sbjct: 135 ALKNIWQHVVRKKRNEWNVSEHSGGSIEDTGGDRDRQQQHREDADNNSSSVNEGN-G--R 191
Query: 192 AQRKRISAKEEDDGELESDDPSTTKKPRVVWSVELHQQFVSAVNQLGIDKAVPKRILELM 251
+ RKR + +D G+ + +D S+ KKPRVVWSVELHQQFV+AVNQLG+DKAVPK+ILE+M
Sbjct: 192 SSRKRKEEEVDDQGD-DKEDSSSLKKPRVVWSVELHQQFVAAVNQLGVDKAVPKKILEMM 250
Query: 252 NVPGLTRENVASHLQEINLQKFRLYLKRLNGVSQ-QGGITNSFCAPIETNV-KLGSLGRF 309
NVPGLTRENVASHLQ K+R+YL+RL GVSQ QG + +SF + + L SL F
Sbjct: 251 NVPGLTRENVASHLQ-----KYRIYLRRLGGVSQHQGNMNHSFMTGQDQSFGPLSSLNGF 305
Query: 310 DIQALAASGQIPPQTLAALHAELLGRPT----GNLVTA-VDQPALLQATLQGPKCIPAD- 363
D+Q+LA +GQ+PPQ+LA L A LGRPT G V+ VDQ ++ + PK D
Sbjct: 306 DLQSLAVTGQLPPQSLAQLQAAGLGRPTLAKPGMSVSPLVDQRSIFN--FENPKIRFGDG 363
Query: 364 HG 365
HG
Sbjct: 364 HG 365
|
|
| TAIR|locus:2065398 RR14 "response regulator 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y0W3 Q7Y0W3 "Two-component response regulator EHD1" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y0W5 EHD1 "Two-component response regulator EHD1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155954 APRR4 "pseudo-response regulator 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2141020 APRR2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 665 | |||
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 7e-24 | |
| COG2204 | 464 | COG2204, AtoC, Response regulator containing CheY- | 9e-23 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 8e-22 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 2e-21 | |
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 3e-20 | |
| COG3706 | 435 | COG3706, PleD, Response regulator containing a Che | 7e-19 | |
| COG0745 | 229 | COG0745, OmpR, Response regulators consisting of a | 6e-18 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 5e-15 | |
| CHL00148 | 240 | CHL00148, orf27, Ycf27; Reviewed | 2e-14 | |
| COG3437 | 360 | COG3437, COG3437, Response regulator containing a | 2e-13 | |
| PLN03162 | 526 | PLN03162, PLN03162, golden-2 like transcription fa | 5e-13 | |
| COG4565 | 224 | COG4565, CitB, Response regulator of citrate/malat | 2e-12 | |
| smart00448 | 55 | smart00448, REC, cheY-homologous receiver domain | 4e-12 | |
| PRK10365 | 441 | PRK10365, PRK10365, transcriptional regulatory pro | 5e-12 | |
| TIGR01818 | 463 | TIGR01818, ntrC, nitrogen regulation protein NR(I) | 7e-12 | |
| COG4753 | 475 | COG4753, COG4753, Response regulator containing Ch | 8e-12 | |
| COG4566 | 202 | COG4566, TtrR, Response regulator [Signal transduc | 2e-11 | |
| PRK11107 | 919 | PRK11107, PRK11107, hybrid sensory histidine kinas | 7e-11 | |
| PRK10610 | 129 | PRK10610, PRK10610, chemotaxis regulatory protein | 9e-11 | |
| COG2197 | 211 | COG2197, CitB, Response regulator containing a Che | 1e-10 | |
| PRK11361 | 457 | PRK11361, PRK11361, acetoacetate metabolism regula | 1e-09 | |
| PRK15115 | 444 | PRK15115, PRK15115, response regulator GlrR; Provi | 2e-08 | |
| COG3947 | 361 | COG3947, COG3947, Response regulator containing Ch | 2e-08 | |
| PRK10923 | 469 | PRK10923, glnG, nitrogen regulation protein NR(I); | 4e-08 | |
| PRK10955 | 232 | PRK10955, PRK10955, DNA-binding transcriptional re | 9e-08 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 2e-07 | |
| PRK11083 | 228 | PRK11083, PRK11083, DNA-binding response regulator | 2e-07 | |
| PRK09390 | 202 | PRK09390, fixJ, response regulator FixJ; Provision | 4e-07 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 6e-07 | |
| COG4567 | 182 | COG4567, COG4567, Response regulator consisting of | 8e-07 | |
| PRK10643 | 222 | PRK10643, PRK10643, DNA-binding transcriptional re | 1e-06 | |
| COG3707 | 194 | COG3707, AmiR, Response regulator with putative an | 1e-06 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 2e-06 | |
| COG3279 | 244 | COG3279, LytT, Response regulator of the LytR/AlgR | 4e-06 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 7e-06 | |
| TIGR01387 | 218 | TIGR01387, cztR_silR_copR, heavy metal response re | 8e-06 | |
| PRK12555 | 337 | PRK12555, PRK12555, chemotaxis-specific methyleste | 9e-06 | |
| PLN03029 | 222 | PLN03029, PLN03029, type-a response regulator prot | 2e-05 | |
| PRK10430 | 239 | PRK10430, PRK10430, DNA-binding transcriptional ac | 3e-05 | |
| COG2201 | 350 | COG2201, CheB, Chemotaxis response regulator conta | 3e-05 | |
| PRK10693 | 303 | PRK10693, PRK10693, response regulator of RpoS; Pr | 1e-04 | |
| PRK00742 | 354 | PRK00742, PRK00742, chemotaxis-specific methyleste | 1e-04 | |
| PRK15479 | 221 | PRK15479, PRK15479, transcriptional regulatory pro | 1e-04 | |
| PRK09468 | 239 | PRK09468, ompR, osmolarity response regulator; Pro | 2e-04 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 4e-04 | |
| TIGR02154 | 226 | TIGR02154, PhoB, phosphate regulon transcriptional | 6e-04 | |
| PRK11466 | 914 | PRK11466, PRK11466, hybrid sensory histidine kinas | 6e-04 | |
| PRK11517 | 223 | PRK11517, PRK11517, transcriptional regulatory pro | 0.001 | |
| PRK09959 | 1197 | PRK09959, PRK09959, hybrid sensory histidine kinas | 0.002 |
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
Score = 96.5 bits (241), Expect = 7e-24
Identities = 39/114 (34%), Positives = 56/114 (49%), Gaps = 6/114 (5%)
Query: 37 LVVDDDITCLRILEQMLRRCLYNVTTCSQAAVALDILRERKGCFDVVLSDVHMPDMDGFK 96
L+VDDD +L ++L + Y V AL +L E K D++L D+ MP MDG +
Sbjct: 1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEK--PDLILLDIMMPGMDGLE 58
Query: 97 LLEHI-GLEMDLPVI---TDGRVSAVMRGIRHGACDYLIKPIREEELKNIWQHV 146
LL I D+P+I G + ++ GA DYL KP EEL + +
Sbjct: 59 LLRRIRKRGPDIPIIFLTAHGDDEDAVEALKAGADDYLTKPFSPEELLARIRAL 112
|
Length = 113 |
| >gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|178707 PLN03162, PLN03162, golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226933 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226230 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|225818 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator | Back alignment and domain information |
|---|
| >gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182454 PRK10430, PRK10430, DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >gnl|CDD|236914 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 665 | |||
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 99.97 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 99.79 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 99.77 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 99.76 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 99.76 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 99.7 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.7 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 99.68 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 99.68 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 99.68 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 99.67 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 99.66 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 99.66 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 99.65 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 99.65 | |
| PRK09483 | 217 | response regulator; Provisional | 99.65 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 99.64 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 99.59 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 99.58 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 99.58 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 99.57 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 99.57 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 99.57 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 99.56 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 99.56 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 99.55 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 99.54 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 99.54 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 99.54 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 99.53 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 99.53 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 99.52 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 99.52 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 99.52 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 99.52 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 99.52 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 99.51 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 99.51 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 99.51 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 99.5 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 99.5 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 99.5 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 99.49 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 99.49 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 99.49 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 99.48 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 99.48 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 99.48 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 99.47 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 99.46 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.45 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 99.45 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 99.44 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 99.43 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 99.42 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.42 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 99.42 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 99.42 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 99.42 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 99.4 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 99.37 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 99.36 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 99.35 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.34 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.34 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.34 | |
| PRK13435 | 145 | response regulator; Provisional | 99.32 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.3 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 99.29 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 99.28 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 99.27 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.26 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 99.25 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.2 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 99.15 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 99.12 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 99.12 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 99.11 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 99.11 | |
| PRK10219 | 107 | DNA-binding transcriptional regulator SoxS; Provis | 99.09 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 99.08 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 99.06 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 99.06 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 99.02 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 99.02 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 99.0 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 98.99 | |
| COG3279 | 244 | LytT Response regulator of the LytR/AlgR family [T | 98.96 | |
| PF12833 | 81 | HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_ | 98.94 | |
| COG2207 | 127 | AraC AraC-type DNA-binding domain-containing prote | 98.89 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 98.89 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 98.83 | |
| PRK09393 | 322 | ftrA transcriptional activator FtrA; Provisional | 98.81 | |
| PRK09978 | 274 | DNA-binding transcriptional regulator GadX; Provis | 98.81 | |
| PRK15121 | 289 | right oriC-binding transcriptional activator; Prov | 98.76 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 98.76 | |
| PRK15044 | 295 | transcriptional regulator SirC; Provisional | 98.72 | |
| PRK09940 | 253 | transcriptional regulator YdeO; Provisional | 98.72 | |
| PRK15185 | 309 | transcriptional regulator HilD; Provisional | 98.68 | |
| PRK15340 | 216 | transcriptional regulator InvF; Provisional | 98.65 | |
| COG4977 | 328 | Transcriptional regulator containing an amidase do | 98.61 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 98.61 | |
| PRK15186 | 291 | AraC family transcriptional regulator; Provisional | 98.61 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 98.59 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 98.54 | |
| PRK10130 | 350 | transcriptional regulator EutR; Provisional | 98.54 | |
| PRK15435 | 353 | bifunctional DNA-binding transcriptional dual regu | 98.45 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 98.3 | |
| COG2169 | 187 | Ada Adenosine deaminase [Nucleotide transport and | 98.04 | |
| PF00165 | 42 | HTH_AraC: Bacterial regulatory helix-turn-helix pr | 97.9 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 97.79 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 97.54 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 97.47 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 96.77 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 94.87 | |
| PRK02261 | 137 | methylaspartate mutase subunit S; Provisional | 94.83 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 94.23 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 93.68 | |
| PRK15435 | 353 | bifunctional DNA-binding transcriptional dual regu | 91.65 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 91.37 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 89.96 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 88.54 | |
| TIGR01501 | 134 | MthylAspMutase methylaspartate mutase, S subunit. | 88.5 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 87.79 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 87.41 | |
| PF03709 | 115 | OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal | 87.06 | |
| PRK11511 | 127 | DNA-binding transcriptional activator MarA; Provis | 85.82 | |
| PRK10219 | 107 | DNA-binding transcriptional regulator SoxS; Provis | 85.77 | |
| COG2169 | 187 | Ada Adenosine deaminase [Nucleotide transport and | 85.08 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 84.34 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 84.18 | |
| cd02072 | 128 | Glm_B12_BD B12 binding domain of glutamate mutase | 83.09 | |
| PF10087 | 97 | DUF2325: Uncharacterized protein conserved in bact | 82.66 | |
| PRK09685 | 302 | DNA-binding transcriptional activator FeaR; Provis | 82.05 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 80.63 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 80.59 | |
| COG2185 | 143 | Sbm Methylmalonyl-CoA mutase, C-terminal domain/su | 80.35 |
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.97 E-value=8.6e-32 Score=295.37 Aligned_cols=116 Identities=28% Similarity=0.464 Sum_probs=104.3
Q ss_pred ccEEEEEeCCHHHHHHHHHHHHhC--CCE-EEEECCHHHHHHHHHHcCCCceEEEEeCCCCCCCHHHHHHHHhcc-CCcc
Q 006006 33 GLRVLVVDDDITCLRILEQMLRRC--LYN-VTTCSQAAVALDILRERKGCFDVVLSDVHMPDMDGFKLLEHIGLE-MDLP 108 (665)
Q Consensus 33 girVLIVDDD~~ire~Lk~lL~~~--gy~-V~tAsngeEALelLre~k~~PDLVIlDI~MP~mDGlELLe~Ir~~-~~IP 108 (665)
.++||||||++.+|++|+.+++|. +++ |.+|.||.+|++++++.. |||||+||+||+|||++|++.+++. +.+-
T Consensus 1 MykVlIVDDE~lIr~GLk~lI~w~~~g~eiVgtA~NG~eAleli~e~~--pDiviTDI~MP~mdGLdLI~~ike~~p~~~ 78 (475)
T COG4753 1 MYKVLIVDDEPLIREGLKSLIDWEALGIEVVGTAANGKEALELIQETQ--PDIVITDINMPGMDGLDLIKAIKEQSPDTE 78 (475)
T ss_pred CeeEEEecChHHHHHHHHHhCChhhcCCeEEEecccHHHHHHHHHhcC--CCEEEEecCCCCCcHHHHHHHHHHhCCCce
Confidence 379999999999999999999986 555 469999999999999987 9999999999999999999999753 4444
Q ss_pred EE---ecCchHHHHHHHHcCCCeEEeCCCCHHHHHHHHHHHHHHh
Q 006006 109 VI---TDGRVSAVMRGIRHGACDYLIKPIREEELKNIWQHVVRKR 150 (665)
Q Consensus 109 VI---a~sd~e~a~kALe~GA~DYLlKPv~~eEL~~aLq~Vlrk~ 150 (665)
+| ++++|+|+++|+++|+.|||+||++.++|.+++.++..+.
T Consensus 79 ~IILSGy~eFeYak~Am~lGV~dYLLKP~~k~eL~~~L~ki~~kl 123 (475)
T COG4753 79 FIILSGYDEFEYAKKAMKLGVKDYLLKPVDKAELEEALKKIIGKL 123 (475)
T ss_pred EEEEeccchhHHHHHHHhcCchhheeCcCCHHHHHHHHHHHHHHH
Confidence 43 8999999999999999999999999999999998887654
|
|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >PRK10219 DNA-binding transcriptional regulator SoxS; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12833 HTH_18: Helix-turn-helix domain; PDB: 2K9S_A 3LSG_C 3OIO_A 1D5Y_B 3GBG_A 3OOU_A 1BL0_A 1XS9_A 3MN2_B 3MKL_B | Back alignment and domain information |
|---|
| >COG2207 AraC AraC-type DNA-binding domain-containing proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PRK09393 ftrA transcriptional activator FtrA; Provisional | Back alignment and domain information |
|---|
| >PRK09978 DNA-binding transcriptional regulator GadX; Provisional | Back alignment and domain information |
|---|
| >PRK15121 right oriC-binding transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >PRK15044 transcriptional regulator SirC; Provisional | Back alignment and domain information |
|---|
| >PRK09940 transcriptional regulator YdeO; Provisional | Back alignment and domain information |
|---|
| >PRK15185 transcriptional regulator HilD; Provisional | Back alignment and domain information |
|---|
| >PRK15340 transcriptional regulator InvF; Provisional | Back alignment and domain information |
|---|
| >COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PRK15186 AraC family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK10130 transcriptional regulator EutR; Provisional | Back alignment and domain information |
|---|
| >PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >PRK02261 methylaspartate mutase subunit S; Provisional | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >PRK15435 bifunctional DNA-binding transcriptional dual regulator/O6-methylguanine-DNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >TIGR01501 MthylAspMutase methylaspartate mutase, S subunit | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure | Back alignment and domain information |
|---|
| >PRK11511 DNA-binding transcriptional activator MarA; Provisional | Back alignment and domain information |
|---|
| >PRK10219 DNA-binding transcriptional regulator SoxS; Provisional | Back alignment and domain information |
|---|
| >COG2169 Ada Adenosine deaminase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) | Back alignment and domain information |
|---|
| >PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PRK09685 DNA-binding transcriptional activator FeaR; Provisional | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 665 | ||||
| 1irz_A | 64 | Solution Structure Of Arr10-B Belonging To The Garp | 3e-17 | ||
| 3t6k_A | 136 | Crystal Structure Of A Hypothetical Response Regula | 2e-07 | ||
| 1w25_A | 459 | Response Regulator Pled In Complex With C-digmp Len | 2e-07 | ||
| 3olw_A | 129 | Structural And Functional Effects Of Substitution A | 2e-07 | ||
| 1ab6_A | 125 | Structure Of Chey Mutant F14n, V86t Length = 125 | 3e-07 | ||
| 2wb4_A | 459 | Activated Diguanylate Cyclase Pled In Complex With | 3e-07 | ||
| 3r0j_A | 250 | Structure Of Phop From Mycobacterium Tuberculosis L | 4e-07 | ||
| 1vlz_A | 128 | Uncoupled Phosphorylation And Activation In Bacteri | 4e-07 | ||
| 1ab5_A | 125 | Structure Of Chey Mutant F14n, V21t Length = 125 | 6e-07 | ||
| 3to5_A | 134 | High Resolution Structure Of Chey3 From Vibrio Chol | 6e-07 | ||
| 3ffx_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59r, | 6e-07 | ||
| 3olx_A | 129 | Structural And Functional Effects Of Substitution A | 6e-07 | ||
| 2zwm_A | 130 | Crystal Structure Of Yycf Receiver Domain From Baci | 6e-07 | ||
| 3fft_A | 128 | Crystal Structure Of Chey Double Mutant F14e, E89r | 6e-07 | ||
| 1d4z_A | 128 | Crystal Structure Of Chey-95iv, A Hyperactive Chey | 7e-07 | ||
| 1l5y_A | 155 | Crystal Structure Of Mg2+ / Bef3-bound Receiver Dom | 8e-07 | ||
| 3f6p_A | 120 | Crystal Structure Of Unphosphorelated Receiver Doma | 8e-07 | ||
| 3olv_A | 129 | Structural And Functional Effects Of Substitution A | 8e-07 | ||
| 1cey_A | 128 | Assignments, Secondary Structure, Global Fold, And | 8e-07 | ||
| 1djm_A | 129 | Solution Structure Of Bef3-Activated Chey From Esch | 8e-07 | ||
| 1eay_A | 128 | Chey-Binding (P2) Domain Of Chea In Complex With Ch | 9e-07 | ||
| 3oo0_A | 129 | Structure Of Apo Chey A113p Length = 129 | 9e-07 | ||
| 3myy_A | 128 | Structure Of E. Coli Chey Mutant A113p Bound To Ber | 1e-06 | ||
| 3fgz_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 1e-06 | ||
| 1cye_A | 129 | Three Dimensional Structure Of Chemotactic Che Y Pr | 1e-06 | ||
| 3oly_A | 129 | Structural And Functional Effects Of Substitution A | 1e-06 | ||
| 1mih_A | 129 | A Role For Chey Glu 89 In Chez-Mediated Dephosphory | 1e-06 | ||
| 1yio_A | 208 | Crystallographic Structure Of Response Regulator St | 1e-06 | ||
| 1ymv_A | 129 | Signal Transduction Protein Chey Mutant With Phe 14 | 1e-06 | ||
| 1ymu_A | 130 | Signal Transduction Protein Chey Mutant With Met 17 | 1e-06 | ||
| 6chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 1e-06 | ||
| 3f7n_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 2e-06 | ||
| 1qkk_A | 155 | Crystal Structure Of The Receiver Domain And Linker | 2e-06 | ||
| 2fka_A | 129 | Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che | 2e-06 | ||
| 3ffw_A | 128 | Crystal Structure Of Chey Triple Mutant F14q, N59k, | 2e-06 | ||
| 2che_A | 128 | Structure Of The Mg2+-Bound Form Of Chey And Mechan | 2e-06 | ||
| 3rvj_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 2e-06 | ||
| 3rvp_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 3e-06 | ||
| 2ayx_A | 254 | Solution Structure Of The E.Coli Rcsc C-Terminus (R | 3e-06 | ||
| 5chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 3e-06 | ||
| 2id7_A | 128 | 1.75 A Structure Of T87i Phosphono-Chey Length = 12 | 3e-06 | ||
| 3rvl_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 3e-06 | ||
| 3rvn_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 4e-06 | ||
| 1jbe_A | 128 | 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co | 4e-06 | ||
| 1ehc_A | 128 | Structure Of Signal Transduction Protein Chey Lengt | 5e-06 | ||
| 2chy_A | 128 | Three-Dimensional Structure Of Chey, The Response R | 6e-06 | ||
| 1c4w_A | 128 | 1.9 A Structure Of A-Thiophosphonate Modified Chey | 6e-06 | ||
| 1zdm_A | 129 | Crystal Structure Of Activated Chey Bound To Xe Len | 6e-06 | ||
| 2ayz_A | 133 | Solution Structure Of The E.Coli Rcsc C-Terminus (R | 7e-06 | ||
| 1e6k_A | 130 | Two-Component Signal Transduction System D12a Mutan | 7e-06 | ||
| 1e6l_A | 127 | Two-Component Signal Transduction System D13a Mutan | 7e-06 | ||
| 1e6m_A | 128 | Two-Component Signal Transduction System D57a Mutan | 8e-06 | ||
| 3jte_A | 143 | Crystal Structure Of Response Regulator Receiver Do | 8e-06 | ||
| 1udr_A | 129 | Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep | 9e-06 | ||
| 2id9_A | 128 | 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length | 9e-06 | ||
| 3nhz_A | 125 | Structure Of N-Terminal Domain Of Mtra Length = 125 | 1e-05 | ||
| 1dc7_A | 124 | Structure Of A Transiently Phosphorylated "switch" | 1e-05 | ||
| 1krw_A | 124 | Solution Structure And Backbone Dynamics Of Beryllo | 2e-05 | ||
| 1j56_A | 124 | Minimized Average Structure Of Beryllofluoride-Acti | 2e-05 | ||
| 3q9s_A | 249 | Crystal Structure Of Rra(1-215) From Deinococcus Ra | 2e-05 | ||
| 3nnn_A | 122 | Bef3 Activated Drrd Receiver Domain Length = 122 | 3e-05 | ||
| 1zy2_A | 150 | Crystal Structure Of The Phosphorylated Receiver Do | 3e-05 | ||
| 1mvo_A | 136 | Crystal Structure Of The Phop Receiver Domain From | 5e-05 | ||
| 1a2o_A | 349 | Structural Basis For Methylesterase Cheb Regulation | 6e-05 | ||
| 3gwg_A | 129 | Crystal Structure Of Chey Of Helicobacter Pylori Le | 8e-05 | ||
| 1dc8_A | 124 | Structure Of A Transiently Phosphorylated "switch" | 9e-05 | ||
| 1m5t_A | 124 | Crystal Structure Of The Response Regulator Divk Le | 1e-04 | ||
| 3f7a_A | 394 | Structure Of Orthorhombic Crystal Form Of Pseudomon | 1e-04 | ||
| 3mm4_A | 206 | Crystal Structure Of The Receiver Domain Of The His | 2e-04 | ||
| 3eq2_A | 394 | Structure Of Hexagonal Crystal Form Of Pseudomonas | 2e-04 | ||
| 2oqr_A | 230 | The Structure Of The Response Regulator Regx3 From | 2e-04 | ||
| 3h1g_A | 129 | Crystal Structure Of Chey Mutant T84a Of Helicobact | 3e-04 | ||
| 1u8t_A | 128 | Crystal Structure Of Chey D13k Y106w Alone And In C | 6e-04 | ||
| 3h1f_A | 129 | Crystal Structure Of Chey Mutant D53a Of Helicobact | 6e-04 | ||
| 3c97_A | 140 | Crystal Structure Of The Response Regulator Receive | 7e-04 | ||
| 1ys6_A | 233 | Crystal Structure Of The Response Regulatory Protei | 8e-04 |
| >pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family Of Plant Myb-Related Dna Binding Motifs Of The Arabidopsis Response Regulators Length = 64 | Back alignment and structure |
|
| >pdb|3T6K|A Chain A, Crystal Structure Of A Hypothetical Response Regulator (Caur_3799) From Chloroflexus Aurantiacus J-10-Fl At 1.86 A Resolution Length = 136 | Back alignment and structure |
| >pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-digmp Length = 459 | Back alignment and structure |
| >pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 | Back alignment and structure |
| >pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 | Back alignment and structure |
| >pdb|3R0J|A Chain A, Structure Of Phop From Mycobacterium Tuberculosis Length = 250 | Back alignment and structure |
| >pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 | Back alignment and structure |
| >pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 | Back alignment and structure |
| >pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 | Back alignment and structure |
| >pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 | Back alignment and structure |
| >pdb|1L5Y|A Chain A, Crystal Structure Of Mg2+ / Bef3-bound Receiver Domain Of Sinorhizobium Meliloti Dctd Length = 155 | Back alignment and structure |
| >pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 | Back alignment and structure |
| >pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 | Back alignment and structure |
| >pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 | Back alignment and structure |
| >pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 | Back alignment and structure |
| >pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 | Back alignment and structure |
| >pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 | Back alignment and structure |
| >pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 | Back alignment and structure |
| >pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 | Back alignment and structure |
| >pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 | Back alignment and structure |
| >pdb|1YIO|A Chain A, Crystallographic Structure Of Response Regulator Styr From Pseudomonas Fluorescens Length = 208 | Back alignment and structure |
| >pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 | Back alignment and structure |
| >pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 | Back alignment and structure |
| >pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1QKK|A Chain A, Crystal Structure Of The Receiver Domain And Linker Region Of Dctd From Sinorhizobium Meliloti Length = 155 | Back alignment and structure |
| >pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 | Back alignment and structure |
| >pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 | Back alignment and structure |
| >pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 | Back alignment and structure |
| >pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 | Back alignment and structure |
| >pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|2ID7|A Chain A, 1.75 A Structure Of T87i Phosphono-Chey Length = 128 | Back alignment and structure |
| >pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 | Back alignment and structure |
| >pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 | Back alignment and structure |
| >pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 | Back alignment and structure |
| >pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 | Back alignment and structure |
| >pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 | Back alignment and structure |
| >pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 | Back alignment and structure |
| >pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 | Back alignment and structure |
| >pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 | Back alignment and structure |
| >pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 | Back alignment and structure |
| >pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 | Back alignment and structure |
| >pdb|3JTE|A Chain A, Crystal Structure Of Response Regulator Receiver Domain Protein From Clostridium Thermocellum Length = 143 | Back alignment and structure |
| >pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 | Back alignment and structure |
| >pdb|2ID9|A Chain A, 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length = 128 | Back alignment and structure |
| >pdb|3NHZ|A Chain A, Structure Of N-Terminal Domain Of Mtra Length = 125 | Back alignment and structure |
| >pdb|1DC7|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 | Back alignment and structure |
| >pdb|1KRW|A Chain A, Solution Structure And Backbone Dynamics Of Beryllofluoride- Activated Ntrc Receiver Domain Length = 124 | Back alignment and structure |
| >pdb|1J56|A Chain A, Minimized Average Structure Of Beryllofluoride-Activated Ntrc Receiver Domain: Model Structure Incorporating Active Site Contacts Length = 124 | Back alignment and structure |
| >pdb|3Q9S|A Chain A, Crystal Structure Of Rra(1-215) From Deinococcus Radiodurans Length = 249 | Back alignment and structure |
| >pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 | Back alignment and structure |
| >pdb|1ZY2|A Chain A, Crystal Structure Of The Phosphorylated Receiver Domain Of The Transcription Regulator Ntrc1 From Aquifex Aeolicus Length = 150 | Back alignment and structure |
| >pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 | Back alignment and structure |
| >pdb|1A2O|A Chain A, Structural Basis For Methylesterase Cheb Regulation By A Phosphorylation-Activated Domain Length = 349 | Back alignment and structure |
| >pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|1DC8|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 | Back alignment and structure |
| >pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 | Back alignment and structure |
| >pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|3MM4|A Chain A, Crystal Structure Of The Receiver Domain Of The Histidine Kinase Cki1 From Arabidopsis Thaliana Length = 206 | Back alignment and structure |
| >pdb|3EQ2|A Chain A, Structure Of Hexagonal Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 | Back alignment and structure |
| >pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|1U8T|A Chain A, Crystal Structure Of Chey D13k Y106w Alone And In Complex With A Flim Peptide Length = 128 | Back alignment and structure |
| >pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 | Back alignment and structure |
| >pdb|1YS6|A Chain A, Crystal Structure Of The Response Regulatory Protein Prra From Mycobacterium Tuberculosis Length = 233 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
Score = 108 bits (270), Expect = 9e-29
Identities = 40/69 (57%), Positives = 56/69 (81%), Gaps = 5/69 (7%)
Query: 213 STTKKPRVVWSVELHQQFVSAVNQLGIDKAVPKRILELMNVPGLTRENVASHLQEINLQK 272
+ KKPRV+W+ ELH +F++AV+ LG+++AVPK+IL+LMNV LTRENVASH LQK
Sbjct: 1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASH-----LQK 55
Query: 273 FRLYLKRLN 281
FR+ LK+++
Sbjct: 56 FRVALKKVS 64
|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 665 | |||
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 99.89 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.84 | |
| 3r0j_A | 250 | Possible two component system response transcript | 99.82 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 99.81 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 99.81 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 99.81 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 99.8 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 99.8 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 99.79 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 99.79 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 99.78 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 99.78 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 99.78 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 99.77 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 99.77 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 99.77 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 99.77 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 99.77 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 99.77 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 99.76 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 99.76 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 99.76 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 99.76 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 99.76 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 99.76 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 99.75 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 99.75 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 99.75 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 99.75 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 99.75 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 99.75 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 99.75 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 99.75 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 99.75 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 99.75 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 99.74 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 99.74 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 99.74 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 99.74 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 99.74 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 99.74 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 99.74 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.74 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 99.74 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 99.74 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 99.74 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 99.74 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 99.74 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 99.74 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 99.74 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 99.74 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 99.74 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 99.74 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 99.74 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 99.73 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 99.73 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 99.73 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 99.73 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 99.73 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 99.73 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.73 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 99.73 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 99.73 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 99.72 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 99.72 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 99.72 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 99.72 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 99.72 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 99.71 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 99.71 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 99.71 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 99.71 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 99.71 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 99.71 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 99.71 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 99.7 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 99.7 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 99.7 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.7 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 99.7 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 99.69 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 99.69 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 99.69 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 99.69 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 99.69 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 99.68 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 99.68 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 99.68 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 99.68 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 99.67 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 99.67 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.67 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.66 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 99.66 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 99.66 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 99.66 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 99.64 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 99.64 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 99.64 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 99.64 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 99.63 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 99.62 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 99.6 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 99.58 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 99.55 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 99.54 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.47 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 99.41 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 99.39 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 99.18 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 99.17 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 99.16 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 99.15 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 99.14 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 99.13 | |
| 3mkl_A | 120 | HTH-type transcriptional regulator GADX; PSI2, MCS | 99.08 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 98.94 | |
| 1d5y_A | 292 | ROB transcription factor; protein-DNA complex, DNA | 98.84 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 98.83 | |
| 4fe7_A | 412 | Xylose operon regulatory protein; HTH_ARAC, helix- | 98.77 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 98.74 | |
| 1u8b_A | 133 | ADA polyprotein; protein-DNA complex, methylation, | 97.37 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 96.01 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 95.04 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 94.49 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 94.3 | |
| 2k9s_A | 107 | Arabinose operon regulatory protein; activator, ar | 93.95 | |
| 3q7r_A | 121 | Transcriptional regulatory protein; CHXR, receiver | 93.81 | |
| 3mn2_A | 108 | Probable ARAC family transcriptional regulator; st | 93.8 | |
| 3oio_A | 113 | Transcriptional regulator (ARAC-type DNA-binding c | 92.84 | |
| 3lsg_A | 103 | Two-component response regulator YESN; structural | 92.68 | |
| 3oou_A | 108 | LIN2118 protein; protein structure initiative, PSI | 91.99 | |
| 1bl0_A | 129 | Protein (multiple antibiotic resistance protein), | 89.3 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 88.69 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 87.49 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 85.75 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 84.21 | |
| 1d5y_A | 292 | ROB transcription factor; protein-DNA complex, DNA | 84.02 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 82.34 |
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
Probab=99.89 E-value=6.5e-23 Score=190.68 Aligned_cols=119 Identities=28% Similarity=0.553 Sum_probs=107.4
Q ss_pred CCCCccEEEEEeCCHHHHHHHHHHHHhCCCE-EEEECCHHHHHHHHHHcCCCceEEEEeCCCCCCCHHHHHHHHhcc---
Q 006006 29 QFPAGLRVLVVDDDITCLRILEQMLRRCLYN-VTTCSQAAVALDILRERKGCFDVVLSDVHMPDMDGFKLLEHIGLE--- 104 (665)
Q Consensus 29 ~fP~girVLIVDDD~~ire~Lk~lL~~~gy~-V~tAsngeEALelLre~k~~PDLVIlDI~MP~mDGlELLe~Ir~~--- 104 (665)
.+.+.+|||||||++..|+.++.+|+..||. |.+|.+|.+|++++++.. |||||+|++||+|||++++++||..
T Consensus 8 ~m~k~~rILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~~~~--~DlillD~~MP~mdG~el~~~ir~~~~~ 85 (134)
T 3to5_A 8 ILNKNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGD--FDFVVTDWNMPGMQGIDLLKNIRADEEL 85 (134)
T ss_dssp -CCTTCCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHHC--CSEEEEESCCSSSCHHHHHHHHHHSTTT
T ss_pred HhCCCCEEEEEeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHHhCC--CCEEEEcCCCCCCCHHHHHHHHHhCCCC
Confidence 3457799999999999999999999999985 778999999999999887 9999999999999999999999853
Q ss_pred CCccEE---ecCchHHHHHHHHcCCCeEEeCCCCHHHHHHHHHHHHHH
Q 006006 105 MDLPVI---TDGRVSAVMRGIRHGACDYLIKPIREEELKNIWQHVVRK 149 (665)
Q Consensus 105 ~~IPVI---a~sd~e~a~kALe~GA~DYLlKPv~~eEL~~aLq~Vlrk 149 (665)
.++||| ++.+.+...+|++.||++||.||++.++|.+.+++++++
T Consensus 86 ~~ipvI~lTa~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~R 133 (134)
T 3to5_A 86 KHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER 133 (134)
T ss_dssp TTCCEEEEESSCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHCC-
T ss_pred CCCeEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHhc
Confidence 578888 677888999999999999999999999999999987643
|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >3mkl_A HTH-type transcriptional regulator GADX; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >1u8b_A ADA polyprotein; protein-DNA complex, methylation, zinc, helix-turn-helix, metal binding protein/DNA complex; 2.10A {Escherichia coli} PDB: 1zgw_A* 1wpk_A* 1adn_A 1eyf_A | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A | Back alignment and structure |
|---|
| >3mn2_A Probable ARAC family transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3oio_A Transcriptional regulator (ARAC-type DNA-binding containing proteins); PSI-2, midwest center for structural genomics; 1.65A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3lsg_A Two-component response regulator YESN; structural genomics, PSI-2, protein structure initiative, MCSG; 2.05A {Fusobacterium nucleatum} | Back alignment and structure |
|---|
| >3oou_A LIN2118 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; HET: BTB; 1.57A {Listeria innocua} | Back alignment and structure |
|---|
| >1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 PDB: 1xs9_A | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1d5y_A ROB transcription factor; protein-DNA complex, DNA, transcription/DNA complex; HET: DNA; 2.70A {Escherichia coli} SCOP: a.4.1.8 a.4.1.8 d.60.1.2 | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 665 | ||||
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 5e-28 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 6e-26 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 4e-23 | |
| d1a2oa1 | 140 | c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal | 4e-23 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 1e-22 | |
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 2e-22 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 2e-22 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 7e-22 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 2e-21 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 2e-21 | |
| d2b4aa1 | 118 | c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba | 2e-21 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 3e-21 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 4e-20 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 4e-20 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 5e-20 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 8e-20 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 8e-20 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 1e-19 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 1e-19 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 2e-19 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 3e-19 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 5e-19 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 7e-19 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 1e-18 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 1e-18 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 2e-18 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 2e-18 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 2e-18 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 1e-17 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 2e-17 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 2e-17 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 8e-17 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 2e-16 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 6e-16 | |
| d1qo0d_ | 189 | c.23.1.3 (D:) Positive regulator of the amidase op | 2e-14 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 104 bits (261), Expect = 5e-28
Identities = 40/68 (58%), Positives = 55/68 (80%), Gaps = 5/68 (7%)
Query: 213 STTKKPRVVWSVELHQQFVSAVNQLGIDKAVPKRILELMNVPGLTRENVASHLQEINLQK 272
+ KKPRV+W+ ELH +F++AV+ LG+++AVPK+IL+LMNV LTRENVASH LQK
Sbjct: 1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASH-----LQK 55
Query: 273 FRLYLKRL 280
FR+ LK++
Sbjct: 56 FRVALKKV 63
|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 665 | |||
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 99.9 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 99.89 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 99.89 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 99.88 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 99.88 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 99.88 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 99.88 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 99.88 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 99.88 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 99.87 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 99.87 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 99.87 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 99.87 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 99.87 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 99.87 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 99.87 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 99.86 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 99.86 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 99.86 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 99.86 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 99.86 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 99.86 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 99.85 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 99.85 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 99.85 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 99.84 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.84 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 99.83 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 99.83 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 99.82 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 99.82 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 99.81 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 99.79 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 99.74 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.2 | |
| d1bl0a2 | 62 | MarA {Escherichia coli [TaxId: 562]} | 98.74 | |
| d1d5ya2 | 65 | Rob transcription factor, N-terminal domain {Esche | 98.7 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 94.48 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 94.2 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 91.65 | |
| d1xrsb1 | 160 | D-lysine 5,6-aminomutase beta subunit KamE, C-term | 87.73 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 86.39 |
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: PhoP receiver domain species: Escherichia coli [TaxId: 562]
Probab=99.90 E-value=4.1e-23 Score=185.35 Aligned_cols=114 Identities=27% Similarity=0.392 Sum_probs=107.0
Q ss_pred cEEEEEeCCHHHHHHHHHHHHhCCCEEEEECCHHHHHHHHHHcCCCceEEEEeCCCCCCCHHHHHHHHhcc-CCccEE--
Q 006006 34 LRVLVVDDDITCLRILEQMLRRCLYNVTTCSQAAVALDILRERKGCFDVVLSDVHMPDMDGFKLLEHIGLE-MDLPVI-- 110 (665)
Q Consensus 34 irVLIVDDD~~ire~Lk~lL~~~gy~V~tAsngeEALelLre~k~~PDLVIlDI~MP~mDGlELLe~Ir~~-~~IPVI-- 110 (665)
||||||||++.+++.++.+|+..||.|.+|.++++|++++++.. ||+||+|+.||+|||++++++++.. +.+|+|
T Consensus 1 mrILvVDDd~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~~~--~dliilD~~mP~~~G~e~~~~i~~~~~~~pvi~l 78 (119)
T d2pl1a1 1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHI--PDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVL 78 (119)
T ss_dssp CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHSC--CSEEEECSCCSSSCHHHHHHHHHHTTCCSCEEEE
T ss_pred CEEEEEeCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHhcc--cceeehhccCCCchhHHHHHHHHhcCcccceEee
Confidence 69999999999999999999999999999999999999999877 9999999999999999999999754 678887
Q ss_pred -ecCchHHHHHHHHcCCCeEEeCCCCHHHHHHHHHHHHHH
Q 006006 111 -TDGRVSAVMRGIRHGACDYLIKPIREEELKNIWQHVVRK 149 (665)
Q Consensus 111 -a~sd~e~a~kALe~GA~DYLlKPv~~eEL~~aLq~Vlrk 149 (665)
++.+.+...+|++.||+|||.||++.++|...+++++++
T Consensus 79 t~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lrR 118 (119)
T d2pl1a1 79 TARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRR 118 (119)
T ss_dssp ESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHH
T ss_pred eccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHHHcc
Confidence 677888899999999999999999999999999999865
|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bl0a2 a.4.1.8 (A:63-124) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d5ya2 a.4.1.8 (A:57-121) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|