Citrus Sinensis ID: 006698

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----
MKSIKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFDSQTGCDPFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETELIETFGEFLNKSS
cccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHcccccEEEccccccccccccccEEEccccccccccccHHHHHHHHcccccccEEEEcHHHHHHHccHHHHHccccccccEEEEcccccccccccHHHHHHcccccccEEEEEcccccccHHHHHHHHHcccccccccHHHHHHHcccHHHHHHcccHHHHHccccccHHHHHHHHHHHHccHHHHcccHHHHccccccEEEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHcccccccEEEEEcccccccccccccccEEEEEcccccccccHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHcccccccHHHcHHHHHHHccc
cccEEEEEEEccccccccccHHHHHHccHHHHHHHHHHccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHccccccHHHHcEEEccccccEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccHHcccccEEEcccccEccccEEEEEEEEHHHHHHHHHHHccHHHHccccEEEEEEcHHHHHHccHHHHHHHHHHccccEEEEEccccHHccHHHHHHHHHHccHHHcccHHHHHHHHHHHccccccccccHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccccccccHHHHHHHHcHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHccccccEEEEEEEEccccccEEEccccEEEEEEcccccccHHHHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccHHcccccccHHHHHHHHHHHHcccc
mksikdidppfatspsrraewreynnvdpsflddlnsrdsgfdsqtgcdpfthaqgtvwelvprdvrkkmfphqreGFEFIWKNiaggidldelknststgggngciishapgtgktgLTLVFLQAYMKlhprcrpviiaprsmLLTWEEEFKKwgidipfynlnkpelsgkenngavalmdnrkrgrgkvgLIRYVKLYSWKMGTGILGLSYRLFEKLVSgdelsgilldlpglfvfdeghtprnddtCMFKALSRIKTRRRIilsgtpfqnNFQELENTLSLVRQEFGEVLRTVRKSGREISKAKHASLISSIgrcanhrdDEKLKELKEKIapfvnvhkgtvlqeslpglrhsvvilqPDEFQKRLCKAVEGVKSFVELNYCVSLLsvhpsllpqqffesfdvDSAKLARlkldpeagiKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGkqdvkkrqssinvlndpssQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWsnmvfpssdgggndqttasepLEDKILEEMAQLynnpsetlinaiipqpkeTELIETFGEFLNKSS
mksikdidppfatspsrraewREYNNVDPSFLDDLNSRDSGFDSQTGCDPFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGavalmdnrkrgrgkvglIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEghtprnddtcMFKALSRIKTRRRIILsgtpfqnnfQELENTLSLVRQEFGEVLRTVRksgreiskakhaslissigrcanHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQFFESFDVDSAKLArlkldpeagIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKrqssinvlndpssQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISrayrlgqkrvVHVYHlitsetlewdkLRRQARKVWWSNMvfpssdgggndqtTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETELIETFGEFLNKSS
MKSIKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFDSQTGCDPFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISKAKHASLISSIGRCANHRDDeklkelkekIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCvsllsvhpsllpQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETELIETFGEFLNKSS
**********************************************GCDPFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNK***********VALMD**KRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVR*************LISSIGRC***********LKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMD**********************RIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVF**********************************TLINAIIP******LIETF********
**SIKDIDPP*********************************************GTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKEN*********************YVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISK*K*****************EKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQF*****************PEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMV*********************ILEEMAQLYNNPSETLI*****************EFL****
MKSIKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFDSQTGCDPFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETELIETFGEFLNKSS
MKSIKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRD**********PFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISK*************ANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSSD******TTASEPLEDKILEEMAQLYNNPSETL****IPQPKETELIETFGEFLN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSIKDIDPPFATSPSRRAEWREYNNVDPSFLDDLNSRDSGFDSQTGCDPFTHAQGTVWELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLLPQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETELIETFGEFLNKSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query635 2.2.26 [Sep-21-2011]
B3NAN8784 DNA repair and recombinat N/A no 0.722 0.585 0.268 1e-45
O76460784 DNA repair and recombinat yes no 0.719 0.582 0.267 8e-45
B4NXB8784 DNA repair and recombinat N/A no 0.722 0.585 0.266 2e-44
Q29KH2782 DNA repair and recombinat yes no 0.721 0.585 0.263 4e-44
B3MMA5791 DNA repair and recombinat N/A no 0.722 0.580 0.266 7e-44
B4JCS7786 DNA repair and recombinat N/A no 0.727 0.587 0.270 8e-44
B4M9A8786 DNA repair and recombinat N/A no 0.729 0.589 0.258 1e-43
B4KHL5783 DNA repair and recombinat N/A no 0.732 0.593 0.265 1e-43
B4GS98782 DNA repair and recombinat N/A no 0.721 0.585 0.263 1e-43
B4MX21784 DNA repair and recombinat N/A no 0.721 0.584 0.258 3e-43
>sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 Back     alignment and function desciption
 Score =  185 bits (469), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 147/548 (26%), Positives = 257/548 (46%), Gaps = 89/548 (16%)

Query: 72  PHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKLH 131
           PHQREG  F+++ + G             G  NGCI++   G GKT   +  +   ++  
Sbjct: 158 PHQREGVRFMYECVEG-----------KRGNFNGCIMADEMGLGKTLQCVTLVWTLLRQG 206

Query: 132 PRCRP-----VIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKR 186
           P C+P     ++++P S++  WE+EF KW             L G+       L+     
Sbjct: 207 PECKPTINKAIVVSPSSLVKNWEKEFTKW-------------LQGR-------LLCLPME 246

Query: 187 GRGKVGLIRYVKLYSW---KMGTGILGLSY---RLFEKLVSGDELSGILLDLPGLFVFDE 240
           G  K   IR ++ +S    ++GT +L +SY   R++ +++   E+        G+ + DE
Sbjct: 247 GGTKENTIRALEQFSMTSSRLGTPVLLISYETFRIYAEILCKYEV--------GMVICDE 298

Query: 241 GHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEF----------- 289
           GH  +N D   ++AL  +KT+RR++LSGTP QN+  E  + ++ V  E            
Sbjct: 299 GHRLKNSDNLTYQALMGLKTKRRVLLSGTPIQNDLTEYYSLVNFVNPEMLGTAAVFKRNF 358

Query: 290 -GEVLR----TVRKSGREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPFVNVHKGT 344
              +LR        + R+ + AK   LI  + +C   R ++ L +        V   K T
Sbjct: 359 ESAILRGQNTDSTDAERQRAIAKTQELIGLVDQCIIRRTNQILTKYLPVKFEMVICAKLT 418

Query: 345 VLQESLPGLRHSVVILQPDEFQKRL--CKAVEGVKSFVELNYCVSLLSVHPSLLPQQ--- 399
            +Q     L      L+ D+ ++ L  CK    + +  ++     + S HP+L+ ++   
Sbjct: 419 SIQ-----LELYTNFLKSDQVRRSLADCKEKASLTALADITTLKKICS-HPNLIYEKITA 472

Query: 400 ----FFESFDVDSAKLARLKLDPEAGIK---TRFLLILLELSTNEKVLVFSQYIEPLTLI 452
               F  S +V  +      L+PE   K     F+L  +    N+KV++ S Y + L L 
Sbjct: 473 RDKGFENSQNVLPSNYNAKDLNPELSGKFMLLDFMLAAIRADGNDKVVLISNYTQTLDLF 532

Query: 453 MEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVG 512
            EQL  +  +      + +DG   +KKR   ++  NDP S + + + S+KA   G+NL+G
Sbjct: 533 -EQLARKRKY----GFVRLDGTMSIKKRSKVVDRFNDPESDSFLFMLSSKAGGCGLNLIG 587

Query: 513 ASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNM 572
           A+R+ + D  WNP  + QA++R +R GQK+  ++Y L+ S ++E   L+RQ  K   S+ 
Sbjct: 588 ANRLFMFDPDWNPANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSST 647

Query: 573 VFPSSDGG 580
           +  +++  
Sbjct: 648 IIDNNESA 655
Involved in mitotic DNA repair and meiotic recombination. Functions in the recombinational DNA repair pathway. Essential for interhomolog gene conversion (GC), but may have a less important role in intersister GC than spn-A/Rad51. In the presence of DNA, spn-A/Rad51 enhances the ATPase activity of okr/Rad54.
Drosophila erecta (taxid: 7220)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 Back     alignment and function description
>sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 Back     alignment and function description
>sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 Back     alignment and function description
>sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 Back     alignment and function description
>sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 Back     alignment and function description
>sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 Back     alignment and function description
>sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 Back     alignment and function description
>sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 Back     alignment and function description
>sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query635
359474506 1070 PREDICTED: uncharacterized protein LOC10 0.971 0.576 0.547 0.0
255552930 1138 ATP-dependent helicase, putative [Ricinu 0.974 0.543 0.519 1e-163
297742194554 unnamed protein product [Vitis vinifera] 0.828 0.949 0.515 1e-162
224136438576 chromatin remodeling complex subunit [Po 0.864 0.953 0.524 1e-156
110740804 1410 hypothetical protein [Arabidopsis thalia 0.905 0.407 0.480 1e-155
8778726 1465 T25N20.14 [Arabidopsis thaliana] 0.905 0.392 0.480 1e-155
145335142 1410 chromatin remodeling 31 [Arabidopsis tha 0.905 0.407 0.480 1e-155
297848822 1406 hypothetical protein ARALYDRAFT_470549 [ 0.922 0.416 0.477 1e-155
357129269 1181 PREDICTED: uncharacterized protein LOC10 0.959 0.515 0.448 1e-145
242087829 1535 hypothetical protein SORBIDRAFT_09g01941 0.900 0.372 0.460 1e-143
>gi|359474506|ref|XP_002279753.2| PREDICTED: uncharacterized protein LOC100267731 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/654 (54%), Positives = 458/654 (70%), Gaps = 37/654 (5%)

Query: 4    IKDIDPPFATSPSRRAEWREYNNVD-PSFLDDLNSRDSGFDSQTGCDPFTHAQGTVWELV 62
            IK I P F+ +P   +E       D  S  D+L  +  G  SQ+G D   H +GTVW+++
Sbjct: 421  IKYILPSFSRNPWGGSEKGNAGKEDCNSIFDELQFQKPGCGSQSGSDHGLHPEGTVWDII 480

Query: 63   PRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLV 122
            P  +R  M+ HQ EGFEFIWKN+AGGI LDELK S+ + GG+GCIISHAPGTGKT LT+V
Sbjct: 481  P-GIRNSMYRHQCEGFEFIWKNVAGGIYLDELKRSSFSDGGSGCIISHAPGTGKTRLTIV 539

Query: 123  FLQAYMKLHPRCRPVIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMD 182
            FLQ YM+L+P CRPVIIAPR+MLLTWEEEFKKW +DIPF+NLNK E SGKEN  A+  + 
Sbjct: 540  FLQTYMELYPACRPVIIAPRTMLLTWEEEFKKWNVDIPFHNLNKLEYSGKENITALNFLR 599

Query: 183  NRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSG--------------- 227
                       IR VKLYSWK    ILG+SY LFEKL     L+                
Sbjct: 600  RISHQGQSAKSIRMVKLYSWKKDRSILGISYTLFEKLAGERVLADQENKKVKVQDYTKVQ 659

Query: 228  ---ILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSL 284
               ILL+LPGL V DEGHTPRN+ + ++KALS+I T RRIILSGTPFQNNF+EL NTL L
Sbjct: 660  VRKILLELPGLLVLDEGHTPRNEQSLIWKALSKIDTERRIILSGTPFQNNFKELYNTLCL 719

Query: 285  VRQEFGEVLRTVR------KSGRE--ISKAKHASLISSIGRCANHRDDEKLKELKEKIAP 336
            VR +F + +   +      K GR+   ++ K   L SSIG+ A    D+K++EL+  I P
Sbjct: 720  VRPKFADRIAVEQYGGFRGKRGRKSNAARGKWDLLTSSIGKIA----DDKVEELRAMIEP 775

Query: 337  FVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVKSFVELNYCVSLLSVHPSLL 396
            FV++HKGT+LQE+LPGL+ SVV+LQP + Q+RL +++   K+ +EL Y VSL+SVHPSLL
Sbjct: 776  FVHIHKGTILQENLPGLKDSVVVLQPSDLQRRLLESIREKKNPLELGYLVSLISVHPSLL 835

Query: 397  PQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLELS--TNEKVLVFSQYIEPLTLIME 454
            P    + F  D  KL ++KL+P+ G+KT+FL+  +  S   NEKVLVFSQ+++PLT +M+
Sbjct: 836  PSDERKLF-FDQTKLEKIKLNPDIGVKTKFLMAFIRFSETMNEKVLVFSQFLDPLTYLMD 894

Query: 455  QLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGAS 514
            QL++ F+W  G+EVLYMDG++DVK+RQSSIN  NDP+SQ R++LASTKAC EGI+LVGAS
Sbjct: 895  QLKYHFHWIVGKEVLYMDGQRDVKQRQSSINTFNDPASQVRVLLASTKACSEGISLVGAS 954

Query: 515  RVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVF 574
            RV+LLDVVWNP VERQAISRAYRLGQ++VV++YHL+TS T+E +K  RQA+K   S +VF
Sbjct: 955  RVILLDVVWNPSVERQAISRAYRLGQRKVVYIYHLLTSGTMEEEKYCRQAKKDRLSELVF 1014

Query: 575  PSSDGGGNDQTTASEPLEDKILEEMAQLYNNPSETLINAIIPQPKETELIETFG 628
             S D        +S   EDKILEEM Q  +N  + + + II QPKE+ LIETFG
Sbjct: 1015 SSKDKTSAGNKISSTVSEDKILEEMVQ--HNKLKDMFDKIINQPKESNLIETFG 1066

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255552930|ref|XP_002517508.1| ATP-dependent helicase, putative [Ricinus communis] gi|223543519|gb|EEF45050.1| ATP-dependent helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297742194|emb|CBI33981.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224136438|ref|XP_002326860.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222835175|gb|EEE73610.1| chromatin remodeling complex subunit [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110740804|dbj|BAE98499.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8778726|gb|AAF79734.1|AC005106_15 T25N20.14 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145335142|ref|NP_172040.2| chromatin remodeling 31 [Arabidopsis thaliana] gi|332189724|gb|AEE27845.1| chromatin remodeling 31 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297848822|ref|XP_002892292.1| hypothetical protein ARALYDRAFT_470549 [Arabidopsis lyrata subsp. lyrata] gi|297338134|gb|EFH68551.1| hypothetical protein ARALYDRAFT_470549 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|357129269|ref|XP_003566287.1| PREDICTED: uncharacterized protein LOC100833676 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242087829|ref|XP_002439747.1| hypothetical protein SORBIDRAFT_09g019410 [Sorghum bicolor] gi|241945032|gb|EES18177.1| hypothetical protein SORBIDRAFT_09g019410 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query635
TAIR|locus:22010061410 chr31 "chromatin remodeling 31 0.623 0.280 0.466 3.3e-136
TAIR|locus:20872231132 CHR40 "chromatin remodeling 40 0.880 0.493 0.428 4.2e-118
TAIR|locus:21499571261 CHR42 "chromatin remodeling 42 0.474 0.238 0.347 2.1e-77
TAIR|locus:20964991256 CHR38 "chromatin remodeling 38 0.466 0.235 0.333 1.7e-71
TAIR|locus:2050039816 CHR34 "chromatin remodeling 34 0.305 0.237 0.360 1.4e-53
TAIR|locus:2042619888 DRD1 "DEFECTIVE IN RNA-DIRECTE 0.259 0.185 0.361 1.5e-52
UNIPROTKB|B4NXB8784 okr "DNA repair and recombinat 0.248 0.201 0.325 2.6e-34
ZFIN|ZDB-GENE-040426-968738 rad54l "RAD54-like (S. cerevis 0.730 0.628 0.271 2.8e-34
UNIPROTKB|E1C963 1148 RAD54L2 "Uncharacterized prote 0.288 0.159 0.358 2.7e-33
UNIPROTKB|F1NBD4733 RAD54L "DNA repair and recombi 0.725 0.628 0.266 8.9e-33
TAIR|locus:2201006 chr31 "chromatin remodeling 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 864 (309.2 bits), Expect = 3.3e-136, Sum P(2) = 3.3e-136
 Identities = 196/420 (46%), Positives = 265/420 (63%)

Query:   223 DELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTL 282
             D++  IL+  PGL V DE HTPRN  +C++K LS+++T++RI+LSGTPFQNNF EL N L
Sbjct:   995 DDIREILMGRPGLLVLDEAHTPRNQRSCIWKTLSKVETQKRILLSGTPFQNNFLELCNVL 1054

Query:   283 SLVRQEFGEVLR-TVRKSGREISKAKHASLISSIGRCANHRDDXXXXXXXXXIAPFVNVH 341
              L R ++ E L  T++KSG  ++K    +L + I    N+R           + PFV+VH
Sbjct:  1055 GLARPKYLERLTSTLKKSGMTVTKRGKKNLGNEI----NNRG---IEELKAVMLPFVHVH 1107

Query:   342 KGTVLQESLPGLRHSVVILQPDEFQKRLCKAVE-----GVKSFVELNYCXXXXXXXXXXX 396
             KG++LQ SLPGLR  VV+L P E Q+R+ +++E       K+  E  +            
Sbjct:  1108 KGSILQSSLPGLRECVVVLNPPELQRRVLESIEVTHNRKTKNVFETEHKLSLVSVHPSLV 1167

Query:   397 XQQFF---ESFDVDSAKLARLK---LDPEAGIKTRFLLILLELST--NEKVLVFSQYIEP 448
              +      E   +D A LA+LK   LDP   +KTRFL+  +EL     EKVLVFSQYI+P
Sbjct:  1168 SRCKISEKERLSIDEALLAQLKKVRLDPNQSVKTRFLMEFVELCEVIKEKVLVFSQYIDP 1227

Query:   449 LTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGI 508
             L LIM+ L  RF W  G+EVLYM GK + K+RQ+ IN  NDP S+A++ LASTKAC EGI
Sbjct:  1228 LKLIMKHLVSRFKWNPGEEVLYMHGKLEQKQRQTLINEFNDPKSKAKVFLASTKACSEGI 1287

Query:   509 NLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVW 568
             +LVGASRV+LLDVVWNP VERQAISRAYR+GQKR+V+ YHL+   T E  K  +QA+K  
Sbjct:  1288 SLVGASRVILLDVVWNPAVERQAISRAYRIGQKRIVYTYHLVAKGTPEGPKYCKQAQKDR 1347

Query:   569 WSNMVFPSSDGGGNDQTTASEPL-EDKILEEMAQLYNNPSETLINAIIPQPKETELIETF 627
              S +VF  S      +   +E + EDK+L+ M + ++   +   N I+ QPKE +L+E F
Sbjct:  1348 ISELVFACSSRHDKGKEKIAEAVTEDKVLDTMVE-HSKLGDMFDNLIV-QPKEADLVEGF 1405
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2087223 CHR40 "chromatin remodeling 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149957 CHR42 "chromatin remodeling 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096499 CHR38 "chromatin remodeling 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050039 CHR34 "chromatin remodeling 34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042619 DRD1 "DEFECTIVE IN RNA-DIRECTED DNA METHYLATION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B4NXB8 okr "DNA repair and recombination protein RAD54-like" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-968 rad54l "RAD54-like (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C963 RAD54L2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBD4 RAD54L "DNA repair and recombination protein RAD54-like" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query635
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 5e-38
pfam00176301 pfam00176, SNF2_N, SNF2 family N-terminal domain 1e-19
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 2e-19
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 5e-14
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-12
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-11
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 3e-11
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 5e-08
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 1e-04
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information 
 Score =  150 bits (380), Expect = 5e-38
 Identities = 134/554 (24%), Positives = 218/554 (39%), Gaps = 94/554 (16%)

Query: 60  ELVPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGL 119
              P D+  ++ P+Q EG  ++          + L+++       G I++   G GKT  
Sbjct: 329 APEPVDLSAELRPYQLEGVNWLS---------ELLRSN-----LLGGILADDMGLGKTVQ 374

Query: 120 TLVFL-QAYMKLHPRCRPV-IIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGA 177
           T+  L      +     P  I+ P S+L  W+ EF+K+  D+           G+++   
Sbjct: 375 TIALLLSLLESIKVYLGPALIVVPASLLSNWKREFEKFAPDLRLV----LVYHGEKSELD 430

Query: 178 VALMDNRKRGRGKVGLI--RYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGL 235
                 R   +  + +I    +  Y              L   LV    L  I  D    
Sbjct: 431 KKREALRDLLKLHLVIIFDVVITTYEL------------LRRFLVDHGGLKKIEWDRV-- 476

Query: 236 FVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQE--FGEVL 293
            V DE H  +ND +   KAL  +K   R+ L+GTP +N   EL + L         G   
Sbjct: 477 -VLDEAHRIKNDQSSEGKALQFLKALNRLDLTGTPLENRLGELWSLLQEFLNPGLLGTSF 535

Query: 294 RT-VRKSGREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPFVN--VHKGTVLQESL 350
               R   + I   +    + +         +  ++ L++ ++PF+     +   + + L
Sbjct: 536 AIFTRLFEKPIQAEEDIGPLEA--------RELGIELLRKLLSPFILRRTKEDVEVLKEL 587

Query: 351 PGLRHSVVILQPDEFQKRLCKAV----------------EGVKSFVELNYCVSLLSV--- 391
           P     V+  +  E Q+ L +A+                         +  +++L++   
Sbjct: 588 PPKIEKVLECELSEEQRELYEALLEGAEKNQQLLEDLEKADSDENRIGDSELNILALLTR 647

Query: 392 ------HPSLLPQQFFESFDVDSAKLA-------RLKLDPEAGIKTRFLL------ILLE 432
                 HP+L+ +    +FD     L          K   +        L       LLE
Sbjct: 648 LRQICNHPALVDEGLEATFDRIVLLLREDKDFDYLKKPLIQLSKGKLQALDELLLDKLLE 707

Query: 433 LSTNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSS 492
                KVL+FSQ+   L L+ + L+       G + + +DG    K+RQ  I+  N    
Sbjct: 708 EGHYHKVLIFSQFTPVLDLLEDYLKAL-----GIKYVRLDGSTPAKRRQELIDRFNADEE 762

Query: 493 QARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITS 552
           + ++ L S KA   G+NL GA  V+L D  WNP VE QAI RA+R+GQKR V VY LIT 
Sbjct: 763 E-KVFLLSLKAGGLGLNLTGADTVILFDPWWNPAVELQAIDRAHRIGQKRPVKVYRLITR 821

Query: 553 ETLEWDKLRRQARK 566
            T+E   L  Q +K
Sbjct: 822 GTIEEKILELQEKK 835

Length = 866
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 635
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
KOG0387 923 consensus Transcription-coupled repair protein CSB 100.0
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 100.0
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 100.0
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 100.0
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 100.0
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 100.0
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 100.0
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 100.0
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 100.0
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 100.0
KOG1002791 consensus Nucleotide excision repair protein RAD16 100.0
KOG4439901 consensus RNA polymerase II transcription terminat 100.0
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 100.0
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 100.0
KOG1001674 consensus Helicase-like transcription factor HLTF/ 100.0
KOG0383696 consensus Predicted helicase [General function pre 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
KOG02981394 consensus DEAD box-containing helicase-like transc 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 100.0
KOG0354 746 consensus DEAD-box like helicase [General function 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 99.97
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.96
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 99.96
PTZ00110545 helicase; Provisional 99.96
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 99.96
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 99.96
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.96
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.96
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.96
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.96
PTZ00424401 helicase 45; Provisional 99.95
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.95
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.95
KOG1123776 consensus RNA polymerase II transcription initiati 99.95
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 99.94
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.94
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.94
PRK13767 876 ATP-dependent helicase; Provisional 99.94
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 99.93
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.93
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.93
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.93
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.93
PRK02362 737 ski2-like helicase; Provisional 99.92
PRK10689 1147 transcription-repair coupling factor; Provisional 99.91
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.91
PRK01172 674 ski2-like helicase; Provisional 99.9
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 99.9
COG4096 875 HsdR Type I site-specific restriction-modification 99.9
PRK00254 720 ski2-like helicase; Provisional 99.9
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.9
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.89
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 99.89
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.88
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.87
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.86
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 99.86
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 99.85
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.85
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.85
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 99.85
COG4889 1518 Predicted helicase [General function prediction on 99.84
KOG0343 758 consensus RNA Helicase [RNA processing and modific 99.84
PHA02653675 RNA helicase NPH-II; Provisional 99.84
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.83
COG1204 766 Superfamily II helicase [General function predicti 99.83
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.83
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 99.82
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 99.82
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 99.82
COG1205 851 Distinct helicase family with a unique C-terminal 99.82
PRK09401 1176 reverse gyrase; Reviewed 99.81
KOG4284 980 consensus DEAD box protein [Transcription] 99.81
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 99.79
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.79
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.78
PRK05580679 primosome assembly protein PriA; Validated 99.78
COG1202 830 Superfamily II helicase, archaea-specific [General 99.78
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.77
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.77
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 99.76
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.76
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.76
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.75
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.75
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.75
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.75
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.75
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.74
PRK09694 878 helicase Cas3; Provisional 99.73
KOG0347731 consensus RNA helicase [RNA processing and modific 99.73
PRK14701 1638 reverse gyrase; Provisional 99.72
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.71
KOG0346569 consensus RNA helicase [RNA processing and modific 99.71
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.71
KOG0334 997 consensus RNA helicase [RNA processing and modific 99.68
KOG0327397 consensus Translation initiation factor 4F, helica 99.67
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.64
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.63
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.63
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.62
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.62
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.62
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.61
smart00487201 DEXDc DEAD-like helicases superfamily. 99.6
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.59
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.59
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.58
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.57
PRK05298652 excinuclease ABC subunit B; Provisional 99.57
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.55
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.55
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.55
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.53
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.53
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.52
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.5
smart0049082 HELICc helicase superfamily c-terminal domain. 99.5
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.5
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.5
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.43
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 99.38
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 99.36
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.31
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.29
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.24
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.21
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.17
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.14
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.09
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.09
COG0610 962 Type I site-specific restriction-modification syst 99.09
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.06
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.06
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.04
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 99.0
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 98.98
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.91
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.88
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 98.87
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 98.87
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.86
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.83
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.83
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.82
PRK15483 986 type III restriction-modification system StyLTI en 98.8
PF11496297 HDA2-3: Class II histone deacetylase complex subun 98.74
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.72
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 98.71
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.68
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.66
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 98.66
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 98.64
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.63
PF13871278 Helicase_C_4: Helicase_C-like 98.58
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.57
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.56
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.56
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.56
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 98.53
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 98.53
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.45
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 98.42
PRK14873665 primosome assembly protein PriA; Provisional 98.31
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.18
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.95
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 97.95
PRK10536262 hypothetical protein; Provisional 97.73
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.72
KOG1131 755 consensus RNA polymerase II transcription initiati 97.59
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.55
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.47
KOG1803649 consensus DNA helicase [Replication, recombination 97.46
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 97.39
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 97.21
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.19
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.16
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.16
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 97.16
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.15
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.15
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.92
PRK04296190 thymidine kinase; Provisional 96.82
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.77
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.74
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.67
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.56
PF1324576 AAA_19: Part of AAA domain 96.42
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.4
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 96.37
PRK06526254 transposase; Provisional 96.37
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 96.35
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.32
PLN03025319 replication factor C subunit; Provisional 96.28
PRK14088440 dnaA chromosomal replication initiation protein; P 96.19
smart00382148 AAA ATPases associated with a variety of cellular 96.16
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.13
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.13
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.05
PRK00149450 dnaA chromosomal replication initiation protein; R 96.02
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 96.0
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.88
PRK14087450 dnaA chromosomal replication initiation protein; P 95.85
PRK08084235 DNA replication initiation factor; Provisional 95.81
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 95.8
CHL00181287 cbbX CbbX; Provisional 95.74
PRK12402337 replication factor C small subunit 2; Reviewed 95.72
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.72
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.68
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 95.66
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.65
PHA02533534 17 large terminase protein; Provisional 95.61
PRK07952244 DNA replication protein DnaC; Validated 95.59
PRK08116268 hypothetical protein; Validated 95.57
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 95.57
PF13173128 AAA_14: AAA domain 95.56
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.55
TIGR02928365 orc1/cdc6 family replication initiation protein. M 95.5
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 95.49
PRK09112351 DNA polymerase III subunit delta'; Validated 95.49
TIGR00376637 DNA helicase, putative. The gene product may repre 95.46
KOG18051100 consensus DNA replication helicase [Replication, r 95.42
PRK08727233 hypothetical protein; Validated 95.4
PRK14086617 dnaA chromosomal replication initiation protein; P 95.2
PRK14974336 cell division protein FtsY; Provisional 95.15
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.07
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.01
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.97
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 94.93
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 94.92
smart00492141 HELICc3 helicase superfamily c-terminal domain. 94.92
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 94.92
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.92
PRK12422445 chromosomal replication initiation protein; Provis 94.84
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.83
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.83
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.76
PRK08181269 transposase; Validated 94.73
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.72
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.71
PRK06893229 DNA replication initiation factor; Validated 94.69
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.69
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.66
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.66
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 94.59
PRK07940394 DNA polymerase III subunit delta'; Validated 94.58
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 94.49
PRK06921266 hypothetical protein; Provisional 94.48
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.47
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 94.43
PTZ001121164 origin recognition complex 1 protein; Provisional 94.39
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 94.36
PRK05642234 DNA replication initiation factor; Validated 94.32
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.26
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.2
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.19
PRK13889988 conjugal transfer relaxase TraA; Provisional 94.17
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.06
PRK00440319 rfc replication factor C small subunit; Reviewed 94.01
PRK06835329 DNA replication protein DnaC; Validated 93.99
PRK05707328 DNA polymerase III subunit delta'; Validated 93.94
PRK06871325 DNA polymerase III subunit delta'; Validated 93.93
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 93.9
PRK04195482 replication factor C large subunit; Provisional 93.85
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 93.84
PRK08769319 DNA polymerase III subunit delta'; Validated 93.81
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 93.74
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.72
PRK12377248 putative replication protein; Provisional 93.71
PHA02544316 44 clamp loader, small subunit; Provisional 93.67
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.66
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.65
PRK11823446 DNA repair protein RadA; Provisional 93.63
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 93.63
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 93.58
PF00004132 AAA: ATPase family associated with various cellula 93.57
PRK09183259 transposase/IS protein; Provisional 93.49
COG0552340 FtsY Signal recognition particle GTPase [Intracell 93.41
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 93.39
PRK07471365 DNA polymerase III subunit delta'; Validated 93.31
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 93.3
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.22
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 93.2
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 93.19
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 93.12
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 93.11
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.09
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.02
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 93.02
PRK07993334 DNA polymerase III subunit delta'; Validated 93.0
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.98
COG0593408 DnaA ATPase involved in DNA replication initiation 92.85
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 92.82
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.78
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 92.75
PRK13342413 recombination factor protein RarA; Reviewed 92.73
PRK08058329 DNA polymerase III subunit delta'; Validated 92.43
PRK10865 857 protein disaggregation chaperone; Provisional 92.4
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 92.37
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 92.33
PRK03992389 proteasome-activating nucleotidase; Provisional 92.32
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.31
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 92.3
PRK08939306 primosomal protein DnaI; Reviewed 92.26
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 92.14
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 92.07
PRK08760476 replicative DNA helicase; Provisional 92.01
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 91.99
PRK08903227 DnaA regulatory inactivator Hda; Validated 91.98
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 91.96
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 91.95
PRK06090319 DNA polymerase III subunit delta'; Validated 91.93
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 91.88
PRK09165497 replicative DNA helicase; Provisional 91.87
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 91.85
CHL00095821 clpC Clp protease ATP binding subunit 91.79
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 91.7
PRK00771437 signal recognition particle protein Srp54; Provisi 91.69
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 91.66
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 91.65
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 91.62
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 91.57
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 91.54
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 91.52
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 91.52
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 91.51
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.5
KOG0734752 consensus AAA+-type ATPase containing the peptidas 91.18
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 91.17
PRK13826 1102 Dtr system oriT relaxase; Provisional 91.12
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 91.11
PHA03368738 DNA packaging terminase subunit 1; Provisional 91.0
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 90.97
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 90.93
PRK06904472 replicative DNA helicase; Validated 90.88
PF02702211 KdpD: Osmosensitive K+ channel His kinase sensor d 90.83
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 90.71
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 90.6
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 90.57
TIGR00595 505 priA primosomal protein N'. All proteins in this f 90.32
PRK08506472 replicative DNA helicase; Provisional 90.29
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 90.28
PRK13341 725 recombination factor protein RarA/unknown domain f 90.25
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 90.21
PRK10416318 signal recognition particle-docking protein FtsY; 90.06
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 89.95
cd03115173 SRP The signal recognition particle (SRP) mediates 89.93
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 89.83
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 89.62
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 89.57
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 89.55
CHL00176638 ftsH cell division protein; Validated 89.37
TIGR00665434 DnaB replicative DNA helicase. This model describe 89.34
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 89.27
PRK13833323 conjugal transfer protein TrbB; Provisional 89.17
PRK11054684 helD DNA helicase IV; Provisional 89.05
PRK06964342 DNA polymerase III subunit delta'; Validated 88.95
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 88.95
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 88.94
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 88.93
PRK05580 679 primosome assembly protein PriA; Validated 88.68
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 88.65
PRK08840464 replicative DNA helicase; Provisional 88.65
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 88.63
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 88.53
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 88.28
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 88.19
PHA00012361 I assembly protein 88.18
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 88.16
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 87.96
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 87.95
PRK05748448 replicative DNA helicase; Provisional 87.95
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 87.95
PRK04132846 replication factor C small subunit; Provisional 87.93
PRK05973237 replicative DNA helicase; Provisional 87.93
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 87.91
PRK07004460 replicative DNA helicase; Provisional 87.8
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 87.79
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 87.78
COG3973747 Superfamily I DNA and RNA helicases [General funct 87.77
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 87.74
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 87.74
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 87.71
TIGR00064272 ftsY signal recognition particle-docking protein F 87.68
PRK06620214 hypothetical protein; Validated 87.68
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 87.38
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 87.34
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 87.28
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 87.23
PHA03372668 DNA packaging terminase subunit 1; Provisional 87.15
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 87.1
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 86.83
TIGR02012321 tigrfam_recA protein RecA. This model describes or 86.8
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 86.78
TIGR00959428 ffh signal recognition particle protein. This mode 86.68
KOG0780483 consensus Signal recognition particle, subunit Srp 86.56
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 86.51
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 86.42
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 86.42
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 86.36
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 86.34
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 86.26
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 86.16
PRK05636505 replicative DNA helicase; Provisional 86.08
PRK07399314 DNA polymerase III subunit delta'; Validated 86.05
PRK10867433 signal recognition particle protein; Provisional 86.02
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 86.0
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 85.97
PRK08006471 replicative DNA helicase; Provisional 85.84
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 85.72
PRK05595444 replicative DNA helicase; Provisional 85.57
COG0470325 HolB ATPase involved in DNA replication [DNA repli 85.51
TIGR00767415 rho transcription termination factor Rho. Members 85.49
PHA02542473 41 41 helicase; Provisional 85.41
CHL00206 2281 ycf2 Ycf2; Provisional 85.37
PRK10490 895 sensor protein KdpD; Provisional 85.17
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 85.1
COG3972660 Superfamily I DNA and RNA helicases [General funct 85.05
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 85.01
PRK06067234 flagellar accessory protein FlaH; Validated 84.99
PRK10689 1147 transcription-repair coupling factor; Provisional 84.86
PRK06321472 replicative DNA helicase; Provisional 84.72
PRK08699325 DNA polymerase III subunit delta'; Validated 84.72
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 84.67
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 84.54
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 84.53
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 84.42
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 84.06
PHA00350399 putative assembly protein 84.02
COG1198 730 PriA Primosomal protein N' (replication factor Y) 84.01
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 83.85
PRK04328249 hypothetical protein; Provisional 83.84
PRK14873 665 primosome assembly protein PriA; Provisional 83.47
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 83.42
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 83.24
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 83.18
PRK09354349 recA recombinase A; Provisional 83.13
PRK09087226 hypothetical protein; Validated 83.08
PRK05564313 DNA polymerase III subunit delta'; Validated 82.72
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 82.67
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 82.6
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 82.51
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 82.35
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 81.97
PRK07773 886 replicative DNA helicase; Validated 81.92
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 81.8
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 81.5
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 81.28
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 81.0
COG2842297 Uncharacterized ATPase, putative transposase [Gene 80.91
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 80.57
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-92  Score=719.22  Aligned_cols=447  Identities=28%  Similarity=0.327  Sum_probs=392.4

Q ss_pred             cChhHH-hcccHHHHHHHHHHHHhhhCCcccccccccCCCCCCCceEEeCCCCchHHHHHHHHHHHHHH-hCCCCCcEEE
Q 006698           62 VPRDVR-KKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMK-LHPRCRPVII  139 (635)
Q Consensus        62 ~p~~l~-~~L~p~Q~~~v~~l~~~~~~~~~~~~~~~~~~~~~~~g~iLad~~GlGKT~~ai~~i~~~~~-~~~~~~~LIv  139 (635)
                      .|..++ ..|||||.+|++|+...+..|+               +|||||+||+|||+|+|+++.++.. .+..+|.||+
T Consensus       159 sP~~v~~g~lr~YQveGlnWLi~l~engi---------------ngILaDEMGLGKTlQtIs~l~yl~~~~~~~GPfLVi  223 (971)
T KOG0385|consen  159 SPSYVKGGELRDYQLEGLNWLISLYENGI---------------NGILADEMGLGKTLQTISLLGYLKGRKGIPGPFLVI  223 (971)
T ss_pred             CchhhcCCccchhhhccHHHHHHHHhcCc---------------ccEeehhcccchHHHHHHHHHHHHHhcCCCCCeEEE
Confidence            566777 8999999999999999887754               8999999999999999999987766 4456788999


Q ss_pred             eCccchHHHHHHHHHhcCCCcccccCCCCCcCcccchhhHhHhhhhcCCCccceeeeeeeeccccCCCeEEeeHHHHHHh
Q 006698          140 APRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKL  219 (635)
Q Consensus       140 ~P~~l~~qW~~E~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvi~ty~~~~~~  219 (635)
                      ||.|++.||.+||.+|.|+++++.+.|....     +. .......                ....++|+||||++..+.
T Consensus       224 ~P~StL~NW~~Ef~rf~P~l~~~~~~Gdk~e-----R~-~~~r~~~----------------~~~~fdV~iTsYEi~i~d  281 (971)
T KOG0385|consen  224 APKSTLDNWMNEFKRFTPSLNVVVYHGDKEE-----RA-ALRRDIM----------------LPGRFDVCITSYEIAIKD  281 (971)
T ss_pred             eeHhhHHHHHHHHHHhCCCcceEEEeCCHHH-----HH-HHHHHhh----------------ccCCCceEeehHHHHHhh
Confidence            9999999999999999999999998874311     11 1111110                123789999999998775


Q ss_pred             hcchhhhhhhccCCCEEEEeCCCcCCCcccHHHHHHHhcccCcEEEEecccCCCChhhHHHHHHhhhhhhhhhHHHHHhh
Q 006698          220 VSGDELSGILLDLPGLFVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKS  299 (635)
Q Consensus       220 ~~~~~~~~~~~~~~~~vIvDEaH~~kn~~s~~~~~l~~l~~~~~l~LTgTP~~n~~~el~~ll~~l~p~~~~~~~~~~~~  299 (635)
                      .+  .   +..-.|.++||||||++||.+|.+++.++.+.+.+|+++||||+||++.|||++|+|+.|.+|++.+.|..|
T Consensus       282 k~--~---lk~~~W~ylvIDEaHRiKN~~s~L~~~lr~f~~~nrLLlTGTPLQNNL~ELWaLLnFllPdiF~~~e~F~sw  356 (971)
T KOG0385|consen  282 KS--F---LKKFNWRYLVIDEAHRIKNEKSKLSKILREFKTDNRLLLTGTPLQNNLHELWALLNFLLPDIFNSAEDFDSW  356 (971)
T ss_pred             HH--H---HhcCCceEEEechhhhhcchhhHHHHHHHHhcccceeEeeCCcccccHHHHHHHHHhhchhhccCHHHHHHH
Confidence            42  2   334469999999999999999999999999999999999999999999999999999999999999888777


Q ss_pred             hhhhhHhhhhhhhhhhhhccCcCcHHHHHHHHHhhcchhhhcccccccccCCCceEEEEEeCCcHHHHHHHHHHhhh---
Q 006698          300 GREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGV---  376 (635)
Q Consensus       300 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~rr~~~~~~~~lp~~~~~~v~~~~s~~q~~~y~~~~~~---  376 (635)
                      +...               ....+.+.+.+|+..++||++||.+.++...||++.+..+++.|+..|++.|..+...   
T Consensus       357 F~~~---------------~~~~~~e~v~~Lh~vL~pFlLRR~K~dVe~sLppKkE~~iyvgms~mQkk~Y~~iL~kdl~  421 (971)
T KOG0385|consen  357 FDFT---------------NCEGDQELVSRLHKVLRPFLLRRIKSDVEKSLPPKKELIIYVGMSSMQKKWYKAILMKDLD  421 (971)
T ss_pred             Hccc---------------ccccCHHHHHHHHhhhhHHHHHHHHHhHhhcCCCcceeeEeccchHHHHHHHHHHHHhcch
Confidence            6432               1114455789999999999999999999999999999999999999999999998652   


Q ss_pred             ----------hhHHHHHHHHhhhcCCCCCCCcccc-ccCccchHHHhhcccCccccchHHHHHHHHHhc--CCCeEEEEc
Q 006698          377 ----------KSFVELNYCVSLLSVHPSLLPQQFF-ESFDVDSAKLARLKLDPEAGIKTRFLLILLELS--TNEKVLVFS  443 (635)
Q Consensus       377 ----------~~~~~~~~~~~~~~~~p~l~~~~~~-~~~~~~~~~l~~~~~~~~~s~K~~~l~~~l~~~--~~~kviIFs  443 (635)
                                ....+..+.+|+||+||+|+.+..+ .++..+...       ...|+|+..|..+|...  .|+||||||
T Consensus       422 ~~n~~~~~~k~kL~NI~mQLRKccnHPYLF~g~ePg~pyttdehL-------v~nSGKm~vLDkLL~~Lk~~GhRVLIFS  494 (971)
T KOG0385|consen  422 ALNGEGKGEKTKLQNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHL-------VTNSGKMLVLDKLLPKLKEQGHRVLIFS  494 (971)
T ss_pred             hhcccccchhhHHHHHHHHHHHhcCCccccCCCCCCCCCCcchHH-------HhcCcceehHHHHHHHHHhCCCeEEEeH
Confidence                      2567788999999999999999665 333333322       23589999999999877  999999999


Q ss_pred             CChhHHHHHHHHHHhhhcccCCceEEEEeCCCCHHHHHHHHHHhcCCCCCcEEEEEccCCcccccccccCCeEEEeCCCC
Q 006698          444 QYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVW  523 (635)
Q Consensus       444 ~~~~~~~~l~~~L~~~~~~~~g~~~~~i~G~~~~~~r~~~i~~F~~~~~~~~vll~st~~~~~GlnL~~a~~vi~~d~~w  523 (635)
                      |++.++|+|++++.-+     |+.|++|+|+++.++|...|+.||.+++...||++||+|||.||||+.|++||+||.+|
T Consensus       495 Qmt~mLDILeDyc~~R-----~y~ycRiDGSt~~eeR~~aI~~fn~~~s~~FiFlLSTRAGGLGINL~aADtVIlyDSDW  569 (971)
T KOG0385|consen  495 QMTRMLDILEDYCMLR-----GYEYCRLDGSTSHEEREDAIEAFNAPPSEKFIFLLSTRAGGLGINLTAADTVILYDSDW  569 (971)
T ss_pred             HHHHHHHHHHHHHHhc-----CceeEeecCCCCcHHHHHHHHhcCCCCcceEEEEEeccccccccccccccEEEEecCCC
Confidence            9999999999999887     99999999999999999999999998888999999999999999999999999999999


Q ss_pred             ChhhHHhhhhhhhhcCCcceEEEEEEEeCCChHHHHHHHHHHhhhhhccccccC
Q 006698          524 NPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSS  577 (635)
Q Consensus       524 np~~~~Qa~gR~~R~GQ~~~V~vy~li~~~tiEe~i~~~~~~K~~~~~~~~~~~  577 (635)
                      ||..+.||.+|+|||||+|+|.||||++++|||++|++++..|.++.+.|++..
T Consensus       570 NPQ~DLQAmDRaHRIGQ~K~V~V~RLitentVEe~IveRA~~KL~Ld~~VIq~g  623 (971)
T KOG0385|consen  570 NPQVDLQAMDRAHRIGQKKPVVVYRLITENTVEEKIVERAAAKLRLDKLVIQQG  623 (971)
T ss_pred             CchhhhHHHHHHHhhCCcCceEEEEEeccchHHHHHHHHHHHHhchhhhhhccC
Confidence            999999999999999999999999999999999999999999999999999876

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK07773 replicative DNA helicase; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query635
1z3i_X644 Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMA 4e-39
3mwy_W800 Crystal Structure Of The Chromodomain-atpase Portio 1e-17
1z63_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 5e-13
1z6a_A500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 7e-13
1z5z_A271 Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal 9e-13
>pdb|1Z3I|X Chain X, Structure Of The Swi2SNF2 CHROMATIN REMODELING DOMAIN OF EUKARYOTIC Rad54 Length = 644 Back     alignment and structure 
Iteration: 1

 Score =  159 bits (403), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 145/556 (26%), Positives = 236/556 (42%), Gaps = 111/556 (19%)
Query: 68  KKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAY 127
           K + PHQREG +F+W  + G      ++NS       GCI++   G GKT   +  +   
Sbjct: 54  KVLRPHQREGVKFLWDCVTG----RRIENSY------GCIMADEMGLGKTLQCITLIWTL 103
Query: 128 MKLHPRCRP-----VIIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNGAVALMD 182
           +K  P C+P     ++++P S++  W  E  KW             L G+    A+   D
Sbjct: 104 LKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKW-------------LGGRVQPVAI---D 147
Query: 183 NRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLF----EKLVSGDELSGILLDLPGLFVF 238
              +      L+ ++     ++ T IL +SY  F    E L  G           GL + 
Sbjct: 148 GGSKDEIDSKLVNFISQQGMRIPTPILIISYETFRLHAEVLHKGK---------VGLVIC 198
Query: 239 DEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVR-------QEFGE 291
           DEGH  +N D   + AL+ +  +RR+++SGTP QN+  E  + +  V        QEF +
Sbjct: 199 DEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAQEFKK 258
Query: 292 VLRTVRKSGREISKA---------KHASLISSIGRCANHRDDXXXXXXXXXIAPFVNVHK 342
                   GR+   +         K   LIS + RC   R                    
Sbjct: 259 RFEIPILKGRDADASDKDRAAGEQKLQELISIVNRCLIRR-------------------T 299
Query: 343 GTVLQESLPGLRHSVVILQPDEFQKRL-------CKAVEGVKS-------------FVEL 382
             +L + LP     VV       QK L        K VE +++               +L
Sbjct: 300 SDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKKL 359
Query: 383 NYCXXXXXXXXXXXXQQFFESFDVDSAKLARLKLDPEAGIKT---RFLLILLELSTNEKV 439
                          + F  + D+     +   ++P+   K     ++L +   +T++KV
Sbjct: 360 CNHPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKV 419
Query: 440 LVFSQYIEPLTLIMEQLRHRFNWREGQEVLY--MDGKQDVKKRQSSINVLNDPSSQARIM 497
           ++ S Y + L L  +  R+R         LY  +DG   +KKR   +   N+PSS   I 
Sbjct: 420 VLVSNYTQTLDLFEKLCRNR-------RYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIF 472
Query: 498 LASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEW 557
           + S+KA   G+NL+GA+R+V+ D  WNP  + QA++R +R GQK+  ++Y L+++ T+E 
Sbjct: 473 MLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEE 532
Query: 558 DKLRRQARKVWWSNMV 573
             L+RQA K   S+ V
Sbjct: 533 KILQRQAHKKALSSCV 548
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z5Z|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE C-Terminal Domain Length = 271 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query635
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 6e-64
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 1e-47
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-40
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-39
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 3e-36
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 9e-17
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 7e-12
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
 Score =  221 bits (566), Expect = 6e-64
 Identities = 145/577 (25%), Positives = 241/577 (41%), Gaps = 103/577 (17%)

Query: 62  VPRDVRKKMFPHQREGFEFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTL 121
           V   + K + PHQREG +F+W          +           GCI++   G GKT   +
Sbjct: 48  VDPVLSKVLRPHQREGVKFLW----------DCVTGRRIENSYGCIMADEMGLGKTLQCI 97

Query: 122 VFLQAYMKLHPRCRPV-----IIAPRSMLLTWEEEFKKWGIDIPFYNLNKPELSGKENNG 176
             +   +K  P C+P      +++P S++  W  E  KW               G     
Sbjct: 98  TLIWTLLKQSPDCKPEIDKVIVVSPSSLVRNWYNEVGKW--------------LGGRVQ- 142

Query: 177 AVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLP-GL 235
               +D   +      L+ ++     ++ T IL +SY   E        + +L     GL
Sbjct: 143 -PVAIDGGSKDEIDSKLVNFISQQGMRIPTPILIISY---ETFRL---HAEVLHKGKVGL 195

Query: 236 FVFDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLV---------- 285
            + DEGH  +N D   + AL+ +  +RR+++SGTP QN+  E     SLV          
Sbjct: 196 VICDEGHRLKNSDNQTYLALNSMNAQRRVLISGTPIQNDLLEY---FSLVHFVNSGILGT 252

Query: 286 RQEFGEVLRTVRKSGREISKAKHASLISSIGRCANHRDDEKLKELKEKIAPF----VNVH 341
            QEF +        GR+   +                 ++KL+EL   +        +  
Sbjct: 253 AQEFKKRFEIPILKGRDADASDKDRAAG----------EQKLQELISIVNRCLIRRTS-- 300

Query: 342 KGTVLQESLPGLRHSVVILQPDEFQKRLCKAV-----------EGVKSFVELNYCVSL-- 388
              +L + LP     VV       QK L K              G  S   L+   SL  
Sbjct: 301 --DILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKK 358

Query: 389 LSVHPSLL-------PQQFFESFDVDSAKLARLKLDPEAGIKTRFLLILLEL---STNEK 438
           L  HP+L+        + F  + D+     +   ++P+   K   L  +L +   +T++K
Sbjct: 359 LCNHPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDK 418

Query: 439 VLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIML 498
           V++ S Y + L L  +  R+R         + +DG   +KKR   +   N+PSS   I +
Sbjct: 419 VVLVSNYTQTLDLFEKLCRNR-----RYLYVRLDGTMSIKKRAKIVERFNNPSSPEFIFM 473

Query: 499 ASTKA--CCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLE 556
            S+KA  C  G+NL+GA+R+V+ D  WNP  + QA++R +R GQK+  ++Y L+++ T+E
Sbjct: 474 LSSKAGGC--GLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIE 531

Query: 557 WDKLRRQARKVWWSNMVFPSSDGGGNDQTTASEPLED 593
              L+RQA K   S+ V    +    ++  +   L +
Sbjct: 532 EKILQRQAHKKALSSCVV--DEEQDVERHFSLGELRE 566
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query635
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.98
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.97
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.97
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 99.97
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 99.97
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.97
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.96
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.96
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.96
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.96
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.96
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.96
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 99.95
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.94
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.94
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.94
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.94
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.93
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.93
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.92
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.91
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.88
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.85
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.84
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.83
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.83
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.83
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.82
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.82
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.82
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.82
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.82
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.82
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.82
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.8
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.8
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.78
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.78
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.78
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.78
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.77
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.77
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.77
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.59
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.74
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.73
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.73
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.72
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.71
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.71
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.7
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.7
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.68
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.67
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.67
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.66
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.66
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.65
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.65
3bor_A237 Human initiation factor 4A-II; translation initiat 99.64
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.63
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.61
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.6
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.57
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.55
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.42
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.32
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.26
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.03
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.82
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.38
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.79
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.57
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 97.56
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.54
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.5
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.28
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.27
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.24
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.23
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 97.08
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.91
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 96.77
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.42
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 96.41
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.39
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.28
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.24
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.19
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.06
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.04
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.02
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.81
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.67
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.65
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 95.5
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.5
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 95.43
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.37
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.35
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 95.35
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.27
3bos_A242 Putative DNA replication factor; P-loop containing 95.11
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.96
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.95
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.82
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.55
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.5
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 94.49
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 94.45
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.42
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.37
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 94.27
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.27
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 94.15
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.95
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.84
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.74
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.62
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 93.5
3co5_A143 Putative two-component system transcriptional RES 92.91
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.84
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.83
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 92.74
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.55
2gno_A305 DNA polymerase III, gamma subunit-related protein; 92.55
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 92.41
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 92.23
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.21
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 91.74
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 91.64
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 91.6
2chq_A319 Replication factor C small subunit; DNA-binding pr 91.53
2v1u_A387 Cell division control protein 6 homolog; DNA repli 91.51
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 91.4
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.2
3pvs_A447 Replication-associated recombination protein A; ma 91.19
3io5_A333 Recombination and repair protein; storage dimer, i 91.18
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 91.17
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 91.15
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 91.11
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.02
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 91.0
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 90.59
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 90.54
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.45
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 89.76
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 89.67
2kjq_A149 DNAA-related protein; solution structure, NESG, st 89.6
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 89.46
1ojl_A304 Transcriptional regulatory protein ZRAR; response 89.41
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 89.17
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 88.46
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 88.19
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 88.04
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 87.75
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 86.93
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 86.72
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 86.69
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 86.68
2cvh_A220 DNA repair and recombination protein RADB; filamen 86.22
1xp8_A366 RECA protein, recombinase A; recombination, radior 86.18
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 84.98
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 84.96
1vma_A306 Cell division protein FTSY; TM0570, structural gen 84.89
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 84.53
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 84.07
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 83.92
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 83.76
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 83.73
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 83.35
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 82.48
1u94_A356 RECA protein, recombinase A; homologous recombinat 82.04
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 81.65
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.4e-78  Score=687.13  Aligned_cols=517  Identities=21%  Similarity=0.293  Sum_probs=390.2

Q ss_pred             cccCCCCCCCCcchhhhhhcCCCC---CccccccCC--CCCCCCCCCCCCCCcCCCCceeeecChh-HHhcccHHHHHHH
Q 006698            5 KDIDPPFATSPSRRAEWREYNNVD---PSFLDDLNS--RDSGFDSQTGCDPFTHAQGTVWELVPRD-VRKKMFPHQREGF   78 (635)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~p~~-l~~~L~p~Q~~~v   78 (635)
                      .+|++||..+||+.++|+....+.   .+.++.+..  ................+........|+. ...+|||||++|+
T Consensus       166 ~~yLvKW~~L~y~~~tWe~~~~~~~~~~~~i~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~Lr~yQ~egv  245 (800)
T 3mwy_W          166 LQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKILPQYSSNYTSQRPRFEKLSVQPPFIKGGELRDFQLTGI  245 (800)
T ss_dssp             CBCCEEETTSCSTTCBCCBHHHHTTTCHHHHHHHHHTTTCTTCSTTCCCCCSCCCCCCCCSSCCTTCCSSCCCTHHHHHH
T ss_pred             eEEEEEecCCCcccccccchhhhhhhhHHHHHHHHHhhhcccCCcchhcccccCCcccccccCCCccCCCCcCHHHHHHH
Confidence            479999999999999998875321   122222211  0000000000001111111112223322 3568999999999


Q ss_pred             HHHHHhhhCCcccccccccCCCCCCCceEEeCCCCchHHHHHHHHHHHHHHh-CCCCCcEEEeCccchHHHHHHHHHhcC
Q 006698           79 EFIWKNIAGGIDLDELKNSTSTGGGNGCIISHAPGTGKTGLTLVFLQAYMKL-HPRCRPVIIAPRSMLLTWEEEFKKWGI  157 (635)
Q Consensus        79 ~~l~~~~~~~~~~~~~~~~~~~~~~~g~iLad~~GlGKT~~ai~~i~~~~~~-~~~~~~LIv~P~~l~~qW~~E~~~~~~  157 (635)
                      +||+..+..               ++||||||+||+|||+++++++..++.. ...+++|||||.+++.||.+|+.+|+|
T Consensus       246 ~~l~~~~~~---------------~~~~ILademGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~~E~~~~~p  310 (800)
T 3mwy_W          246 NWMAFLWSK---------------GDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAP  310 (800)
T ss_dssp             HHHHHHHTT---------------TCCEEECCCTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHHHHHHHHST
T ss_pred             HHHHHHhhc---------------CCCEEEEeCCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHHHHHHHHCC
Confidence            999877654               6799999999999999999999877544 445678999999999999999999999


Q ss_pred             CCcccccCCCCCcCcccchhhHhHhhhhcCCCccceeeeeeeeccccCCCeEEeeHHHHHHhhcchhhhhhhccCCCEEE
Q 006698          158 DIPFYNLNKPELSGKENNGAVALMDNRKRGRGKVGLIRYVKLYSWKMGTGILGLSYRLFEKLVSGDELSGILLDLPGLFV  237 (635)
Q Consensus       158 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvi~ty~~~~~~~~~~~~~~~~~~~~~~vI  237 (635)
                      ++++..+.+......    ............         ........++|+|+||+++.+...     .+....|++||
T Consensus       311 ~~~v~~~~g~~~~r~----~~~~~~~~~~~~---------~~~~~~~~~dvvitTy~~l~~~~~-----~l~~~~w~~vI  372 (800)
T 3mwy_W          311 DLNCICYMGNQKSRD----TIREYEFYTNPR---------AKGKKTMKFNVLLTTYEYILKDRA-----ELGSIKWQFMA  372 (800)
T ss_dssp             TCCEEECCCSSHHHH----HHHHHHSCSCC--------------CCCCCSEEEECTTHHHHTHH-----HHHTSEEEEEE
T ss_pred             CceEEEEeCCHHHHH----HHHHHHhhcccc---------ccccccccCCEEEecHHHHHhhHH-----HHhcCCcceee
Confidence            999888776432211    110000000000         000113467899999999987542     24444699999


Q ss_pred             EeCCCcCCCcccHHHHHHHhcccCcEEEEecccCCCChhhHHHHHHhhhhhhhhhHHHHHhhhhhhhHhhhhhhhhhhhh
Q 006698          238 FDEGHTPRNDDTCMFKALSRIKTRRRIILSGTPFQNNFQELENTLSLVRQEFGEVLRTVRKSGREISKAKHASLISSIGR  317 (635)
Q Consensus       238 vDEaH~~kn~~s~~~~~l~~l~~~~~l~LTgTP~~n~~~el~~ll~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (635)
                      |||||++||..++.++++..+++.++|+|||||++|++.|+|++++|+.|+.++....+. +..                
T Consensus       373 vDEaH~lkn~~s~~~~~l~~l~~~~rl~LTgTPiqN~l~el~~ll~fL~p~~~~~~~~~~-~~~----------------  435 (800)
T 3mwy_W          373 VDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQEID-FEN----------------  435 (800)
T ss_dssp             ETTGGGGCCSSSHHHHHHTTSEEEEEEEECSCCCSSCSHHHHHHHHHHCSCCC----------C----------------
T ss_pred             hhhhhhhcCchhHHHHHHHHhhhccEEEeeCCcCCCCHHHHHHHHHHhCccccCchhhhc-ccc----------------
Confidence            999999999999999999999999999999999999999999999999999876544321 100                


Q ss_pred             ccCcCcHHHHHHHHHhhcchhhhcccccccccCCCceEEEEEeCCcHHHHHHHHHHhhh-------------hhHHHHHH
Q 006698          318 CANHRDDEKLKELKEKIAPFVNVHKGTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGV-------------KSFVELNY  384 (635)
Q Consensus       318 ~~~~~~~~~~~~l~~~l~~~~~rr~~~~~~~~lp~~~~~~v~~~~s~~q~~~y~~~~~~-------------~~~~~~~~  384 (635)
                       ........+..|+..+.|+++||++.++...+|++.+.++.++|++.|+++|+.+...             ...+....
T Consensus       436 -~~~~~~~~~~~L~~~l~p~~lRR~k~dv~~~LP~k~~~~v~v~ls~~q~~~Y~~i~~~~~~~l~~~~~~~~~~~l~~l~  514 (800)
T 3mwy_W          436 -QDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMN  514 (800)
T ss_dssp             -CTTHHHHHHHHHHHTTGGGEEECCGGGGTTTSCCEEEEEEEECCCHHHHHHHHHHHHHCCC----------CTHHHHHH
T ss_pred             -cchhHHHHHHHHHHHHhHHHhhhhHHhhhhccCCcEEEEEEeCCCHHHHHHHHHHHHHHHHHHhhccccchhhHHHHHH
Confidence             0012234578899999999999999999999999999999999999999999987653             25667788


Q ss_pred             HHhhhcCCCCCCCccccccCc-------cchHHHhhcccCccccchHHHHHHHHHhc--CCCeEEEEcCChhHHHHHHHH
Q 006698          385 CVSLLSVHPSLLPQQFFESFD-------VDSAKLARLKLDPEAGIKTRFLLILLELS--TNEKVLVFSQYIEPLTLIMEQ  455 (635)
Q Consensus       385 ~~~~~~~~p~l~~~~~~~~~~-------~~~~~l~~~~~~~~~s~K~~~l~~~l~~~--~~~kviIFs~~~~~~~~l~~~  455 (635)
                      .++++|+||.++.........       .....+..   ....++|+..|.+++...  .++|+||||+++.+++.|.+.
T Consensus       515 ~Lrk~~~hp~l~~~~~~~~~~~~~~~~~~~~~~~~~---l~~~s~K~~~L~~lL~~~~~~g~kvLIFsq~~~~ld~L~~~  591 (800)
T 3mwy_W          515 ELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRG---LIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDY  591 (800)
T ss_dssp             HHHHHHHCGGGSSSHHHHHCCCC----CCSHHHHHH---HHHTCHHHHHHHHHHHHHTTTTCCEEEEESCHHHHHHHHHH
T ss_pred             HHHHHhcChhhhcchHHHHHHhcccccccHHHHHHH---hhhcChHHHHHHHHHHHHhhCCCeEEEEechHHHHHHHHHH
Confidence            899999999988654221110       00011111   123588999999999887  789999999999999999999


Q ss_pred             HHhhhcccCCceEEEEeCCCCHHHHHHHHHHhcCCCCCcEEEEEccCCcccccccccCCeEEEeCCCCChhhHHhhhhhh
Q 006698          456 LRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRA  535 (635)
Q Consensus       456 L~~~~~~~~g~~~~~i~G~~~~~~r~~~i~~F~~~~~~~~vll~st~~~~~GlnL~~a~~vi~~d~~wnp~~~~Qa~gR~  535 (635)
                      |...     |+.+.+++|+++.++|+++++.|++++++..|+|+||++||+||||++|++||+||++|||..+.||+||+
T Consensus       592 L~~~-----g~~~~~i~G~~~~~eR~~~i~~F~~~~~~~~v~LlSt~agg~GlNL~~a~~VI~~D~~wnp~~~~Qa~gR~  666 (800)
T 3mwy_W          592 LSIK-----GINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARA  666 (800)
T ss_dssp             HHHH-----TCCCEEESTTSCHHHHHHHHHTTSSTTCSCCCEEEEHHHHTTTCCCTTCCEEEESSCCSCSHHHHHHHTTT
T ss_pred             HHhC-----CCCEEEEeCCCCHHHHHHHHHHhhCCCCCceEEEEecccccCCCCccccceEEEecCCCChhhHHHHHHHH
Confidence            9987     99999999999999999999999987777778999999999999999999999999999999999999999


Q ss_pred             hhcCCcceEEEEEEEeCCChHHHHHHHHHHhhhhhccccccCCCC
Q 006698          536 YRLGQKRVVHVYHLITSETLEWDKLRRQARKVWWSNMVFPSSDGG  580 (635)
Q Consensus       536 ~R~GQ~~~V~vy~li~~~tiEe~i~~~~~~K~~~~~~~~~~~~~~  580 (635)
                      ||+||+++|+||+|+++||+|++|++++.+|..+.+++++.....
T Consensus       667 ~RiGQ~k~V~Vyrlv~~~TiEe~i~~~~~~K~~l~~~vi~~~~~~  711 (800)
T 3mwy_W          667 HRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTD  711 (800)
T ss_dssp             SCSSCCSCEEEEEEEETTSHHHHHHHHHHHHTTSCC---------
T ss_pred             HhcCCCceEEEEEEecCCCHHHHHHHHHHHHHHHHHHHHccCccc
Confidence            999999999999999999999999999999999999999876543
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 635
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 1e-21
d1z3ix2298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 3e-16
d1z5za1244 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h 4e-13
d1z63a1230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 3e-12
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 9e-11
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 7e-10
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 5e-04
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 0.001
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

 Score = 94.6 bits (234), Expect = 1e-21
 Identities = 81/315 (25%), Positives = 136/315 (43%), Gaps = 38/315 (12%)

Query: 345 VLQESLPGLRHSVVILQPDEFQKRLCKAV-----------EGVKSFVELNYCVSL--LSV 391
           +L + LP     VV       QK L K              G  S   L+   SL  L  
Sbjct: 4   ILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKKLCN 63

Query: 392 HPSLLPQQFFESFDVDSAKLARLK-------LDPEAGIKTRFLLILLEL---STNEKVLV 441
           HP+L+ ++     +     L           ++P+   K   L  +L +   +T++KV++
Sbjct: 64  HPALIYEKCLTGEEGFDGALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVL 123

Query: 442 FSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKKRQSSINVLNDPSSQARIMLAST 501
            S Y + L L  +  R+R         + +DG   +KKR   +   N+PSS   I + S+
Sbjct: 124 VSNYTQTLDLFEKLCRNRRYLY-----VRLDGTMSIKKRAKIVERFNNPSSPEFIFMLSS 178

Query: 502 KACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDKLR 561
           KA   G+NL+GA+R+V+ D  WNP  + QA++R +R GQK+  ++Y L+++ T+E   L+
Sbjct: 179 KAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKILQ 238

Query: 562 RQARKVWWSNMVFPSSDGGGNDQTTASEP-------LEDKILEEMAQLYNNPSETLINAI 614
           RQA K   S+ V    D   + +   S         L +K L +    +          +
Sbjct: 239 RQAHKKALSSCVV---DEEQDVERHFSLGELRELFSLNEKTLSDTHDRFRCRRCVNGRQV 295

Query: 615 IPQPKETELIETFGE 629
            P P +++       
Sbjct: 296 RPPPDDSDCTCDLSN 310
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query635
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 100.0
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 100.0
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.91
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.87
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.87
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.87
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.85
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.84
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.84
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.83
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.81
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.81
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.79
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.76
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.7
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.68
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.67
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.59
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.57
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.57
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.5
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.49
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.45
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.41
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.38
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.3
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.28
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.27
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.27
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.25
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.25
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.24
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.22
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.18
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.16
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.15
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.14
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.07
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.44
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.43
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.8
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.76
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.57
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.51
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 97.35
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.07
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.04
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.89
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.78
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.5
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 95.44
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.42
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.23
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.91
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.88
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 94.6
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.47
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 94.32
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.23
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.17
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.08
d1okkd2207 GTPase domain of the signal recognition particle r 94.03
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 93.93
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.62
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 93.36
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.27
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.08
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.83
d2qy9a2211 GTPase domain of the signal recognition particle r 92.79
d1vmaa2213 GTPase domain of the signal recognition particle r 92.7
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 92.65
d1ls1a2207 GTPase domain of the signal sequence recognition p 92.02
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.56
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.48
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.35
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.93
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 88.4
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.78
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.25
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 87.18
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.83
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 86.58
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 85.61
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 84.62
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 84.2
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 82.69
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Rad54-like, Rad54L
species: Zebra fish (Danio rerio) [TaxId: 7955]

Probab=100.00  E-value=3.9e-43  Score=351.42  Aligned_cols=232  Identities=30%  Similarity=0.413  Sum_probs=198.2

Q ss_pred             cccccccCCCceEEEEEeCCcHHHHHHHHHHhhhh-------------hHHHHHHHHhhhcCCCCCCCccccccCccchH
Q 006698          343 GTVLQESLPGLRHSVVILQPDEFQKRLCKAVEGVK-------------SFVELNYCVSLLSVHPSLLPQQFFESFDVDSA  409 (635)
Q Consensus       343 ~~~~~~~lp~~~~~~v~~~~s~~q~~~y~~~~~~~-------------~~~~~~~~~~~~~~~p~l~~~~~~~~~~~~~~  409 (635)
                      .+.+.+.||++.+.+++|+||+.|+++|+.+....             ..+.....++++|+||.++.............
T Consensus         2 ~~vl~k~LP~K~e~vv~v~LS~~Q~~lY~~~l~~~~~~~~~~~~~~~~~~L~~l~~LRkiCnHP~L~~~~~~~~~~~~~~   81 (346)
T d1z3ix1           2 SDILSKYLPVKIEQVVCCNLTPLQKELYKLFLKQAKPVESLQTGKISVSSLSSITSLKKLCNHPALIYEKCLTGEEGFDG   81 (346)
T ss_dssp             GGGGGGTSCCEEEEEEEECCCHHHHHHHHHHHHHHCGGGSSCTTCCCHHHHHHHHHHHHHHHCTHHHHHHHHHTCTTCTT
T ss_pred             hhhhhccCCCCEEEEEEeCCCHHHHHHHHHHHHHHHHHHhhhcCCchHHHHHHHHHHHHHhCCHHHhhhhhccccccccc
Confidence            34556789999999999999999999999986422             56777889999999999865431111110000


Q ss_pred             -------HHhhcccCccccchHHHHHHHHHhc---CCCeEEEEcCChhHHHHHHHHHHhhhcccCCceEEEEeCCCCHHH
Q 006698          410 -------KLARLKLDPEAGIKTRFLLILLELS---TNEKVLVFSQYIEPLTLIMEQLRHRFNWREGQEVLYMDGKQDVKK  479 (635)
Q Consensus       410 -------~l~~~~~~~~~s~K~~~l~~~l~~~---~~~kviIFs~~~~~~~~l~~~L~~~~~~~~g~~~~~i~G~~~~~~  479 (635)
                             ........+..|+|+..|.+++...   +++||||||+|+.++++|.+.|...     |+.+.+++|+++.++
T Consensus        82 ~~~~~~~~~~~~~~~~~~S~Kl~~L~~ll~~~~~~~g~KvlIFs~~~~~ld~l~~~l~~~-----g~~~~~l~G~~~~~~  156 (346)
T d1z3ix1          82 ALDLFPQNYSTKAVEPQLSGKMLVLDYILAMTRTTTSDKVVLVSNYTQTLDLFEKLCRNR-----RYLYVRLDGTMSIKK  156 (346)
T ss_dssp             GGGTSCSSCCSSSCCGGGSHHHHHHHHHHHHHHHHCCCEEEEEESCHHHHHHHHHHHHHH-----TCCEEEECSSCCHHH
T ss_pred             hhhhccccccccccccccCHHHHHHHHHHHHHHHhcCCceeEEeehhhhhHHHHHHHhhh-----hccccccccchhHHH
Confidence                   0111223345689999999998764   7899999999999999999999998     999999999999999


Q ss_pred             HHHHHHHhcCCCCCcEEEEEccCCcccccccccCCeEEEeCCCCChhhHHhhhhhhhhcCCcceEEEEEEEeCCChHHHH
Q 006698          480 RQSSINVLNDPSSQARIMLASTKACCEGINLVGASRVVLLDVVWNPFVERQAISRAYRLGQKRVVHVYHLITSETLEWDK  559 (635)
Q Consensus       480 r~~~i~~F~~~~~~~~vll~st~~~~~GlnL~~a~~vi~~d~~wnp~~~~Qa~gR~~R~GQ~~~V~vy~li~~~tiEe~i  559 (635)
                      |+.+++.|+++++...|||+++++||+||||++|++||+||++|||+.+.||+||+||+||+++|+||+|+++||+|++|
T Consensus       157 R~~~i~~F~~~~~~~~vlLls~~agg~GlnL~~a~~vi~~d~~wnp~~~~Qa~~R~~R~GQ~~~V~v~rli~~~TiEe~i  236 (346)
T d1z3ix1         157 RAKIVERFNNPSSPEFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGTIEEKI  236 (346)
T ss_dssp             HHHHHHHHHSTTCCCCEEEEEGGGSCTTCCCTTEEEEEECSCCSSHHHHHHHHTTSSSTTCCSCEEEEEEEETTSHHHHH
T ss_pred             HHHHHHhhhcccccceeeeecchhhhhccccccceEEEEecCCCccchHhHhhhcccccCCCCceEEEEEEeCCCHHHHH
Confidence            99999999986666789999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhhhccccccCCC
Q 006698          560 LRRQARKVWWSNMVFPSSDG  579 (635)
Q Consensus       560 ~~~~~~K~~~~~~~~~~~~~  579 (635)
                      ++++..|..+++.++++...
T Consensus       237 ~~~~~~K~~l~~~v~~~~~~  256 (346)
T d1z3ix1         237 LQRQAHKKALSSCVVDEEQD  256 (346)
T ss_dssp             HHHHHHHHHTSCCCCSCSSS
T ss_pred             HHHHHHHHHHHHHHhCCchh
Confidence            99999999999999987654
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure