Citrus Sinensis ID: 007673


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590---
MAQIQVQHQAQMSGPNGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS
ccccccHHHcccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEEcccccccccccccEEEccccccccHHHHHHHHHccccccEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEccccccEEEEEEEcccHHHHHHHHHHHcccEEccEEEEEEEccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEcccccccEEEEEEcccHHHHHHHHHHHcccEEccEEEEEEEEEccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHcccccHHHHHcccccccHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
ccccHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHHHHcccEEccEEcEEEEccccHHHHHccccEEEEEcccccccHHHHHHHHHHHccEEEEEEEEcccccccccEEEEcccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEcccccccccEEEEcccHHHHHHHHHHHccccccccEEEEEcHccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEccHHHHHHHHHHHcccEcccccEEHEHHccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
MAQIQVQHQaqmsgpngvaagasgnqflttslyvgdldfnvtdsqLYDLFSQVGQVLSVRVcrdlstrrslgygyvnyanpadaaraldvlnftplnnksirimyshrdpsirksgtgnifiknldksidhkalhdtfssFGNILSckiatdgsgqskgfgfvqfeNKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFvknldesttdedLKKIFGEYGTITSAVvmrdgdgkskcfgfvnfenADDAAKAVEALngkkfddrewyvgkaqkksEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFgtitsckvmrdpsgiskgsgfvafstPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFsqmrpvamgpsvpprmpmyppgpsglgqqflygqappaiippqmpprghayryplgrnmqdfpfdmgagsmlpvpvdmgagiprrdasvgqpmpITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQqannpadqlaslslnenlvs
MAQIQVQHQAQMSGPNGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRimyshrdpsirksgtgNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERetvaiktkfnnvfvknldesttdedlkkiFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEalngkkfddrewyvgkaqkksereqeLKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLqaqfsqmrpvamgpsvpPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQannpadqlaslslnenlvs
MAQIQVQHQAQMSGPNGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMgpsvpprmpmyppgpsgLGQQFLYGqappaiippqmppRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS
***********************GNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYV************************VDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMR**********FV*****************KMIVSKPLYVAV*********************************************LY******************YRYPLGRNMQDFPFDM***********************************************LGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLE******************************************
*******************************LYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRI****************IFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVG*******************VFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYV******************************LNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVA********************************************************************************************************************************GESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEV***************************
***************NGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGK**************FEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVA**********QAQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS
***************N*****ASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIP*********MPITALST***NASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQ*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQIQVQHQAQMSGPNGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKxxxxxxxxxxxxxxxxxxxxxTVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQMPPRGHAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGAGIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLNENLVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query593 2.2.26 [Sep-21-2011]
P42731629 Polyadenylate-binding pro yes no 0.961 0.906 0.641 0.0
Q05196682 Polyadenylate-binding pro no no 0.930 0.809 0.515 1e-164
O64380660 Polyadenylate-binding pro no no 0.898 0.807 0.529 1e-163
Q6DEY7629 Embryonic polyadenylate-b yes no 0.940 0.887 0.443 1e-143
Q5B630732 Polyadenylate-binding pro yes no 0.925 0.75 0.419 1e-142
Q4VXU2614 Polyadenylate-binding pro no no 0.917 0.885 0.461 1e-141
Q1DXH0768 Polyadenylate-binding pro N/A no 0.905 0.699 0.437 1e-140
Q6GR16629 Embryonic polyadenylate-b N/A no 0.940 0.887 0.444 1e-140
Q98SP8629 Embryonic polyadenylate-b N/A no 0.940 0.887 0.440 1e-140
P0CP46673 Polyadenylate-binding pro yes no 0.908 0.800 0.457 1e-140
>sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 Back     alignment and function desciption
 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/647 (64%), Positives = 487/647 (75%), Gaps = 77/647 (11%)

Query: 1   MAQIQVQHQAQMSGPNGVAA----------GASGNQFLTTSLYVGDLDFNVTDSQLYDLF 50
           MAQ+Q+Q Q     PNG  A          GA+  QF  TSLYVGDLDFNVTDSQL+D F
Sbjct: 1   MAQVQLQGQT----PNGSTAAVTSAPATSGGATATQFGNTSLYVGDLDFNVTDSQLFDAF 56

Query: 51  SQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDP 110
            Q+G V++VRVCRDL TRRSLGYGYVN+ NP DAARA+  LN+ PL  K IR+MYSHRDP
Sbjct: 57  GQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIRVMYSHRDP 116

Query: 111 SIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKES 170
           S+R+SG GNIFIKNLD+SIDHKALHDTFSSFGNI+SCK+A D SGQSKG+GFVQ+ N+ES
Sbjct: 117 SVRRSGAGNIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVDSSGQSKGYGFVQYANEES 176

Query: 171 AQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFG 230
           AQ AI+KLNGML+NDKQV+VG FLR+QER++ A KTKF NV+VKNL ESTTD+DLK  FG
Sbjct: 177 AQKAIEKLNGMLLNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFG 236

Query: 231 EYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSER 290
           EYG ITSAVVM+DG+GKSK FGFVNFENADDAA+AVE+LNG KFDD+EWYVG+AQKKSER
Sbjct: 237 EYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQKKSER 296

Query: 291 EQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGI 350
           E EL+ ++EQ +KE  DKFQ  NLY+KNL  SI DEKLKE+FS FGT+TS KVMRDP+G 
Sbjct: 297 ETELRVRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGT 356

Query: 351 SKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMG 410
           SKGSGFVAF+TPEEA+ A+++++GKMI SKPLYVA+AQRKE+RR RLQAQFSQ+RPVAM 
Sbjct: 357 SKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQRKEDRRVRLQAQFSQVRPVAMQ 416

Query: 411 PSVPPRMPMYPPGPSGLGQQFLYGQAPPAIIPPQ------------MPPRG--------- 449
           PSV PRMP+YPPG  G+GQQ  YGQAPPA+IPPQ            M P G         
Sbjct: 417 PSVGPRMPVYPPGGPGIGQQMFYGQAPPAMIPPQPGYGYQQQLVPGMRPGGGPVPSFFMP 476

Query: 450 -------------------HA---------YRYPLGRNMQDFPFDMGAGSMLPVPVDMGA 481
                              H+           +P GR M  +P   G    +P P DMG 
Sbjct: 477 MVQPQQQRPGGGRRPGGIQHSQQQNPMMQQQMHPRGR-MFRYPQGRGGSGDVP-PYDMGN 534

Query: 482 GIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEM 541
            +         P+ I AL++ L+NA+PEQQRT+LGE LYPLVEQ+E ++AAKVTGMLLEM
Sbjct: 535 NM---------PLTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEM 585

Query: 542 DQTEVLHLLESPEALKAKVAEAMEVLRSVAQQQANNPADQLASLSLN 588
           DQTEVLHLLESPEALKAKVAEAM+VLRSVA   A    +QLASL+L+
Sbjct: 586 DQTEVLHLLESPEALKAKVAEAMDVLRSVA---AGGATEQLASLNLS 629




Binds the poly(A) tail of mRNA.
Arabidopsis thaliana (taxid: 3702)
>sp|Q05196|PABP5_ARATH Polyadenylate-binding protein 5 OS=Arabidopsis thaliana GN=PAB5 PE=1 SV=3 Back     alignment and function description
>sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 Back     alignment and function description
>sp|Q6DEY7|EPAB_XENTR Embryonic polyadenylate-binding protein OS=Xenopus tropicalis GN=epabp PE=2 SV=1 Back     alignment and function description
>sp|Q5B630|PABP_EMENI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pab1 PE=2 SV=2 Back     alignment and function description
>sp|Q4VXU2|PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens GN=PABPC1L PE=2 SV=1 Back     alignment and function description
>sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 Back     alignment and function description
>sp|Q6GR16|EPABB_XENLA Embryonic polyadenylate-binding protein B OS=Xenopus laevis GN=epabp-b PE=2 SV=1 Back     alignment and function description
>sp|Q98SP8|EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis GN=epabp-a PE=1 SV=2 Back     alignment and function description
>sp|P0CP46|PABP_CRYNJ Polyadenylate-binding protein, cytoplasmic and nuclear OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAB1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
224063493657 predicted protein [Populus trichocarpa] 0.996 0.899 0.750 0.0
356564176654 PREDICTED: polyadenylate-binding protein 0.994 0.902 0.722 0.0
255538240658 polyadenylate-binding protein, putative 0.996 0.898 0.725 0.0
357437769647 Polyadenylate-binding protein [Medicago 0.984 0.902 0.718 0.0
356552218652 PREDICTED: polyadenylate-binding protein 0.994 0.904 0.720 0.0
317106694642 JHL03K20.4 [Jatropha curcas] 0.993 0.917 0.698 0.0
356499763646 PREDICTED: polyadenylate-binding protein 0.991 0.910 0.711 0.0
224137600632 predicted protein [Populus trichocarpa] 0.959 0.900 0.739 0.0
317106693642 JHL03K20.3 [Jatropha curcas] 0.993 0.917 0.704 0.0
225438781654 PREDICTED: polyadenylate-binding protein 0.956 0.866 0.721 0.0
>gi|224063493|ref|XP_002301171.1| predicted protein [Populus trichocarpa] gi|222842897|gb|EEE80444.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  946 bits (2445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/653 (75%), Positives = 533/653 (81%), Gaps = 62/653 (9%)

Query: 1   MAQIQV-QHQAQMSGPNGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSV 59
           MAQIQV Q  A + GPNGVAAG    QF+ TSLYVGDLDFNVTDSQLYDLF+QVGQV+SV
Sbjct: 1   MAQIQVHQAAAPVPGPNGVAAGPGAIQFVPTSLYVGDLDFNVTDSQLYDLFNQVGQVVSV 60

Query: 60  RVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGN 119
           RVCRDLSTRRSLGYGYVNY+NP DAARALDVLNFTPLNNK +RIMYSHRDPSIRKSG  N
Sbjct: 61  RVCRDLSTRRSLGYGYVNYSNPQDAARALDVLNFTPLNNKPLRIMYSHRDPSIRKSGMAN 120

Query: 120 IFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLN 179
           IFIKNLDK+IDHKALHDTFSSFGNILSCK+ATD SGQSKG+GFVQF+++E+AQNAIDKLN
Sbjct: 121 IFIKNLDKTIDHKALHDTFSSFGNILSCKVATDASGQSKGYGFVQFDSEEAAQNAIDKLN 180

Query: 180 GMLINDKQVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAV 239
           GMLINDKQV+VG+FLRKQER++     KFNN++VKNL ESTTDEDLK IF E+G ITSAV
Sbjct: 181 GMLINDKQVYVGNFLRKQERDSALSNIKFNNIYVKNLAESTTDEDLKSIFEEHGAITSAV 240

Query: 240 VMRDGDGKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFE 299
           VMRD DGKSKCFGFVNFEN DDAAKAVEALNGKKFDD+EWYVGKAQKKSERE ELKG+FE
Sbjct: 241 VMRDADGKSKCFGFVNFENVDDAAKAVEALNGKKFDDKEWYVGKAQKKSERELELKGRFE 300

Query: 300 QAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAF 359
           Q++ E+V+K+Q +NLYIKNL DS++DEKLKELFS+FGTITSCKVM DPSGIS+GSGFVAF
Sbjct: 301 QSL-ESVEKYQAVNLYIKNLDDSVNDEKLKELFSDFGTITSCKVMHDPSGISRGSGFVAF 359

Query: 360 STPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPSVPPRMPM 419
           STPEEASRALAE+NGKM+VSKPLYVA AQRKEERRARLQAQFSQMRPVAM PSV PRM M
Sbjct: 360 STPEEASRALAELNGKMVVSKPLYVAPAQRKEERRARLQAQFSQMRPVAMAPSVAPRMQM 419

Query: 420 YPPGPSGLGQQFLYGQAPPAIIP-----------PQMPPRG------------------- 449
           YPPG  GLGQQFLYGQ PPA+IP           P M P G                   
Sbjct: 420 YPPGAPGLGQQFLYGQGPPAMIPQAGFGYQQQLVPGMRPGGAPMPNFFVPLVQQGQQGQR 479

Query: 450 ----------------------------HAYRYPLGRNMQDFPFDMGAGSMLPVPVDMGA 481
                                         YRYP GRNM D P    AG ML VP DMG 
Sbjct: 480 PGGRRGGGPVQQTQQPVPLMQQQMLPRGRVYRYPPGRNMPDVPMPGVAGGMLSVPYDMGV 539

Query: 482 GIPRRDASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEM 541
            +P RDA+ GQPMPITAL+TALANA+PEQQRT+LGE LYPLV+QLE D+AAKVTGMLLEM
Sbjct: 540 -MPIRDAAGGQPMPITALATALANATPEQQRTMLGEGLYPLVDQLEHDSAAKVTGMLLEM 598

Query: 542 DQTEVLHLLESPEALKAKVAEAMEVLRSV-AQQQANNPADQLASLSLNENLVS 593
           DQTEVLHLLESPEALKAKVAEAMEVLR+V AQQQ NNPAD LASLSLNENLVS
Sbjct: 599 DQTEVLHLLESPEALKAKVAEAMEVLRTVAAQQQINNPADHLASLSLNENLVS 651




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356564176|ref|XP_003550332.1| PREDICTED: polyadenylate-binding protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|255538240|ref|XP_002510185.1| polyadenylate-binding protein, putative [Ricinus communis] gi|223550886|gb|EEF52372.1| polyadenylate-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357437769|ref|XP_003589160.1| Polyadenylate-binding protein [Medicago truncatula] gi|355478208|gb|AES59411.1| Polyadenylate-binding protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356552218|ref|XP_003544466.1| PREDICTED: polyadenylate-binding protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|317106694|dbj|BAJ53195.1| JHL03K20.4 [Jatropha curcas] Back     alignment and taxonomy information
>gi|356499763|ref|XP_003518706.1| PREDICTED: polyadenylate-binding protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224137600|ref|XP_002327166.1| predicted protein [Populus trichocarpa] gi|222835481|gb|EEE73916.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|317106693|dbj|BAJ53194.1| JHL03K20.3 [Jatropha curcas] Back     alignment and taxonomy information
>gi|225438781|ref|XP_002283105.1| PREDICTED: polyadenylate-binding protein 2 [Vitis vinifera] gi|296082381|emb|CBI21386.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
TAIR|locus:2012161671 PAB8 "AT1G49760" [Arabidopsis 0.704 0.622 0.696 4.3e-205
TAIR|locus:2124261629 PAB2 "AT4G34110" [Arabidopsis 0.731 0.689 0.693 1.1e-196
TAIR|locus:2058573662 PAB4 "AT2G23350" [Arabidopsis 0.703 0.629 0.668 5.9e-187
TAIR|locus:2199700660 PAB3 "poly(A) binding protein 0.676 0.607 0.610 1.2e-151
UNIPROTKB|F1SV06631 PABPC4 "Uncharacterized protei 0.640 0.602 0.588 8.2e-138
UNIPROTKB|A4IFC3645 PABPC4 "Uncharacterized protei 0.640 0.589 0.588 1.1e-137
UNIPROTKB|E2R9I0631 PABPC4 "Uncharacterized protei 0.640 0.602 0.588 1.1e-137
UNIPROTKB|B1ANR0615 PABPC4 "Polyadenylate-binding 0.640 0.617 0.588 1.1e-137
UNIPROTKB|Q13310644 PABPC4 "Polyadenylate-binding 0.640 0.590 0.588 1.1e-137
UNIPROTKB|D4AC14631 Pabpc4 "Protein Pabpc4" [Rattu 0.640 0.602 0.585 1.3e-137
TAIR|locus:2012161 PAB8 "AT1G49760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1519 (539.8 bits), Expect = 4.3e-205, Sum P(3) = 4.3e-205
 Identities = 292/419 (69%), Positives = 347/419 (82%)

Query:    17 GVAAGASGN-QFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGY 75
             G AA A+G  Q  TTSLYVGDLD  VTDSQL++ F+Q GQV+SVRVCRD++TRRSLGYGY
Sbjct:    31 GAAAAAAGAAQQGTTSLYVGDLDATVTDSQLFEAFTQAGQVVSVRVCRDMTTRRSLGYGY 90

Query:    76 VNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALH 135
             VNYA P DA+RAL+ LNF  LN ++IR+MYS RDPS+RKSG GNIFIKNLDKSIDHKALH
Sbjct:    91 VNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLRKSGVGNIFIKNLDKSIDHKALH 150

Query:   136 DTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLR 195
             +TFS+FG ILSCK+A D SGQSKG+GFVQ++  E+AQ AIDKLNGML+NDKQV+VG F+ 
Sbjct:   151 ETFSAFGPILSCKVAVDPSGQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVH 210

Query:   196 KQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVN 255
             K +R+    K KF NV+VKNL ES +DE+L K+FGE+G  TS V+MRDG+GKSK FGFVN
Sbjct:   211 KLQRDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVTTSCVIMRDGEGKSKGFGFVN 270

Query:   256 FENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLY 315
             FEN+DDAA+AV+ALNGK FDD+EW+VGKAQKKSERE ELK +FEQ++KE  DK QG NLY
Sbjct:   271 FENSDDAARAVDALNGKTFDDKEWFVGKAQKKSERETELKQKFEQSLKEAADKSQGSNLY 330

Query:   316 IKNLGDSIDDEKLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGK 375
             +KNL +S+ D+KL+E F+ FGTITSCKVMRDPSG+S+GSGFVAFSTPEEA+RA+ EMNGK
Sbjct:   331 VKNLDESVTDDKLREHFAPFGTITSCKVMRDPSGVSRGSGFVAFSTPEEATRAITEMNGK 390

Query:   376 MIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMXXXXXXXXXXXXXXXXXLGQQFLYG 434
             MIV+KPLYVA+AQRKE+R+ARLQAQFSQMRPV M                 +GQQ  YG
Sbjct:   391 MIVTKPLYVALAQRKEDRKARLQAQFSQMRPVNMPPAVGPRMQMYPPGGPPMGQQLFYG 449


GO:0003723 "RNA binding" evidence=ISS
GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
TAIR|locus:2124261 PAB2 "AT4G34110" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058573 PAB4 "AT2G23350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199700 PAB3 "poly(A) binding protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV06 PABPC4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFC3 PABPC4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9I0 PABPC4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B1ANR0 PABPC4 "Polyadenylate-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13310 PABPC4 "Polyadenylate-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D4AC14 Pabpc4 "Protein Pabpc4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P42731PABP2_ARATHNo assigned EC number0.64140.96120.9062yesno
Q6CDH3PABP_YARLINo assigned EC number0.44140.90210.8505yesno
Q6FKG4PABP_CANGANo assigned EC number0.46380.87520.8963yesno
Q13310PABP4_HUMANNo assigned EC number0.55520.67280.6195yesno
Q6CSV3PABP_KLULANo assigned EC number0.44780.89370.8952yesno
P31209PABP_SCHPONo assigned EC number0.46490.92580.8407yesno
P0CP46PABP_CRYNJNo assigned EC number0.45740.90890.8008yesno
A3LXL0PABP_PICSTNo assigned EC number0.46320.87850.8243yesno
Q9EPH8PABP1_RATNo assigned EC number0.56400.67790.6320yesno
Q54BM2PAP1A_DICDINo assigned EC number0.47250.87180.9150yesno
P04147PABP_YEASTNo assigned EC number0.44560.87520.8994yesno
Q6BI95PABP_DEBHANo assigned EC number0.44480.92580.8755yesno
Q6DEY7EPAB_XENTRNo assigned EC number0.44320.94090.8871yesno
P21187PABP_DROMENo assigned EC number0.53130.70320.6577yesno
Q74ZS6PABP_ASHGONo assigned EC number0.46260.84990.8615yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_II1125
hypothetical protein (657 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 0.0
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 6e-49
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-47
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-45
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-44
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 9e-34
pfam0065872 pfam00658, PABP, Poly-adenylate binding protein, u 2e-32
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-31
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 9e-29
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-28
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 4e-28
smart0051764 smart00517, PolyA, C-terminal domain of Poly(A)-bi 5e-28
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 5e-27
smart0036073 smart00360, RRM, RNA recognition motif 3e-26
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 5e-26
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-25
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-25
smart0036073 smart00360, RRM, RNA recognition motif 4e-23
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 8e-23
smart0036073 smart00360, RRM, RNA recognition motif 3e-22
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 4e-22
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-22
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 8e-22
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 9e-22
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 2e-21
smart0036073 smart00360, RRM, RNA recognition motif 3e-21
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 8e-21
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-20
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-20
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 4e-20
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-19
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-19
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-19
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 4e-19
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-18
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 2e-18
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-18
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-18
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-18
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 4e-18
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 8e-18
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 9e-18
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-17
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-17
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-17
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-17
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 4e-17
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 7e-17
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 8e-17
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-16
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-16
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 2e-16
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-16
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-16
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-16
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-16
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 4e-16
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 5e-16
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 7e-16
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-15
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-15
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-15
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-15
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-15
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 4e-15
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-15
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 5e-15
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 6e-15
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 7e-15
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 8e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-14
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-14
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-14
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 2e-14
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 2e-14
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 2e-14
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 2e-14
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-14
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-14
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 3e-14
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-14
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 4e-14
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 4e-14
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 5e-14
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 6e-14
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 6e-14
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 6e-14
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-13
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-13
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 1e-13
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 1e-13
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-13
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-13
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-13
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-13
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-13
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 3e-13
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-13
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 3e-13
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 3e-13
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-13
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 4e-13
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 4e-13
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 4e-13
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 5e-13
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 5e-13
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 6e-13
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 6e-13
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 7e-13
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 7e-13
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 8e-13
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 8e-13
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 8e-13
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 8e-13
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 8e-13
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 8e-13
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 9e-13
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-12
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-12
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 1e-12
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 1e-12
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-12
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-12
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-12
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-12
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-12
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-12
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-12
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-12
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-12
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-12
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 2e-12
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 2e-12
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-12
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-12
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 3e-12
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 3e-12
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 3e-12
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-12
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 3e-12
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 4e-12
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 4e-12
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 4e-12
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 4e-12
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 4e-12
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 4e-12
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 4e-12
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 4e-12
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 5e-12
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 5e-12
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 5e-12
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 6e-12
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 6e-12
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 6e-12
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 6e-12
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 6e-12
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 7e-12
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 7e-12
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 8e-12
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 8e-12
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 8e-12
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 9e-12
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 9e-12
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 1e-11
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 1e-11
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 1e-11
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-11
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-11
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 1e-11
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-11
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-11
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-11
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-11
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-11
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 2e-11
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-11
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-11
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 2e-11
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-11
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 3e-11
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 3e-11
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-11
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 3e-11
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 3e-11
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 3e-11
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 3e-11
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-11
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-11
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 3e-11
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-11
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 4e-11
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 4e-11
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-11
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 4e-11
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 5e-11
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 5e-11
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 5e-11
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 5e-11
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 5e-11
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 5e-11
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 6e-11
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 6e-11
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 7e-11
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 7e-11
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 7e-11
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 7e-11
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 8e-11
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 8e-11
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 8e-11
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-10
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-10
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-10
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 1e-10
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 1e-10
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 1e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 1e-10
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 1e-10
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-10
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-10
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-10
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-10
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 1e-10
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-10
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 2e-10
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-10
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-10
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-10
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 2e-10
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 2e-10
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-10
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-10
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-10
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 3e-10
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 3e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-10
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 4e-10
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 4e-10
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 4e-10
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 4e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-10
pfam1389356 pfam13893, RRM_5, RNA recognition motif 4e-10
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 4e-10
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 5e-10
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 5e-10
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 5e-10
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 5e-10
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 5e-10
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 5e-10
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 5e-10
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-10
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 6e-10
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 6e-10
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-10
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 6e-10
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 7e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 7e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 7e-10
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-10
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 8e-10
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 9e-10
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 9e-10
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 9e-10
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 9e-10
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 9e-10
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 9e-10
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-09
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 1e-09
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-09
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 1e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 1e-09
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 1e-09
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 1e-09
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 1e-09
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 1e-09
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 1e-09
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 1e-09
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 1e-09
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-09
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 2e-09
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 2e-09
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-09
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-09
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 2e-09
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-09
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 2e-09
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 2e-09
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-09
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-09
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 2e-09
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 2e-09
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 2e-09
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-09
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 3e-09
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 3e-09
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 3e-09
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-09
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-09
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 3e-09
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 3e-09
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-09
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 3e-09
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-09
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-09
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 4e-09
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 4e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 4e-09
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 4e-09
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 4e-09
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 4e-09
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 4e-09
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 4e-09
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 4e-09
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 5e-09
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 5e-09
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 5e-09
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 5e-09
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-09
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 6e-09
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 6e-09
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 6e-09
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 6e-09
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 6e-09
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 6e-09
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 7e-09
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 7e-09
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 7e-09
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 7e-09
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 7e-09
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 7e-09
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 7e-09
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 7e-09
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 8e-09
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 8e-09
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 8e-09
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 8e-09
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 8e-09
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 9e-09
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 9e-09
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 9e-09
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 9e-09
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-08
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 1e-08
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 1e-08
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-08
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-08
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 1e-08
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-08
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-08
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 1e-08
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-08
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 1e-08
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 1e-08
TIGR01649481 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl 1e-08
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-08
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 1e-08
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 2e-08
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-08
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-08
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 2e-08
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-08
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 2e-08
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-08
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-08
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 2e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-08
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 2e-08
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-08
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 2e-08
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-08
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-08
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-08
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 3e-08
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 3e-08
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 3e-08
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 3e-08
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 3e-08
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 3e-08
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-08
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 3e-08
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 3e-08
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 3e-08
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 4e-08
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-08
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 4e-08
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 4e-08
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 4e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 4e-08
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 4e-08
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 4e-08
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 4e-08
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 4e-08
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 5e-08
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 5e-08
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 5e-08
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 5e-08
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 5e-08
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 5e-08
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 5e-08
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 5e-08
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 5e-08
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 5e-08
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 5e-08
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 5e-08
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 6e-08
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-08
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 6e-08
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 6e-08
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 6e-08
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 7e-08
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 7e-08
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 7e-08
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 8e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 8e-08
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 8e-08
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 8e-08
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 8e-08
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 8e-08
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 9e-08
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 9e-08
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 9e-08
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 9e-08
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 9e-08
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 9e-08
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-07
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 1e-07
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 1e-07
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 1e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 1e-07
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-07
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 1e-07
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 1e-07
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 1e-07
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 1e-07
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 1e-07
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-07
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 1e-07
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-07
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 1e-07
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 1e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-07
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 1e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 1e-07
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 1e-07
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 1e-07
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 1e-07
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 1e-07
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 2e-07
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-07
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 2e-07
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 2e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-07
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-07
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 2e-07
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-07
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 2e-07
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-07
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 2e-07
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 2e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 2e-07
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 2e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 2e-07
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-07
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-07
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-07
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 2e-07
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 2e-07
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-07
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 2e-07
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 3e-07
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 3e-07
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 3e-07
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-07
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 3e-07
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 3e-07
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 3e-07
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-07
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 3e-07
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 3e-07
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 3e-07
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 3e-07
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 3e-07
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 4e-07
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-07
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 4e-07
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 4e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 4e-07
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 4e-07
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 4e-07
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 4e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 4e-07
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 4e-07
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 4e-07
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 4e-07
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 4e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 5e-07
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-07
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 5e-07
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 5e-07
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 5e-07
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 5e-07
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 5e-07
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 5e-07
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 6e-07
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 6e-07
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 6e-07
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 6e-07
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 6e-07
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 6e-07
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 6e-07
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 7e-07
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 7e-07
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 7e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 7e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 7e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 7e-07
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 8e-07
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 8e-07
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 8e-07
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 8e-07
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 9e-07
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 9e-07
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 9e-07
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 9e-07
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 1e-06
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 1e-06
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 1e-06
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-06
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 1e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-06
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 1e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-06
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 1e-06
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 1e-06
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 1e-06
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 1e-06
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 1e-06
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-06
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 1e-06
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 1e-06
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 1e-06
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 1e-06
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-06
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-06
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 2e-06
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 2e-06
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-06
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-06
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-06
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 2e-06
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 2e-06
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-06
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 2e-06
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-06
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 2e-06
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 2e-06
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 2e-06
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 2e-06
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 2e-06
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 2e-06
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 2e-06
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 2e-06
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-06
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 2e-06
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 3e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-06
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 3e-06
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 3e-06
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 3e-06
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 3e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 3e-06
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 3e-06
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 3e-06
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 3e-06
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 3e-06
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 3e-06
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 3e-06
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 3e-06
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 3e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 3e-06
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 3e-06
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 3e-06
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 3e-06
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 3e-06
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 3e-06
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 3e-06
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 3e-06
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 3e-06
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 4e-06
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 4e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 4e-06
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 4e-06
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 4e-06
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 4e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 4e-06
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 4e-06
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 4e-06
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 5e-06
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 5e-06
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 5e-06
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 5e-06
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 5e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 5e-06
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 5e-06
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 5e-06
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 5e-06
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 5e-06
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 5e-06
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 5e-06
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 5e-06
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 5e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 6e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 6e-06
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 6e-06
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 6e-06
cd1223873 cd12238, RRM1_RBM40_like, RNA recognition motif 1 6e-06
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 6e-06
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 7e-06
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 7e-06
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 7e-06
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 7e-06
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 7e-06
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 7e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 8e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 8e-06
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 8e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 8e-06
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 8e-06
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 8e-06
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 8e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 8e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 9e-06
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 9e-06
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 9e-06
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 9e-06
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 9e-06
cd1246483 cd12464, RRM_G3BP2, RNA recognition motif in ras G 9e-06
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 9e-06
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 9e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-05
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 1e-05
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 1e-05
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 1e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 1e-05
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 1e-05
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 1e-05
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 1e-05
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 1e-05
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 1e-05
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 1e-05
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 1e-05
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 1e-05
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 1e-05
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 1e-05
cd1256872 cd12568, RRM3_MRD1, RNA recognition motif 3 in yea 1e-05
cd1261181 cd12611, RRM1_NGR1_NAM8_like, RNA recognition moti 1e-05
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 1e-05
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 1e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-05
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-05
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-05
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 2e-05
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 2e-05
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 2e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 2e-05
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 2e-05
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-05
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 2e-05
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 2e-05
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 2e-05
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 2e-05
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 2e-05
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 2e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-05
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 2e-05
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 2e-05
cd1259180 cd12591, RRM2_p54nrb, RNA recognition motif 2 in v 2e-05
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 2e-05
cd1245870 cd12458, RRM_AtC3H46_like, RNA recognition motif i 2e-05
cd1260276 cd12602, RRM2_SF2_plant_like, RNA recognition moti 2e-05
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 3e-05
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-05
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 3e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-05
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 3e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-05
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 3e-05
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 3e-05
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 3e-05
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 3e-05
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 3e-05
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 3e-05
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 3e-05
cd1247891 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 s 3e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-05
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 4e-05
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 4e-05
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 4e-05
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 4e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 5e-05
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 5e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 5e-05
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 5e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 5e-05
cd1262677 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in 5e-05
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 5e-05
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 5e-05
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 6e-05
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 6e-05
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 6e-05
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 6e-05
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 7e-05
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 7e-05
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 7e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 7e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 7e-05
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 7e-05
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 7e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 7e-05
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 7e-05
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 7e-05
cd1242576 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 7e-05
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 7e-05
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 8e-05
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 8e-05
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 8e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 8e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 8e-05
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 8e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 8e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 8e-05
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 8e-05
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 8e-05
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 8e-05
cd1253483 cd12534, RRM_SARFH, RNA recognition motif in Droso 8e-05
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 8e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 9e-05
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 9e-05
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 9e-05
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 9e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 9e-05
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 9e-05
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 9e-05
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 9e-05
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 9e-05
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 9e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-04
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 1e-04
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 1e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-04
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 1e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 1e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 1e-04
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 1e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 1e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 1e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 1e-04
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 1e-04
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 1e-04
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 1e-04
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 1e-04
cd1234974 cd12349, RRM2_SHARP, RNA recognition motif 2 in SM 1e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 1e-04
cd1258980 cd12589, RRM2_PSP1, RNA recognition motif 2 in ver 1e-04
cd1258980 cd12589, RRM2_PSP1, RNA recognition motif 2 in ver 1e-04
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 1e-04
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 1e-04
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 1e-04
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 1e-04
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 1e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 1e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 1e-04
cd1259080 cd12590, RRM2_PSF, RNA recognition motif 2 in vert 1e-04
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 1e-04
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-04
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 1e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-04
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 1e-04
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 1e-04
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-04
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 2e-04
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 2e-04
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 2e-04
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 2e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-04
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 2e-04
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 2e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-04
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 2e-04
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 2e-04
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 2e-04
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 2e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 2e-04
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 2e-04
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 2e-04
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 2e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 2e-04
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 2e-04
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 2e-04
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 2e-04
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 2e-04
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-04
cd1229971 cd12299, RRM4_Prp24, RNA recognition motif 4 in fu 2e-04
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 2e-04
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 3e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 3e-04
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 3e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 3e-04
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 3e-04
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 3e-04
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 3e-04
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 3e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 3e-04
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 3e-04
cd1259180 cd12591, RRM2_p54nrb, RNA recognition motif 2 in v 3e-04
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 3e-04
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 3e-04
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 3e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 3e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 3e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 3e-04
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 3e-04
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 3e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 3e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 3e-04
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 4e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 4e-04
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 4e-04
cd1266177 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in v 4e-04
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 4e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 4e-04
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 4e-04
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-04
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 4e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 4e-04
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 4e-04
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 4e-04
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 4e-04
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 4e-04
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 4e-04
cd1243571 cd12435, RRM_GW182_like, RNA recognition motif in 4e-04
cd1228993 cd12289, RRM_LARP6, RNA recognition motif in La-re 4e-04
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 4e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 5e-04
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 5e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 5e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 5e-04
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 5e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 5e-04
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 5e-04
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 5e-04
cd1247891 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 s 5e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 5e-04
cd1258980 cd12589, RRM2_PSP1, RNA recognition motif 2 in ver 5e-04
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 5e-04
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 5e-04
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 5e-04
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 5e-04
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 6e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 6e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 6e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 6e-04
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 6e-04
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 6e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 6e-04
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 6e-04
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 6e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 6e-04
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 6e-04
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 6e-04
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 7e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 7e-04
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 7e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 7e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 7e-04
cd1259080 cd12590, RRM2_PSF, RNA recognition motif 2 in vert 7e-04
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 7e-04
cd1246380 cd12463, RRM_G3BP1, RNA recognition motif found in 7e-04
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 8e-04
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 8e-04
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 8e-04
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 8e-04
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 8e-04
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 8e-04
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 8e-04
cd1238870 cd12388, RRM1_RAVER, RNA recognition motif 1 in ri 8e-04
cd1245288 cd12452, RRM_ARP_like, RNA recognition motif in ye 8e-04
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 9e-04
cd1244173 cd12441, RRM_Nup53_like, RNA recognition motif in 9e-04
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 9e-04
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.001
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 0.001
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 0.001
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.001
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 0.001
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.001
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.001
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 0.001
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.001
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 0.001
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.001
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 0.001
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.001
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 0.001
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 0.001
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 0.001
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 0.001
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 0.001
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 0.001
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 0.001
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 0.001
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 0.001
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 0.001
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 0.001
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.001
cd1262577 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in 0.001
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.002
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.002
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 0.002
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 0.002
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 0.002
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 0.002
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 0.002
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.002
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.002
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 0.002
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 0.002
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 0.002
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 0.002
cd1259080 cd12590, RRM2_PSF, RNA recognition motif 2 in vert 0.002
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 0.002
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 0.002
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 0.002
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 0.002
cd1226586 cd12265, RRM_SLT11, RNA recognition motif of pre-m 0.002
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 0.002
cd1260476 cd12604, RRM_RALY, RNA recognition motif in verteb 0.002
pfam08777102 pfam08777, RRM_3, RNA binding motif 0.002
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 0.002
cd1235679 cd12356, RRM_PPARGC1B, RNA recognition motif in pe 0.002
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 0.003
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 0.003
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 0.003
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 0.003
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.003
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 0.003
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 0.003
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.003
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 0.003
cd1229275 cd12292, RRM2_La_like, RNA recognition motif 2 in 0.003
cd1260072 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 0.003
cd1248778 cd12487, RRM1_DND1, RNA recognition motif 1 found 0.003
cd1246588 cd12465, RRM_UHMK1, RNA recognition motif found in 0.003
cd1254176 cd12541, RRM2_La, RNA recognition motif 2 in La au 0.003
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.004
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.004
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.004
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 0.004
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.004
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.004
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 0.004
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 0.004
cd1259180 cd12591, RRM2_p54nrb, RNA recognition motif 2 in v 0.004
cd1225772 cd12257, RRM1_RBM26_like, RNA recognition motif 1 0.004
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 0.004
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 0.004
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 0.004
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 0.004
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 0.004
cd1228993 cd12289, RRM_LARP6, RNA recognition motif in La-re 0.004
cd12540105 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 0.004
cd1223472 cd12234, RRM1_AtRSp31_like, RNA recognition motif 0.004
cd1265776 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in v 0.004
cd1244373 cd12443, RRM_MCM3A_like, RNA recognition motif in 0.004
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
 Score =  684 bits (1768), Expect = 0.0
 Identities = 298/562 (53%), Positives = 387/562 (68%), Gaps = 25/562 (4%)

Query: 31  SLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDV 90
           SLYVGDLD +VT+++LYDLF   G VLSVRVCRD  TRRSLGYGYVN+ NPADA RAL+ 
Sbjct: 2   SLYVGDLDPDVTEAKLYDLFKPFGPVLSVRVCRDSVTRRSLGYGYVNFQNPADAERALET 61

Query: 91  LNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIA 150
           +NF  L  K IRIM+S RDPS+R+SG GNIF+KNLDKS+D+KAL DTFS FGNILSCK+A
Sbjct: 62  MNFKRLGGKPIRIMWSQRDPSLRRSGVGNIFVKNLDKSVDNKALFDTFSKFGNILSCKVA 121

Query: 151 TDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHFLRKQERETVAIKTKFNN 210
           TD +G+S+G+GFV FE +ESA+ AI K+NGML+NDK+V+VG F++K ERE  A   KF N
Sbjct: 122 TDENGKSRGYGFVHFEKEESAKAAIQKVNGMLLNDKEVYVGRFIKKHERE-AAPLKKFTN 180

Query: 211 VFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEALN 270
           ++VKNLD S  ++ L+++F ++G ITSA VM+DG G+S+ F FVNFE  +DAAKAVE +N
Sbjct: 181 LYVKNLDPSVNEDKLRELFAKFGEITSAAVMKDGSGRSRGFAFVNFEKHEDAAKAVEEMN 240

Query: 271 GKKFDDREW----YVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDE 326
           GKK    +     YVG+AQK++ERE EL+ +FE+  +E   K QG+NLY+KNL D++ DE
Sbjct: 241 GKKIGLAKEGKKLYVGRAQKRAEREAELRRKFEELQQERKMKAQGVNLYVKNLDDTVTDE 300

Query: 327 KLKELFSEFGTITSCKVMRDPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAV 386
           KL+ELFSE G ITS KVM D  G+S+G GFV FS PEEA+RA+ EM+G+M+  KPLYVA+
Sbjct: 301 KLRELFSECGEITSAKVMLDEKGVSRGFGFVCFSNPEEANRAVTEMHGRMLGGKPLYVAL 360

Query: 387 AQRKEERRARLQAQFSQMRPVAMGPSVPPRM-------PMYPPGPSGL--GQQFLYGQAP 437
           AQRKE+RRA LQ QF Q++P      +   M       P Y  GP     GQ   + +  
Sbjct: 361 AQRKEQRRAHLQDQFMQLQPRMRQLPMGSPMGGAMGQPPYYGQGPQQQFNGQPLGWPRMS 420

Query: 438 PAIIP--PQMPPRGHAYRYP-----LGRNMQDFPFDMGAGSMLPVPVDMG----AGIPRR 486
               P  P  P R +            RN Q+         ++  P          +P+ 
Sbjct: 421 MMPTPMGPGGPLRPNGLAPMNAVRAPSRNAQNAAQKPPMQPVMYPPNYQSLPLSQDLPQP 480

Query: 487 DASVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEV 546
            ++  Q      L+  LA+A+P+ Q+ +LGE L+PLVE +E   AAK+TGMLLEMD +E+
Sbjct: 481 QSTASQGGQNKKLAQVLASATPQMQKQVLGERLFPLVEAIEPALAAKITGMLLEMDNSEL 540

Query: 547 LHLLESPEALKAKVAEAMEVLR 568
           LHLLESPE LK+KV EA+EVL+
Sbjct: 541 LHLLESPELLKSKVDEALEVLK 562


These eukaryotic proteins recognize the poly-A of mRNA and consists of four tandem RNA recognition domains at the N-terminus (rrm: pfam00076) followed by a PABP-specific domain (pfam00658) at the C-terminus. The protein is involved in the transport of mRNA's from the nucleus to the cytoplasm. There are four paralogs in Homo sapiens which are expressed in testis (GP:11610605_PABP3 ), platelets (SP:Q13310_PABP4 ), broadly expressed (SP:P11940_PABP1) and of unknown tissue range (SP:Q15097_PABP2). Length = 562

>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|201378 pfam00658, PABP, Poly-adenylate binding protein, unique domain Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|197769 smart00517, PolyA, C-terminal domain of Poly(A)-binding protein Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240684 cd12238, RRM1_RBM40_like, RNA recognition motif 1 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240910 cd12464, RRM_G3BP2, RNA recognition motif in ras GTPase-activating protein-binding protein 2 (G3BP2) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241055 cd12611, RRM1_NGR1_NAM8_like, RNA recognition motif 1 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240904 cd12458, RRM_AtC3H46_like, RNA recognition motif in Arabidopsis thaliana zinc finger CCCH domain-containing protein 46 (AtC3H46) and similar proteins Back     alignment and domain information
>gnl|CDD|241046 cd12602, RRM2_SF2_plant_like, RNA recognition motif 2 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240922 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 small nuclear ribonucleoprotein B" (U2B") and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|241070 cd12626, RRM1_IGF2BP2, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2) Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240871 cd12425, RRM4_PTBP1_like, RNA recognition motif 4 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240978 cd12534, RRM_SARFH, RNA recognition motif in Drosophila melanogaster RNA-binding protein cabeza and similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240795 cd12349, RRM2_SHARP, RNA recognition motif 2 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) Back     alignment and domain information
>gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240745 cd12299, RRM4_Prp24, RNA recognition motif 4 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|241105 cd12661, RRM3_hnRNPM, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240881 cd12435, RRM_GW182_like, RNA recognition motif in the GW182 family proteins Back     alignment and domain information
>gnl|CDD|240735 cd12289, RRM_LARP6, RNA recognition motif in La-related protein 6 (LARP6) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240922 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 small nuclear ribonucleoprotein B" (U2B") and similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240909 cd12463, RRM_G3BP1, RNA recognition motif found in ras GTPase-activating protein-binding protein 1 (G3BP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240834 cd12388, RRM1_RAVER, RNA recognition motif 1 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240898 cd12452, RRM_ARP_like, RNA recognition motif in yeast asparagine-rich protein (ARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240887 cd12441, RRM_Nup53_like, RNA recognition motif in nucleoporin Nup53 and similar proteins Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241069 cd12625, RRM1_IGF2BP1, RNA recognition motif 1 in vertebrate insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241034 cd12590, RRM2_PSF, RNA recognition motif 2 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240711 cd12265, RRM_SLT11, RNA recognition motif of pre-mRNA-splicing factor SLT11 and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|241048 cd12604, RRM_RALY, RNA recognition motif in vertebrate RNA-binding protein Raly Back     alignment and domain information
>gnl|CDD|220013 pfam08777, RRM_3, RNA binding motif Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator 1-beta (PGC-1-beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240738 cd12292, RRM2_La_like, RNA recognition motif 2 in La autoantigen (La or SS-B or LARP3), La-related protein 7 (LARP7 or PIP7S) and similar proteins Back     alignment and domain information
>gnl|CDD|241044 cd12600, RRM2_SRSF4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240931 cd12487, RRM1_DND1, RNA recognition motif 1 found in vertebrate dead end protein homolog 1 (DND1) Back     alignment and domain information
>gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology motif kinase 1 (UHMK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240985 cd12541, RRM2_La, RNA recognition motif 2 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241035 cd12591, RRM2_p54nrb, RNA recognition motif 2 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240703 cd12257, RRM1_RBM26_like, RNA recognition motif 1 in vertebrate RNA-binding protein 26 (RBM26) and similar proteins Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240735 cd12289, RRM_LARP6, RNA recognition motif in La-related protein 6 (LARP6) and similar proteins Back     alignment and domain information
>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins Back     alignment and domain information
>gnl|CDD|240680 cd12234, RRM1_AtRSp31_like, RNA recognition motif in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|241101 cd12657, RRM1_hnRNPM, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240889 cd12443, RRM_MCM3A_like, RNA recognition motif in 80 kDa MCM3-associated protein (Map80) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 593
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 100.0
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 100.0
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 100.0
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.96
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.95
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.95
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.94
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.94
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.93
smart0051764 PolyA C-terminal domain of Poly(A)-binding protein 99.93
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.93
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.93
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.93
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.92
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.92
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.91
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.91
PF0065872 PABP: Poly-adenylate binding protein, unique domai 99.9
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.89
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.88
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.88
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.86
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.85
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.83
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.82
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 99.76
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.75
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.74
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.73
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.73
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.73
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.72
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.7
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.7
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.69
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.69
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.67
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.63
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.6
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.57
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.54
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 99.54
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.53
KOG0122270 consensus Translation initiation factor 3, subunit 99.53
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.52
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.52
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.51
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.5
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.5
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.48
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.46
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.46
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.46
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.45
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.44
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.44
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.44
KOG0122270 consensus Translation initiation factor 3, subunit 99.44
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.43
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.43
PLN03120260 nucleic acid binding protein; Provisional 99.42
PLN03120260 nucleic acid binding protein; Provisional 99.4
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.4
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.39
KOG4207256 consensus Predicted splicing factor, SR protein su 99.38
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.38
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.36
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 99.35
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.35
PLN03213 759 repressor of silencing 3; Provisional 99.33
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.32
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.32
smart0036272 RRM_2 RNA recognition motif. 99.32
PLN03121243 nucleic acid binding protein; Provisional 99.32
smart0036272 RRM_2 RNA recognition motif. 99.32
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.31
KOG4207256 consensus Predicted splicing factor, SR protein su 99.3
PLN03213 759 repressor of silencing 3; Provisional 99.3
PLN03121243 nucleic acid binding protein; Provisional 99.3
smart0036071 RRM RNA recognition motif. 99.29
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.28
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.28
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.26
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.25
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.25
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.24
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.24
smart0036071 RRM RNA recognition motif. 99.23
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.23
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.22
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.2
KOG4660549 consensus Protein Mei2, essential for commitment t 99.18
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.17
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.17
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.14
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.13
smart0036170 RRM_1 RNA recognition motif. 99.13
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.11
smart0036170 RRM_1 RNA recognition motif. 99.1
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 99.09
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.04
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 99.03
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.02
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.98
KOG0226290 consensus RNA-binding proteins [General function p 98.97
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 98.94
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.93
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.9
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.84
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.81
KOG0226290 consensus RNA-binding proteins [General function p 98.77
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.76
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.73
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.71
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.68
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.66
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.66
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.65
KOG4210285 consensus Nuclear localization sequence binding pr 98.61
KOG0112975 consensus Large RNA-binding protein (RRM superfami 98.61
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.53
KOG0151 877 consensus Predicted splicing regulator, contains R 98.48
KOG4210285 consensus Nuclear localization sequence binding pr 98.48
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.46
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.45
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.34
KOG0151 877 consensus Predicted splicing regulator, contains R 98.32
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.3
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.27
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.24
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 98.22
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.2
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.03
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.03
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.98
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.92
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.83
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.68
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.66
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.63
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.58
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 97.56
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 97.55
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 97.51
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 97.47
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.47
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 97.3
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.26
KOG2314 698 consensus Translation initiation factor 3, subunit 97.22
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.21
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.02
KOG3152278 consensus TBP-binding protein, activator of basal 96.94
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.91
KOG1855484 consensus Predicted RNA-binding protein [General f 96.85
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.79
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.68
KOG3152278 consensus TBP-binding protein, activator of basal 96.63
KOG0943 3015 consensus Predicted ubiquitin-protein ligase/hyper 96.51
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.47
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.4
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.4
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 96.36
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.34
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 95.98
KOG2314 698 consensus Translation initiation factor 3, subunit 95.97
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.83
KOG1996378 consensus mRNA splicing factor [RNA processing and 95.76
KOG1855484 consensus Predicted RNA-binding protein [General f 95.72
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.72
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 94.95
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 94.87
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 94.65
PF15023166 DUF4523: Protein of unknown function (DUF4523) 94.18
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 94.17
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 94.14
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 94.09
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 93.94
KOG2068327 consensus MOT2 transcription factor [Transcription 93.71
KOG2135526 consensus Proteins containing the RNA recognition 93.66
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.37
KOG2068327 consensus MOT2 transcription factor [Transcription 93.23
KOG2591684 consensus c-Mpl binding protein, contains La domai 92.27
KOG2591 684 consensus c-Mpl binding protein, contains La domai 91.55
KOG2135526 consensus Proteins containing the RNA recognition 91.48
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 91.43
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.41
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 91.05
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 90.91
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 90.76
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.1
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 88.77
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 87.78
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 87.53
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 87.06
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 86.71
KOG2253668 consensus U1 snRNP complex, subunit SNU71 and rela 86.67
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 86.54
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 85.83
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 85.73
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 85.22
KOG2318650 consensus Uncharacterized conserved protein [Funct 80.16
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
Probab=100.00  E-value=1.4e-93  Score=785.48  Aligned_cols=531  Identities=56%  Similarity=0.875  Sum_probs=431.1

Q ss_pred             cEEEEeCCCCCCCHHHHHHHHhccCCeEEEEEEeeCCCCCcccEEEEEecCHHHHHHHHHhcCCcccCCcEEEEeeccCC
Q 007673           30 TSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRD  109 (593)
Q Consensus        30 ~sL~V~nLp~~~te~~L~~~F~~~G~V~~i~v~~d~~t~~s~g~AfV~F~s~e~A~~Al~~ln~~~i~g~~i~v~~s~~~  109 (593)
                      +||||||||.++||++|+++|++||.|.+|+||+|..|++++|||||+|.+.++|++|++.+|+..|.|++|+|+|+.++
T Consensus         1 ~sl~VgnLp~~vte~~L~~~F~~~G~v~~v~v~~d~~t~~s~G~afV~F~~~~~A~~Al~~ln~~~i~gk~i~i~~s~~~   80 (562)
T TIGR01628         1 ASLYVGDLDPDVTEAKLYDLFKPFGPVLSVRVCRDSVTRRSLGYGYVNFQNPADAERALETMNFKRLGGKPIRIMWSQRD   80 (562)
T ss_pred             CeEEEeCCCCCCCHHHHHHHHHhcCCEEEEEEEecCCCCCcceEEEEEECCHHHHHHHHHHhCCCEECCeeEEeeccccc
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCccEEEeCCCcccCHHHHHhhhccccceEEEEEeeCCCCCceeEEEEEEcCHHHHHHHHHHhCCceecCeeEE
Q 007673          110 PSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVF  189 (593)
Q Consensus       110 ~~~~~~~~~~lfV~nLp~~~t~~~L~~~f~~~G~i~~~~i~~~~~g~s~g~afV~F~~~e~A~~Al~~l~g~~~~g~~l~  189 (593)
                      ++.+..+.++|||+||+.++++++|+++|+.||.|.+|++..+.+|+++|||||+|.+.++|.+|++.+||..++++.+.
T Consensus        81 ~~~~~~~~~~vfV~nLp~~~~~~~L~~~F~~~G~i~~~~i~~~~~g~skg~afV~F~~~e~A~~Ai~~lng~~~~~~~i~  160 (562)
T TIGR01628        81 PSLRRSGVGNIFVKNLDKSVDNKALFDTFSKFGNILSCKVATDENGKSRGYGFVHFEKEESAKAAIQKVNGMLLNDKEVY  160 (562)
T ss_pred             ccccccCCCceEEcCCCccCCHHHHHHHHHhcCCcceeEeeecCCCCcccEEEEEECCHHHHHHHHHHhcccEecCceEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccccchhhhHHHHhhccccceeccCCCCCCCHHHHHHhhccCCCeeEEEEeeCCCCCcceeEEEEeCCHHHHHHHHHHH
Q 007673          190 VGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAVEAL  269 (593)
Q Consensus       190 v~~~~~~~~~~~~~~~~~~~~l~V~nlp~~~te~~l~~~F~~~G~v~~v~i~~~~~g~~~g~afV~F~~~e~A~~Ai~~l  269 (593)
                      |..+..+..+. ......+++|||+||+.++++++|+++|+.||.|.++.++++.+++++|||||+|.+.++|.+|++.+
T Consensus       161 v~~~~~~~~~~-~~~~~~~~~l~V~nl~~~~tee~L~~~F~~fG~i~~~~i~~~~~g~~~G~afV~F~~~e~A~~Av~~l  239 (562)
T TIGR01628       161 VGRFIKKHERE-AAPLKKFTNLYVKNLDPSVNEDKLRELFAKFGEITSAAVMKDGSGRSRGFAFVNFEKHEDAAKAVEEM  239 (562)
T ss_pred             Eeccccccccc-cccccCCCeEEEeCCCCcCCHHHHHHHHHhcCCEEEEEEEECCCCCcccEEEEEECCHHHHHHHHHHh
Confidence            98887766553 12345678999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccC----CceEEEeccccchHHHHHHhhhHHhhhhhhhcccccceeeeccCCCCCCHHHHHHHhhcCCCeeEEEEee
Q 007673          270 NGKKFD----DREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSIDDEKLKELFSEFGTITSCKVMR  345 (593)
Q Consensus       270 ~g~~~~----~~~l~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nl~~~~~~~~l~~~F~~~G~i~~v~i~~  345 (593)
                      ++..+.    ++.++|.++.++.++..++.........+......+++|||+||++++++++|+++|+.||.|++|+++.
T Consensus       240 ~g~~i~~~~~g~~l~v~~a~~k~er~~~~~~~~~~~~~~~~~~~~~~~l~V~nl~~~~~~~~L~~~F~~~G~i~~~~i~~  319 (562)
T TIGR01628       240 NGKKIGLAKEGKKLYVGRAQKRAEREAELRRKFEELQQERKMKAQGVNLYVKNLDDTVTDEKLRELFSECGEITSAKVML  319 (562)
T ss_pred             CCcEecccccceeeEeecccChhhhHHHHHhhHHhhhhhhhcccCCCEEEEeCCCCccCHHHHHHHHHhcCCeEEEEEEE
Confidence            999999    9999999999999888777777666666656677889999999999999999999999999999999999


Q ss_pred             CCCCCCccEEEEEeCCHHHHHHHHHHhCCceecCeeeEEEeccchHHHHHHHHHhhhcCCCCCCCCC-CCCCCCCCCCCC
Q 007673          346 DPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQMRPVAMGPS-VPPRMPMYPPGP  424 (593)
Q Consensus       346 ~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~~~~~l~v~~~~~~~~r~~~~~~~~~~~~~~~~~~~-~~~~~~~~p~~~  424 (593)
                      +.+|.++|||||+|.+.++|.+|+..|||+.++|++|+|.++++++.++...+.++.+..+....++ ..+..+.+    
T Consensus       320 d~~g~~~g~gfV~f~~~~~A~~A~~~~~g~~~~gk~l~V~~a~~k~~~~~~~~~~~~q~~~~~~~~~~~~p~~~~~----  395 (562)
T TIGR01628       320 DEKGVSRGFGFVCFSNPEEANRAVTEMHGRMLGGKPLYVALAQRKEQRRAHLQDQFMQLQPRMRQLPMGSPMGGAM----  395 (562)
T ss_pred             CCCCCcCCeEEEEeCCHHHHHHHHHHhcCCeeCCceeEEEeccCcHHHHHHHHHHHHHhhhhccCCCCCCCCCCcc----
Confidence            9999999999999999999999999999999999999999999999999888877766332111110 00000000    


Q ss_pred             CCCCCCCCCCCCCCCCCC---------CCCCCCCCCC--CCCCCC-CCCCCCCCC----CCCCC---CCCCCCCCCCC-C
Q 007673          425 SGLGQQFLYGQAPPAIIP---------PQMPPRGHAY--RYPLGR-NMQDFPFDM----GAGSM---LPVPVDMGAGI-P  484 (593)
Q Consensus       425 ~~~~~~~~~~~~pp~~~p---------p~~~p~~~~~--~~pp~~-~~p~~~~p~----~~~~~---~p~~~~~~~~~-p  484 (593)
                         +++.+++++++++++         ++++++++++  ..|.++ ++++.++++    +..++   ++.+|+++... |
T Consensus       396 ---~~p~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~  472 (562)
T TIGR01628       396 ---GQPPYYGQGPQQQFNGQPLGWPRMSMMPTPMGPGGPLRPNGLAPMNAVRAPSRNAQNAAQKPPMQPVMYPPNYQSLP  472 (562)
T ss_pred             ---cCCCccCCCCcccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCcccccccccccCCCcCCCccccCCC
Confidence               111111111100000         0000000000  000000 000000000    00000   00011111000 1


Q ss_pred             CCCC------CCCCCCccccchhhhcCCCHHHHHHHhhhcchhhHhhhcCCcccchhhhhcCCCHHHHHHhhCChHHHHH
Q 007673          485 RRDA------SVGQPMPITALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALKA  558 (593)
Q Consensus       485 ~~~~------~~~~~~~~~~~~~~l~~~~~~~~~~~lg~~l~~~v~~~~~~~a~kitgmll~~~~~~~~~~~~~~~~l~~  558 (593)
                      .++.      +..++.+.+.++++|++++|++||++|||+|||+|++++|++|+||||||||||++|||+||+|+++|++
T Consensus       473 ~~~~~~~~~~~~~~~~~~~~~~~~la~~~p~~q~~~lg~~~~~~~~~~~~~~~~~~tgm~l~~~~~~~~~~~~~~~~~~~  552 (562)
T TIGR01628       473 LSQDLPQPQSTASQGGQNKKLAQVLASATPQMQKQVLGERLFPLVEAIEPALAAKITGMLLEMDNSELLHLLESPELLKS  552 (562)
T ss_pred             CCcccccccCCccccccchhHHHHHhhCCHHHHHHHHHHHhHHHHHhhChhhcCcceEEEecCCHHHHHHHhcCHHHHHH
Confidence            0000      0011112356889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHH
Q 007673          559 KVAEAMEVLR  568 (593)
Q Consensus       559 ~v~~a~~~l~  568 (593)
                      ||+||++||+
T Consensus       553 ~~~~~~~~~~  562 (562)
T TIGR01628       553 KVDEALEVLK  562 (562)
T ss_pred             HHHHHHHHhC
Confidence            9999999984



There are four paralogs in Homo sapiens which are expressed in testis, platelets, broadly expressed, or of unknown tissue range.

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>smart00517 PolyA C-terminal domain of Poly(A)-binding protein Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00658 PABP: Poly-adenylate binding protein, unique domain; InterPro: IPR002004 The polyadenylate-binding protein (PABP) has a conserved C-terminal domain (PABC), which is also found in the hyperplastic discs protein (HYD) family of ubiquitin ligases that contain HECT domains (IPR000569 from INTERPRO) [] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 2e-64
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 9e-23
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 4e-19
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 2e-64
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 3e-22
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 2e-18
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 5e-33
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 3e-14
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 1e-31
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 4e-15
2dyd_A85 Solution Structure Of The Pabc Domain From Triticum 4e-29
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 4e-27
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-23
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-16
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 2e-16
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-06
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 6e-23
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 5e-17
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 3e-07
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 8e-23
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-15
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 9e-23
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 9e-16
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-06
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 8e-19
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-16
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 8e-15
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 1e-06
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 8e-19
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 5e-16
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 4e-14
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 8e-17
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 6e-16
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 6e-10
1g9l_A144 Solution Structure Of The Pabc Domain Of Human Poly 1e-15
1jgn_A98 Solution Structure Of The C-Terminal Pabc Domain Of 1e-15
1nmr_A85 Solution Structure Of C-Terminal Domain From Trypan 2e-15
3kus_A88 Crystal Structure Of The Mlle Domain Of Poly(A)-Bin 2e-15
3kur_A79 Crystal Structure Of The Mlle Domain Of Poly(A)-Bin 2e-15
3pth_A82 The Pabc1 Mlle Domain Bound To The Variant Pam2 Mot 2e-15
2rqg_B83 Structure Of Gspt1ERF3A-Pabc Length = 83 2e-15
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 2e-15
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 3e-11
2x04_A80 Crystal Structure Of The Pabc-Tnrc6c Complex Length 5e-15
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-13
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 6e-10
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 5e-13
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 6e-05
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 2e-12
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 6e-09
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 2e-12
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 7e-09
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 2e-12
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 7e-09
4ive_A98 Crystal Structure Of A Polyadenylate-binding Protei 2e-12
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 2e-12
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 7e-09
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-11
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-09
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-09
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 3e-11
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 2e-09
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 3e-09
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 5e-11
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 6e-11
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-07
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-07
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 6e-11
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 7e-11
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 1e-08
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 2e-10
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 2e-06
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-10
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 8e-05
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 2e-10
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 3e-08
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 2e-10
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 3e-07
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 4e-10
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 4e-04
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-09
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 5e-09
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 4e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 7e-09
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 2e-07
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 3e-07
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 4e-06
1x5o_A114 Solution Structure Of Rrm Domain In Rna Binding Mot 7e-09
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 8e-09
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 3e-06
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 1e-08
2khc_A118 Bruno Rrm3+ Length = 118 4e-08
2khc_A118 Bruno Rrm3+ Length = 118 4e-06
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 5e-08
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 4e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 5e-08
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 1e-07
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 9e-08
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 9e-08
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 8e-07
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-07
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-07
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 9e-04
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 1e-07
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 2e-07
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 3e-07
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 2e-07
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 3e-07
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 4e-07
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 4e-07
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 1e-06
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 3e-05
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 1e-06
2dh9_A89 Solution Structure Of The C-Terminal Rna Binding Do 1e-06
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 1e-06
1sxl_A97 Resonance Assignments And Solution Structure Of The 2e-06
1sxl_A97 Resonance Assignments And Solution Structure Of The 2e-06
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 2e-06
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 2e-06
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 2e-06
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 2e-06
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 2e-06
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 2e-06
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 1e-05
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 2e-06
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 1e-05
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 2e-06
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 8e-06
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 3e-06
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 9e-06
2dgv_A92 Solution Structure Of The Rna Binding Domain In Het 3e-06
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 3e-06
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 8e-06
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 3e-06
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 3e-06
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 2e-05
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 3e-06
2ghp_A292 Crystal Structure Of The N-Terminal 3 Rna Binding D 3e-06
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 4e-06
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 1e-04
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 4e-06
2dhg_A104 Solution Structure Of The C-Terminal Rna Recognitio 4e-06
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 5e-06
2dnh_A105 Solution Structure Of Rna Binding Domain In Bruno-L 5e-06
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 6e-06
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 7e-05
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 6e-06
3ulh_A107 Crystal Structure Of A Rna Binding Domain Of Tho Co 7e-06
3ulh_A107 Crystal Structure Of A Rna Binding Domain Of Tho Co 1e-04
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 7e-06
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 6e-04
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 8e-06
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 4e-05
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 9e-06
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-05
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 9e-06
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 1e-05
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 1e-05
3ntw_A65 Structure Of The Mlle Domain Of Edd In Complex With 2e-05
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 2e-05
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 6e-04
1i2t_A61 X-Ray Structure Of The Human Hyperplastic Discs Pro 2e-05
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 2e-05
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 4e-05
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 2e-05
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 3e-05
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 3e-05
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-05
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 6e-05
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-05
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 6e-05
2f3j_A177 The Solution Structure Of The Ref2-I Mrna Export Fa 4e-05
2f3j_A177 The Solution Structure Of The Ref2-I Mrna Export Fa 2e-04
3lqv_A115 Branch Recognition By Sf3b14 Length = 115 6e-05
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 6e-05
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 6e-05
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 4e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 8e-05
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 1e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 9e-04
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 8e-05
1fht_A116 Rna-Binding Domain Of The U1a Spliceosomal Protein 9e-05
1fht_A116 Rna-Binding Domain Of The U1a Spliceosomal Protein 7e-04
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 9e-05
2yka_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 9e-05
2yka_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 2e-04
2kt5_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 9e-05
2kt5_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 2e-04
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 1e-04
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 1e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 1e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 5e-04
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 1e-04
3bs9_A87 X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 1e-04
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 1e-04
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 1e-04
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-04
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 1e-04
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 1e-04
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 2e-04
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 2e-04
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 2e-04
2jvo_A108 Segmental Isotope Labeling Of Npl3 Length = 108 2e-04
1oia_A95 U1a Rnp Domain 1-95 Length = 95 2e-04
2f9d_A125 2.5 Angstrom Resolution Structure Of The Spliceosom 2e-04
2u2f_A85 Solution Structure Of The Second Rna-Binding Domain 4e-04
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 4e-04
2fho_B87 Nmr Solution Structure Of The Human Spliceosomal Pr 5e-04
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 5e-04
2dk2_A97 Solution Structure Of Rrm Domain In Heterogeneous N 5e-04
2dgt_A92 Solution Structure Of The Second Rna Binding Domain 5e-04
1aud_A101 U1a-Utrrna, Nmr, 31 Structures Length = 101 6e-04
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 6e-04
2cph_A107 Solution Structure Of The C-Terminal Rna Recognitio 6e-04
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 7e-04
2osq_A74 Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length 7e-04
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 9e-04
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure

Iteration: 1

Score = 243 bits (620), Expect = 2e-64, Method: Compositional matrix adjust. Identities = 115/187 (61%), Positives = 146/187 (78%), Gaps = 2/187 (1%) Query: 14 GPNGVAAGASGNQFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGY 73 GP G + S + SLYVGDL +VT++ LY+ FS G +LS+RVCRD+ TRRSLGY Sbjct: 1 GPLG-SMNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGY 59 Query: 74 GYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPSIRKSGTGNIFIKNLDKSIDHKA 133 YVN+ PADA RALD +NF + K +RIM+S RDPS+RKSG GNIFIKNLDKSID+KA Sbjct: 60 AYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKA 119 Query: 134 LHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDKQVFVGHF 193 L+DTFS+FGNILSCK+ D +G SKG+GFV FE +E+A+ AI+K+NGML+ND++VFVG F Sbjct: 120 LYDTFSAFGNILSCKVVCDENG-SKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRF 178 Query: 194 LRKQERE 200 ++ERE Sbjct: 179 KSRKERE 185
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2DYD|A Chain A, Solution Structure Of The Pabc Domain From Triticum Aevestium Poly(A)-Binding Protein Length = 85 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1G9L|A Chain A, Solution Structure Of The Pabc Domain Of Human Poly(A) Binding Protein Length = 144 Back     alignment and structure
>pdb|1JGN|A Chain A, Solution Structure Of The C-Terminal Pabc Domain Of Human Poly(A)-Binding Protein In Complex With The Peptide From Paip2 Length = 98 Back     alignment and structure
>pdb|1NMR|A Chain A, Solution Structure Of C-Terminal Domain From Trypanosoma Cruzi Poly(A)-Binding Protein Length = 85 Back     alignment and structure
>pdb|3KUS|A Chain A, Crystal Structure Of The Mlle Domain Of Poly(A)-Binding Protein In Complex With The Binding Region Of Paip2 Length = 88 Back     alignment and structure
>pdb|3KUR|A Chain A, Crystal Structure Of The Mlle Domain Of Poly(A)-Binding Protein Length = 79 Back     alignment and structure
>pdb|3PTH|A Chain A, The Pabc1 Mlle Domain Bound To The Variant Pam2 Motif Of Larp4b Length = 82 Back     alignment and structure
>pdb|2RQG|B Chain B, Structure Of Gspt1ERF3A-Pabc Length = 83 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2X04|A Chain A, Crystal Structure Of The Pabc-Tnrc6c Complex Length = 80 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|4IVE|A Chain A, Crystal Structure Of A Polyadenylate-binding Protein 3 (pabpc3) From Homo Sapiens At 2.30 A Resolution Length = 98 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1X5O|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 1 Length = 114 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DH9|A Chain A, Solution Structure Of The C-Terminal Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 89 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|2DGV|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein M Length = 92 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2GHP|A Chain A, Crystal Structure Of The N-Terminal 3 Rna Binding Domains Of The Yeast Splicing Factor Prp24 Length = 292 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2DHG|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif In Trna Selenocysteine Associated Protein Length = 104 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2DNH|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 5 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|3ULH|A Chain A, Crystal Structure Of A Rna Binding Domain Of Tho Complex Subunit 4 Protein (Thoc4) From Homo Sapiens At 2.54 A Resolution Length = 107 Back     alignment and structure
>pdb|3ULH|A Chain A, Crystal Structure Of A Rna Binding Domain Of Tho Complex Subunit 4 Protein (Thoc4) From Homo Sapiens At 2.54 A Resolution Length = 107 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|3NTW|A Chain A, Structure Of The Mlle Domain Of Edd In Complex With A Pam2 Peptide From Paip1 Length = 65 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|1I2T|A Chain A, X-Ray Structure Of The Human Hyperplastic Discs Protein: An Ortholog Of The C-Terminal Domain Of Poly(A)-Binding Protein Length = 61 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2F3J|A Chain A, The Solution Structure Of The Ref2-I Mrna Export Factor (Residues 1-155) Length = 177 Back     alignment and structure
>pdb|2F3J|A Chain A, The Solution Structure Of The Ref2-I Mrna Export Factor (Residues 1-155) Length = 177 Back     alignment and structure
>pdb|3LQV|A Chain A, Branch Recognition By Sf3b14 Length = 115 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|1FHT|A Chain A, Rna-Binding Domain Of The U1a Spliceosomal Protein U1a117, Nmr, 43 Structures Length = 116 Back     alignment and structure
>pdb|1FHT|A Chain A, Rna-Binding Domain Of The U1a Spliceosomal Protein U1a117, Nmr, 43 Structures Length = 116 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2YKA|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hvs Orf57 Peptide Length = 124 Back     alignment and structure
>pdb|2YKA|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hvs Orf57 Peptide Length = 124 Back     alignment and structure
>pdb|2KT5|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hsv-1 Icp27 Peptide Length = 124 Back     alignment and structure
>pdb|2KT5|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hsv-1 Icp27 Peptide Length = 124 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|3BS9|A Chain A, X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2JVO|A Chain A, Segmental Isotope Labeling Of Npl3 Length = 108 Back     alignment and structure
>pdb|1OIA|A Chain A, U1a Rnp Domain 1-95 Length = 95 Back     alignment and structure
>pdb|2F9D|A Chain A, 2.5 Angstrom Resolution Structure Of The Spliceosomal Protein P14 Bound To Region Of Sf3b155 Length = 125 Back     alignment and structure
>pdb|2U2F|A Chain A, Solution Structure Of The Second Rna-Binding Domain Of Hu2af65 Length = 85 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|2FHO|B Chain B, Nmr Solution Structure Of The Human Spliceosomal Protein Complex P14-Sf3b155 Length = 87 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2DK2|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleoprotein R (Hnrnp R) Length = 97 Back     alignment and structure
>pdb|2DGT|A Chain A, Solution Structure Of The Second Rna Binding Domain In Rna- Binding Protein 30 Length = 92 Back     alignment and structure
>pdb|1AUD|A Chain A, U1a-Utrrna, Nmr, 31 Structures Length = 101 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|2OSQ|A Chain A, Nmr Structure Of Rrm-1 Of Yeast Npl3 Protein Length = 74 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-128
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-83
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-53
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-46
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-125
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-96
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-98
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-62
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 9e-61
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-22
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-84
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-63
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-52
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-25
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-22
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-82
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 3e-73
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-62
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-27
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-23
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-79
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-63
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-50
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-25
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-18
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-78
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-76
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-60
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-14
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 6e-74
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-68
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-55
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-27
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-73
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-71
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-58
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-28
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-73
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-61
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 7e-51
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-24
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 9e-63
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-49
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-45
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-17
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-59
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-48
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 8e-48
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-15
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-51
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 7e-38
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 7e-35
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 6e-24
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-49
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-32
1x5o_A114 RNA binding motif, single-stranded interacting pro 5e-30
1x5o_A114 RNA binding motif, single-stranded interacting pro 7e-17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 9e-47
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-36
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-29
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-20
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-46
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-32
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-32
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-23
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-44
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-35
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 6e-27
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-19
2kt5_A124 RNA and export factor-binding protein 2; chaperone 8e-44
2kt5_A124 RNA and export factor-binding protein 2; chaperone 4e-31
2kt5_A124 RNA and export factor-binding protein 2; chaperone 5e-24
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-20
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 1e-43
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-30
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-18
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-14
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-43
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 4e-31
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-27
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 9e-21
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-42
2f3j_A177 RNA and export factor binding protein 2; RRM domai 9e-28
2f3j_A177 RNA and export factor binding protein 2; RRM domai 4e-23
2f3j_A177 RNA and export factor binding protein 2; RRM domai 6e-18
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-42
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-38
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-30
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-18
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-09
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-42
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-41
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 7e-38
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-18
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 9e-13
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-40
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-28
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 5e-28
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 1e-21
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-40
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-29
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-23
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-20
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-40
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-38
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-33
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 5e-40
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-27
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-22
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-17
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-39
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-30
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-27
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-22
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-39
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-38
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-29
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-17
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 7e-39
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-34
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-25
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-18
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 8e-39
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-31
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-20
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-16
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-38
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-22
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 6e-21
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-16
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-38
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-36
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-30
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 6e-17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-11
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-36
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-30
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-29
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-20
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-35
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-31
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-26
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 4e-21
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-35
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 5e-28
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-23
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-13
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-35
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-22
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-21
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 3e-17
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-35
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 6e-33
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-19
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-15
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 8e-35
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-30
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-29
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-15
1ifw_A92 Polyadenylate-binding protein, cytoplasmic and nuc 2e-33
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 3e-33
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 7e-32
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 4e-22
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 7e-18
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-32
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 3e-23
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-21
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-20
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 9e-32
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-25
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-24
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 7e-19
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-31
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-31
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-23
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 8e-23
2div_A99 TRNA selenocysteine associated protein; structural 3e-31
2div_A99 TRNA selenocysteine associated protein; structural 2e-18
2div_A99 TRNA selenocysteine associated protein; structural 1e-17
2div_A99 TRNA selenocysteine associated protein; structural 1e-16
2dyd_A85 Poly(A)-binding protein; alpha helical protein, RN 1e-29
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-29
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-27
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-18
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-17
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-29
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-25
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-19
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-16
1nmr_A85 Poly(A)-binding protein; all helical domain, pepti 6e-29
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-29
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-28
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-24
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-21
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 9e-29
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-24
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-22
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 6e-18
3kuj_A88 Polyadenylate-binding protein 1; protein-protein c 1e-28
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 6e-28
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-22
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-19
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-17
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-28
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-27
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-20
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-19
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 9e-28
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-21
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-19
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-16
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-27
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-24
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-23
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-21
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-27
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-22
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-19
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-17
1x4e_A85 RNA binding motif, single-stranded interacting pro 5e-27
1x4e_A85 RNA binding motif, single-stranded interacting pro 9e-25
1x4e_A85 RNA binding motif, single-stranded interacting pro 6e-23
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-19
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-27
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-21
3q2s_C229 Cleavage and polyadenylation specificity factor S; 7e-17
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-27
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 6e-26
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 3e-25
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 7e-20
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 9e-27
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-25
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 6e-18
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 8e-18
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-26
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-19
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 7e-18
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 4e-26
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-22
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 6e-20
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-19
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-25
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-24
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-15
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-11
1i2t_A61 HYD protein; four alpha-helical domain, ligase; 1. 1e-25
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-25
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-22
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-20
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 9e-19
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-25
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-20
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 5e-18
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-17
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-25
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 3e-22
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-19
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-19
1x5p_A97 Negative elongation factor E; structure genomics, 3e-25
1x5p_A97 Negative elongation factor E; structure genomics, 9e-21
1x5p_A97 Negative elongation factor E; structure genomics, 5e-20
1x5p_A97 Negative elongation factor E; structure genomics, 2e-14
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-25
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-21
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-19
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-19
1g9l_A144 Polyadenylate-binding protein 1; all-helical domai 4e-25
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-25
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-23
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-23
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-22
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-25
2cpj_A99 Non-POU domain-containing octamer-binding protein; 9e-23
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-18
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-24
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 5e-21
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-20
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-18
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-24
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-20
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-19
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 8e-19
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-24
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-23
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-18
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 8e-18
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-24
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-20
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-19
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-18
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-24
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-20
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-18
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-18
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-23
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-20
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-19
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 4e-18
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-23
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 4e-20
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 8e-20
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-19
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-23
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-20
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 4e-19
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-18
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-23
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 3e-19
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 4e-18
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-17
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-23
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 1e-18
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 5e-18
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 8e-18
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-23
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-20
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-18
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-18
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-23
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-20
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 8e-20
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-17
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-23
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 6e-18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 8e-17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-22
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-20
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-18
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-18
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-22
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 9e-19
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 7e-18
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-17
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-22
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-19
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-16
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-14
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-22
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-18
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-16
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-15
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-22
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-20
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-16
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 5e-16
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-22
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-17
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 4e-16
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-16
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-22
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-20
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-18
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-17
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-22
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-19
3p5t_L90 Cleavage and polyadenylation specificity factor S; 6e-17
3p5t_L90 Cleavage and polyadenylation specificity factor S; 1e-16
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-22
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 5e-21
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-19
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-17
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-21
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 5e-17
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 1e-16
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-16
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-21
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-17
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-13
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-13
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-21
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-18
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-15
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-21
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-16
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 9e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-12
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-21
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-17
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-13
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-21
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-19
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-17
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-16
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-21
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 6e-20
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-18
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-16
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-21
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 8e-20
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-18
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 5e-15
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 7e-21
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-17
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 3e-14
2i2y_A150 Fusion protein consists of immunoglobin G- binding 8e-21
2i2y_A150 Fusion protein consists of immunoglobin G- binding 8e-19
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 9e-13
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-20
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-15
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-20
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-14
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-11
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-20
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 7e-15
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-14
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-20
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-18
3n9u_C156 Cleavage and polyadenylation specificity factor S; 6e-17
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-20
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-16
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 6e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-20
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-17
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-13
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-20
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-17
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-16
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-16
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 5e-20
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-15
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 9e-14
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 9e-20
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-10
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-09
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-07
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-19
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 1e-16
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-14
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-14
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-19
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-17
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-15
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-13
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-19
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-16
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 9e-14
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 2e-12
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-19
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-15
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-14
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-13
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-19
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-18
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-17
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-16
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 8e-19
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-16
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 4e-16
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-15
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-18
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 8e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-14
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-18
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-12
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-11
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 6e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-18
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-18
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-18
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-17
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 2e-18
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-16
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-13
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 1e-11
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-18
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 8e-15
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-12
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 6e-12
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-18
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 6e-15
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-13
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-11
2krb_A81 Eukaryotic translation initiation factor 3 subunit 4e-18
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 8e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 8e-18
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-14
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-12
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-17
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 9e-17
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 9e-12
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-11
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 1e-17
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 1e-15
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-11
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 6e-11
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-17
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-15
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-14
2la6_A99 RNA-binding protein FUS; structural genomics, nort 7e-14
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-17
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 8e-16
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-11
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-10
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-17
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 7e-13
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 1e-12
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-17
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-15
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 7e-11
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-17
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 4e-13
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-12
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 7e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 6e-17
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-16
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 3e-12
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 7e-12
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-17
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-14
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-12
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-17
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 9e-12
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-11
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 7e-17
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-16
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-15
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-15
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-16
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-14
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-13
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-12
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-16
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-12
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-16
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 4e-13
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 2e-10
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-08
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-16
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 7e-13
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-12
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 6e-12
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-16
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-12
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-11
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-07
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-16
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-10
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 8e-16
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-14
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 4e-13
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-15
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 4e-09
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 9e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-15
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 5e-12
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 9e-11
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 2e-09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-15
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 4e-14
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-11
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 1e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-15
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 4e-11
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-08
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 6e-15
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-11
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 8e-15
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 3e-11
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-08
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-14
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 3e-12
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 6e-12
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-11
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-14
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-11
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-14
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-12
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-11
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 5e-11
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 8e-14
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-11
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 5e-09
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-13
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-12
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-09
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-09
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-13
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 8e-12
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-09
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 6e-09
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-13
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-12
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-10
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 3e-13
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 9e-11
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-10
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-13
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-09
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 5e-13
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 5e-12
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-10
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-10
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 9e-13
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-12
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 5e-12
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-12
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-10
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 6e-09
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 1e-08
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 6e-12
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-08
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 8e-07
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-06
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 8e-12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-10
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 5e-09
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 1e-08
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-11
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 6e-09
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-08
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 3e-08
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 6e-11
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-10
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-08
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-10
2dnl_A114 Cytoplasmic polyadenylation element binding protei 8e-07
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-10
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 6e-08
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-07
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 2e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-10
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-08
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-08
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 8e-08
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 5e-09
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-07
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 6e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-08
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 7e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-08
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 1e-05
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-05
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-08
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 6e-08
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 4e-08
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 6e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 2e-05
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 6e-08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 8e-08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 8e-08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 3e-06
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 2e-07
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 6e-07
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 4e-04
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 1e-06
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 7e-05
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 8e-04
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 2e-06
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 4e-06
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 6e-04
2dit_A112 HIV TAT specific factor 1 variant; structural geno 7e-06
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-04
2dit_A112 HIV TAT specific factor 1 variant; structural geno 5e-04
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 9e-05
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 7e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 1e-04
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 2e-04
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 3e-04
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 6e-04
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 7e-04
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
 Score =  377 bits (969), Expect = e-128
 Identities = 61/328 (18%), Positives = 126/328 (38%), Gaps = 44/328 (13%)

Query: 70  SLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSHRDPS---IRKSGTGNIFIKNLD 126
           S+ YG+       D+ R LD                + +  +    R      + +KNL 
Sbjct: 1   SMEYGHHA---RPDSKRPLD-------EGSPAAAGLTSKKANEALTRNRELTTVLVKNLP 50

Query: 127 KSIDHKALHDTFSSFGNILSCKIATDGSGQSKGFGFVQFENKESAQNAIDKLNGMLINDK 186
           KS +   ++  F   G I+   +A     ++  F  ++F   + A  AI K + ++    
Sbjct: 51  KSYNQNKVYKYFKHCGPIIHVDVADS-LKKNFRFARIEFARYDGALAAITKTHKVV-GQN 108

Query: 187 QVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVM-RDGD 245
           ++ V H                  +++ N   S T  +++ +  +   +  ++ +     
Sbjct: 109 EIIVSHL-------------TECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRF 155

Query: 246 GKSKCFGFVNFENADDAAKAVEALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKET 305
             S+ F +++  + +DA   VE LNG K +        +    + ++             
Sbjct: 156 NTSRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVSNPLEKSKR-----------TD 204

Query: 306 VDKFQGLNLYIKNLGDSIDDEK-LKELFSEFGTITSCKVMRD--PSGISKGSGFVAFSTP 362
               +G  + I+NL   + DE  L+E F  FG+I    +         +    F+ F   
Sbjct: 205 SATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENK 264

Query: 363 EEASRALAEMNGKMIVSKPLYVAVAQRK 390
           + A RAL +MN  ++ ++ + V++A +K
Sbjct: 265 DSAERAL-QMNRSLLGNREISVSLADKK 291


>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1ifw_A Polyadenylate-binding protein, cytoplasmic and nuclear; all-helical domain, RNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.144.1.1 Length = 92 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dyd_A Poly(A)-binding protein; alpha helical protein, RNA binding protein; NMR {Triticum aestivum} Length = 85 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nmr_A Poly(A)-binding protein; all helical domain, peptide binding protein; NMR {Trypanosoma cruzi} SCOP: a.144.1.1 Length = 85 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3kuj_A Polyadenylate-binding protein 1; protein-protein complex, methylation, mRNA processing, mRNA nucleus, phosphoprotein, RNA-binding, spliceosome; 1.40A {Homo sapiens} PDB: 3ktr_A 3kui_A 3ktp_A 3kus_A* 3kut_A 3pkn_A 2rqg_B 2rqh_B 3kur_A 3pth_A 2x04_A Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1i2t_A HYD protein; four alpha-helical domain, ligase; 1.04A {Homo sapiens} SCOP: a.144.1.1 PDB: 3ntw_A Length = 61 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1g9l_A Polyadenylate-binding protein 1; all-helical domain, RNA binding protein; NMR {Homo sapiens} SCOP: a.144.1.1 PDB: 1jgn_A 1jh4_A Length = 144 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.98
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.97
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.97
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.97
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.97
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.97
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.97
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.97
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.96
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.96
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.96
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.96
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.96
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.96
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.96
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.96
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.95
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.95
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.95
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.95
2dyd_A85 Poly(A)-binding protein; alpha helical protein, RN 99.95
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.95
1ifw_A92 Polyadenylate-binding protein, cytoplasmic and nuc 99.95
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.95
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.94
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.94
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.94
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.94
1g9l_A144 Polyadenylate-binding protein 1; all-helical domai 99.94
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.94
3kuj_A88 Polyadenylate-binding protein 1; protein-protein c 99.94
1nmr_A85 Poly(A)-binding protein; all helical domain, pepti 99.94
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.94
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.93
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.93
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.93
1i2t_A61 HYD protein; four alpha-helical domain, ligase; 1. 99.91
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.84
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.83
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.81
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.8
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.8
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.79
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.78
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.78
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.78
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.77
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.77
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.77
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.76
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.76
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.76
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.76
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.76
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.76
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.75
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.75
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.75
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.75
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.75
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.75
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.75
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.75
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.74
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.74
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.74
2div_A99 TRNA selenocysteine associated protein; structural 99.74
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.74
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.74
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.74
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.74
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.74
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.74
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.74
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.74
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.73
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.73
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.73
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.73
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.73
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.73
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.73
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.73
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.72
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.72
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.72
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.72
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.72
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.72
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.72
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.72
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.71
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.71
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.71
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.71
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.71
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.71
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.71
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.71
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.71
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.71
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.71
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.71
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.7
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.7
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.7
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.7
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.7
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.7
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.7
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.7
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.7
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.7
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.7
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.69
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.69
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.69
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.69
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.69
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.69
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.69
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.69
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.69
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.69
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.69
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.69
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.69
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.69
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.69
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.69
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.69
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.69
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.69
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.69
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.69
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.68
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.68
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.68
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.68
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.68
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.68
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.68
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.68
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.68
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.68
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.68
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.68
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.68
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.68
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.67
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.67
2dis_A109 Unnamed protein product; structural genomics, RRM 99.67
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.67
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.67
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.67
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.67
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.67
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.67
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.67
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.67
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.67
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.67
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.67
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.67
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.67
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.67
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.66
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.66
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.66
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.66
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.66
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.66
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.66
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.66
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.66
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.66
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.66
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.66
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.66
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.66
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.66
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.66
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.65
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.65
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.65
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.65
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.65
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.65
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.65
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.65
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.65
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.65
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.65
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.65
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.65
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.65
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.65
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.65
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.65
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.65
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.64
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.64
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.64
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.64
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.64
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.64
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.64
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.64
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.64
2div_A99 TRNA selenocysteine associated protein; structural 99.64
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.64
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.64
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.64
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.64
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.64
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.64
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.64
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.64
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.64
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.64
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.63
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.63
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.63
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.63
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.63
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.63
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.63
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.63
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.63
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.63
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.63
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.63
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.62
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.62
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.62
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.62
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.62
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.62
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.62
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.62
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.62
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.62
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.62
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.62
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.62
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.62
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.61
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.61
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.61
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.61
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.61
1x5p_A97 Negative elongation factor E; structure genomics, 99.61
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.61
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.61
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.61
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.61
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.61
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.61
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.4
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.61
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.61
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.61
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.61
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.6
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.6
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.6
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.6
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.6
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.6
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.6
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.6
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.6
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.6
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.6
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.59
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.59
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.59
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.59
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.59
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.59
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.59
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.59
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.59
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.59
2dis_A109 Unnamed protein product; structural genomics, RRM 99.59
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.59
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.59
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.58
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.58
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.58
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.58
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.58
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.58
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.58
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.57
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.57
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.57
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.57
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.57
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.56
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.56
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.56
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.33
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.55
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.55
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.55
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.55
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.55
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.55
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.55
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.55
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.55
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.54
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.54
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.54
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.54
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.54
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.54
1x5p_A97 Negative elongation factor E; structure genomics, 99.54
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.53
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.53
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.53
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.53
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.53
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.53
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.53
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.52
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.52
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.52
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.51
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.51
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.5
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.5
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.5
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.49
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.47
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.47
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.46
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.45
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.45
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.44
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.44
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.44
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.43
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.43
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.4
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.39
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.38
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.38
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.34
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.34
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.26
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.24
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.22
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.19
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.19
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.02
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.02
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.9
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.89
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.8
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.79
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.7
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.69
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.5
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.98
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.86
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.75
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.58
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.43
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.29
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.17
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.84
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.73
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.62
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.49
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.41
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.29
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.28
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.56
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.75
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.67
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 93.61
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 92.62
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 83.48
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
Probab=100.00  E-value=3e-43  Score=353.35  Aligned_cols=255  Identities=21%  Similarity=0.314  Sum_probs=230.6

Q ss_pred             CccEEEEeCCCCCCCHHHHHHHHhccCCeEEEEEEeeCCCCCcccEEEEEecCHHHHHHHHHhcCCcccCCcEEEEeecc
Q 007673           28 LTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMYSH  107 (593)
Q Consensus        28 ~~~sL~V~nLp~~~te~~L~~~F~~~G~V~~i~v~~d~~t~~s~g~AfV~F~s~e~A~~Al~~ln~~~i~g~~i~v~~s~  107 (593)
                      .+++|||+|||+++|+++|+++|+.|| |.++++      ++++|||||+|.+.++|.+|++.+|+..+.|+.|+|.|+.
T Consensus        21 ~~~~l~V~nLp~~~te~~l~~~F~~~G-i~~~~~------~~~~g~afV~f~~~~~A~~A~~~l~~~~~~g~~i~v~~~~   93 (284)
T 3smz_A           21 NRRKILIRGLPGDVTNQEVHDLLSDYE-LKYCFV------DKYKGTAFVTLLNGEQAEAAINAFHQSRLRERELSVQLQP   93 (284)
T ss_dssp             CCCEEEEECCCTTCCHHHHHHHTTTSC-EEEEEE------ETTTTEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECC
T ss_pred             CCCEEEEeCCCCCCCHHHHHHHHHHcC-CEEEEE------ecCCCEEEEEeCCHHHHHHHHHHcCCCeeCCeEEEEEecC
Confidence            468999999999999999999999999 999988      4677999999999999999999999999999999999865


Q ss_pred             CCCCCCCCCCccEEEeCCCcccCHHHHHhhhccccceEEEEEeeC-CCCCceeEEEEEEcCHHHHHHHHHHhCCceecCe
Q 007673          108 RDPSIRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATD-GSGQSKGFGFVQFENKESAQNAIDKLNGMLINDK  186 (593)
Q Consensus       108 ~~~~~~~~~~~~lfV~nLp~~~t~~~L~~~f~~~G~i~~~~i~~~-~~g~s~g~afV~F~~~e~A~~Al~~l~g~~~~g~  186 (593)
                      .        ..+|||+|||.++++++|+++|+.||.|.++.+..+ .+|.++|||||+|.+.++|.+|++.+++..+.|+
T Consensus        94 ~--------~~~l~v~nlp~~~t~~~l~~~f~~~G~i~~~~i~~~~~~g~~~g~afV~f~~~~~a~~A~~~l~~~~~~g~  165 (284)
T 3smz_A           94 T--------DALLCVANLPPSLTQQQFEELVRPFGSLERCFLVYSERTGQSKGYGFAEYMKKDSAARAKSDLLGKPLGPR  165 (284)
T ss_dssp             C--------SCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHHTTCEETTE
T ss_pred             C--------CCEEEEcCCCCcCCHHHHHHHHHhcCCeeEEEEEeeCCCCccceEEEEEECCHHHHHHHHHHhCCCEeCCc
Confidence            3        468999999999999999999999999999999988 5899999999999999999999999999999999


Q ss_pred             eEEeccccchhhhHHHHhhccccceeccCCCCCCCHHHHHHhhccCCCeeEEEEeeCCCCCcceeEEEEeCCHHHHHHHH
Q 007673          187 QVFVGHFLRKQERETVAIKTKFNNVFVKNLDESTTDEDLKKIFGEYGTITSAVVMRDGDGKSKCFGFVNFENADDAAKAV  266 (593)
Q Consensus       187 ~l~v~~~~~~~~~~~~~~~~~~~~l~V~nlp~~~te~~l~~~F~~~G~v~~v~i~~~~~g~~~g~afV~F~~~e~A~~Ai  266 (593)
                      .|.|.+...+....                                                                  
T Consensus       166 ~i~v~~a~~~~~~~------------------------------------------------------------------  179 (284)
T 3smz_A          166 TLYVHWTDAGQLTP------------------------------------------------------------------  179 (284)
T ss_dssp             ECEEEECCGGGCCT------------------------------------------------------------------
T ss_pred             EEEEEECCCCCCCc------------------------------------------------------------------
Confidence            99998764321100                                                                  


Q ss_pred             HHHCCCccCCceEEEeccccchHHHHHHhhhHHhhhhhhhcccccceeeeccCCCCC-CHHHHHHHhhcCCCeeEEEEee
Q 007673          267 EALNGKKFDDREWYVGKAQKKSEREQELKGQFEQAMKETVDKFQGLNLYIKNLGDSI-DDEKLKELFSEFGTITSCKVMR  345 (593)
Q Consensus       267 ~~l~g~~~~~~~l~v~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nl~~~~-~~~~l~~~F~~~G~i~~v~i~~  345 (593)
                                                              .....++|||+|||..+ ++++|+++|+.||.|.+++|+.
T Consensus       180 ----------------------------------------~~~~~~~l~v~nlp~~~~~~~~l~~~f~~~G~i~~v~i~~  219 (284)
T 3smz_A          180 ----------------------------------------ALLHSRCLCVDRLPPGFNDVDALCRALSAVHSPTFCQLAC  219 (284)
T ss_dssp             ----------------------------------------TTTSCSEEEEECCCTTCCCHHHHHHHTCSSSCCSEEEEEE
T ss_pred             ----------------------------------------ccCCccEEEEecCCcccCCHHHHHHHhhCCCCeEEEEEEE
Confidence                                                    00245689999999996 9999999999999999999999


Q ss_pred             CCCCCCccEEEEEeCCHHHHHHHHHHhCCceecCeeeEEEeccchHHHHHHHHHhhhc
Q 007673          346 DPSGISKGSGFVAFSTPEEASRALAEMNGKMIVSKPLYVAVAQRKEERRARLQAQFSQ  403 (593)
Q Consensus       346 ~~~g~~~g~afV~f~~~~~A~~A~~~~~~~~~~~~~l~v~~~~~~~~r~~~~~~~~~~  403 (593)
                      +.+|.++|+|||+|.+.++|.+|+..|||..++|++|.|.|+.++..++....++...
T Consensus       220 ~~~g~~~g~afV~f~~~~~A~~A~~~l~g~~~~g~~l~v~~a~~~~~~~~~~~~~~aa  277 (284)
T 3smz_A          220 GQDGQLKGFAVLEYETAEMAEEAQQQADGLSLGGSHLRVSFCAPGPPGRSMLAALIAA  277 (284)
T ss_dssp             CSSCCEEEEEEEECSSHHHHHHHHHHHTTCEETTEECEEEECCSSSCHHHHHHHHHHH
T ss_pred             CCCCCcccEEEEEeCCHHHHHHHHHHhCCCccCCeEEEEEEecCCCcccchhhhhhHH
Confidence            9999999999999999999999999999999999999999999998887776665544



>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2dyd_A Poly(A)-binding protein; alpha helical protein, RNA binding protein; NMR {Triticum aestivum} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1ifw_A Polyadenylate-binding protein, cytoplasmic and nuclear; all-helical domain, RNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.144.1.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1g9l_A Polyadenylate-binding protein 1; all-helical domain, RNA binding protein; NMR {Homo sapiens} SCOP: a.144.1.1 PDB: 1jgn_A 1jh4_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3kuj_A Polyadenylate-binding protein 1; protein-protein complex, methylation, mRNA processing, mRNA nucleus, phosphoprotein, RNA-binding, spliceosome; 1.40A {Homo sapiens} PDB: 3ktr_A 3kui_A 3ktp_A 3kus_A* 3kut_A 3pkn_A 2rqg_B 2rqh_B 3kur_A 3pth_A 2x04_A Back     alignment and structure
>1nmr_A Poly(A)-binding protein; all helical domain, peptide binding protein; NMR {Trypanosoma cruzi} SCOP: a.144.1.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1i2t_A HYD protein; four alpha-helical domain, ligase; 1.04A {Homo sapiens} SCOP: a.144.1.1 PDB: 3ntw_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 593
d1nmra_85 a.144.1.1 (A:) poly(A) binding protein {Protozoan 2e-32
d1g9la_144 a.144.1.1 (A:) poly(A) binding protein {Human (Hom 3e-32
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-28
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-27
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 6e-27
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-09
d1ifwa_92 a.144.1.1 (A:) poly(A) binding protein {Baker's ye 3e-28
d1i2ta_61 a.144.1.1 (A:) hyperplastic discs protein {Human ( 1e-26
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-22
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-19
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-19
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-15
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-22
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-21
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-18
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-13
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-21
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-18
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 7e-18
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 4e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 7e-20
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-17
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-16
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-15
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-18
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 3e-17
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 7e-15
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 1e-13
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-18
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-17
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 7e-16
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 1e-13
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-18
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-18
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 5e-16
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-14
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-18
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-16
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-16
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 8e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-18
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-15
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 3e-13
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-18
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 9e-17
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-15
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-14
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 7e-18
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-14
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 1e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-17
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-17
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-16
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-13
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-17
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-16
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-14
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-17
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 8e-16
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-12
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-17
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-14
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-13
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-17
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-15
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 8e-15
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-12
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 7e-17
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-15
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-11
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-16
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-13
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 7e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-16
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-14
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-14
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-13
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-16
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-15
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-14
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 4e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-16
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-15
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 5e-13
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-16
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-16
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 6e-14
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 2e-13
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-12
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 5e-16
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-14
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-11
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-16
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-14
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-12
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 6e-16
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-14
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-12
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-11
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 7e-16
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-14
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-14
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-11
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 9e-16
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 5e-10
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 4e-08
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-05
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 9e-16
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 6e-15
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 9e-14
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-13
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-15
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 8e-15
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-12
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-15
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-15
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-13
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-15
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 9e-13
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-12
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-15
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 5e-12
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 9e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-15
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-14
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-14
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-13
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-15
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-13
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-12
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-14
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 7e-13
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 3e-09
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-14
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 3e-13
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 3e-13
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 4e-11
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-14
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-13
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-11
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 6e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-14
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-12
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 7e-11
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-14
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 8e-14
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 9e-13
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-10
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-14
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-09
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 5e-14
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 9e-12
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 6e-14
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 6e-12
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-11
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 9e-14
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 4e-11
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-13
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 8e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 4e-12
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 8e-12
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-13
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 3e-13
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 8e-09
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 4e-07
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-13
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 4e-09
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 5e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-13
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 5e-11
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 8e-11
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-09
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 3e-13
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-12
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-11
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-08
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 3e-13
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-13
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-11
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-11
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-13
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 6e-12
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 9e-10
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 6e-13
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 1e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 6e-13
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 4e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 5e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 8e-13
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-11
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 3e-09
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-12
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 3e-11
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 3e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-12
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-11
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 3e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 8e-08
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-12
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 4e-11
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 4e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-12
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 5e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 3e-12
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-09
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 7e-09
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-12
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 7e-11
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-12
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-11
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-11
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-10
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-12
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 1e-09
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-08
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 5e-12
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 4e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 7e-12
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-09
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 6e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-11
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 4e-09
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 6e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-11
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 3e-10
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 9e-08
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-11
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-08
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-07
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 6e-11
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 3e-06
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 5e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-10
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 3e-10
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-09
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-09
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-10
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-10
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 3e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-10
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-10
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-09
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 2e-09
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 1e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 6e-06
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 2e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-09
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 9e-07
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 9e-09
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-08
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 1e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 4e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 9e-04
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-08
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 3e-08
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 9e-06
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 6e-04
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-08
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 2e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-07
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 9e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-07
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 5e-06
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.002
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 4e-07
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 6e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 5e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 6e-07
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 3e-06
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 1e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 6e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-06
>d1nmra_ a.144.1.1 (A:) poly(A) binding protein {Protozoan (Trypanosoma cruzi) [TaxId: 5693]} Length = 85 Back     information, alignment and structure

class: All alpha proteins
fold: PABP domain-like
superfamily: PABC (PABP) domain
family: PABC (PABP) domain
domain: poly(A) binding protein
species: Protozoan (Trypanosoma cruzi) [TaxId: 5693]
 Score =  117 bits (296), Expect = 2e-32
 Identities = 42/72 (58%), Positives = 52/72 (72%)

Query: 498 ALSTALANASPEQQRTLLGESLYPLVEQLERDAAAKVTGMLLEMDQTEVLHLLESPEALK 557
            LST LAN +PEQQ+ +LGE LY  +  +   AAAKVTGMLLEMD  E+L+LL++P  L 
Sbjct: 10  NLSTVLANLTPEQQKNVLGERLYNHIVAINPAAAAKVTGMLLEMDNGEILNLLDTPGLLD 69

Query: 558 AKVAEAMEVLRS 569
           AKV EA+EVL  
Sbjct: 70  AKVQEALEVLNR 81


>d1g9la_ a.144.1.1 (A:) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1ifwa_ a.144.1.1 (A:) poly(A) binding protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1i2ta_ a.144.1.1 (A:) hyperplastic discs protein {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.96
d1g9la_144 poly(A) binding protein {Human (Homo sapiens) [Tax 99.95
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.95
d1nmra_85 poly(A) binding protein {Protozoan (Trypanosoma cr 99.93
d1ifwa_92 poly(A) binding protein {Baker's yeast (Saccharomy 99.92
d1i2ta_61 hyperplastic discs protein {Human (Homo sapiens) [ 99.91
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.84
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.81
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.8
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.8
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.8
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.8
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.79
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.79
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.79
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.78
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.78
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.77
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.77
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.77
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.77
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.77
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.77
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.77
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.76
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.76
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.76
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.76
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.76
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.76
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.75
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.75
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.75
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.74
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.74
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.74
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.74
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.74
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.74
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.74
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.74
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.74
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.73
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.73
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.73
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.73
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.73
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.73
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.73
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.72
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.72
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.72
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.72
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.72
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.72
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.72
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.71
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.71
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.71
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.71
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.7
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.7
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.7
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.7
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.7
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.7
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.7
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.7
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.69
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.69
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.69
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.69
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.69
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.69
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.69
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.68
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.68
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.68
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.68
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.68
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.68
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.68
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.68
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.67
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.67
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.67
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.67
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.67
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.67
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.67
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.67
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.66
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.66
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.66
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.66
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.66
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.66
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.66
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.65
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.65
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.65
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.65
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.65
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.64
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.64
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.64
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.64
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.64
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.64
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.63
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.63
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.63
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.63
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.63
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.63
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.63
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.62
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.62
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.62
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.62
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.62
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.61
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.61
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.61
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.61
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.6
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.6
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.59
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.59
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.59
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.58
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.58
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.57
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.56
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.56
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.55
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.55
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.52
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.49
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.46
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.43
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.39
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.38
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.33
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.31
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.31
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.28
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.27
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.26
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.23
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.22
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.94
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.65
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.59
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.1
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.59
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.31
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 94.98
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.8
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=7.4e-29  Score=229.33  Aligned_cols=173  Identities=27%  Similarity=0.445  Sum_probs=153.3

Q ss_pred             CCCccEEEEeCCCCCCCHHHHHHHHhccCCeEEEEEEeeCCCCCcccEEEEEecCHHHHHHHHHhcCCcccCCcEEEEee
Q 007673           26 QFLTTSLYVGDLDFNVTDSQLYDLFSQVGQVLSVRVCRDLSTRRSLGYGYVNYANPADAARALDVLNFTPLNNKSIRIMY  105 (593)
Q Consensus        26 ~~~~~sL~V~nLp~~~te~~L~~~F~~~G~V~~i~v~~d~~t~~s~g~AfV~F~s~e~A~~Al~~ln~~~i~g~~i~v~~  105 (593)
                      +.+.++|||||||+++||++|+++|++||.|.+++++++..+++++|||||.|.+.++|.+|+. +++..+.++.+.+.+
T Consensus         3 p~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~-~~~~~~~~~~~~~~~   81 (183)
T d1u1qa_           3 PEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMN-ARPHKVDGRVVEPKR   81 (183)
T ss_dssp             CHHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHH-TCSCEETTEECEEEE
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHH-hcCCcccccchhhhh
Confidence            3456999999999999999999999999999999999999999999999999999999999999 456777888888776


Q ss_pred             ccCCCC----CCCCCCccEEEeCCCcccCHHHHHhhhccccceEEEEEeeC-CCCCceeEEEEEEcCHHHHHHHHHHhCC
Q 007673          106 SHRDPS----IRKSGTGNIFIKNLDKSIDHKALHDTFSSFGNILSCKIATD-GSGQSKGFGFVQFENKESAQNAIDKLNG  180 (593)
Q Consensus       106 s~~~~~----~~~~~~~~lfV~nLp~~~t~~~L~~~f~~~G~i~~~~i~~~-~~g~s~g~afV~F~~~e~A~~Al~~l~g  180 (593)
                      ......    ......++|||+|||.++|+++|+++|+.||.|..+.+..+ .+|.++|||||+|.+.++|.+|++ +++
T Consensus        82 ~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~Al~-~~~  160 (183)
T d1u1qa_          82 AVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVI-QKY  160 (183)
T ss_dssp             CCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHHHHT-SSC
T ss_pred             hhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHHHHH-hCC
Confidence            544332    22345678999999999999999999999999999999998 578999999999999999999996 788


Q ss_pred             ceecCeeEEeccccchhhhH
Q 007673          181 MLINDKQVFVGHFLRKQERE  200 (593)
Q Consensus       181 ~~~~g~~l~v~~~~~~~~~~  200 (593)
                      ..++|+.|.|.++.++.++.
T Consensus       161 ~~~~G~~i~V~~A~~k~e~~  180 (183)
T d1u1qa_         161 HTVNGHNCEVRKALSKQEMA  180 (183)
T ss_dssp             EEETTEEEEEEECCCHHHHH
T ss_pred             CeECCEEEEEEecCCccccc
Confidence            99999999999988776654



>d1g9la_ a.144.1.1 (A:) poly(A) binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nmra_ a.144.1.1 (A:) poly(A) binding protein {Protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1ifwa_ a.144.1.1 (A:) poly(A) binding protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ta_ a.144.1.1 (A:) hyperplastic discs protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure