Citrus Sinensis ID: 007864

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------
MASRIFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAHNSGTSNSHPSFDQKSVNVDASLVALVQLSSSMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPVGSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIRSARMCGY
cccHHHHHccccccccccHHHHHHcccccccccccccccccEEEcccccccccccccccccccccccEEEEcccccccHHccccccccccccccccEEEEEEEcccccEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEccccccccccEEEEcccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEcccHHccccccEEEEEEEEccccEEEEEEEEcccccccccccccHHHHHHHHHcccccccccEEEEEEcccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHcccEEEEEEEEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccEEcccccccHHHHHHHHHccccccccEEEEEEcccccc
cHHHHHHHHHHHHHHHHHHHHEEEHcHHHHcHccccHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHHHHccccHccccEEEEEEHcHHccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccccHEEEEEccccccccccEEEEccccccccccccccccEEccHHHHHHHHccccccccccccccccccEEcccccccHHccHcHEHHHcccHHHHHHHcHHHHHHHHHccHEEEEEcccccccEEEEEccccHHHHHcHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHccccccccccEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcEEEEEEEccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHcccccccEEEEEEcccccc
MASRIftkalncrnharscftrvfcsaatikdeyCSTRTAKAIAlkftppapideqplmglhgydFRHILLCARPQFSYLKMNleqrffspkqhqnVIEVEVCGLLSKFTVwqgkesidegrFITKCAEEAMLHIKRRHNPFGIVlryqvgdtptkQFLFALdastnfkgmpicfahnsgtsnshpsfdqksvnVDASLVALVQLsssmpiagppldtsqldiklqplmglhcfkldnillcsrrGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEkfepvgfvvgfpvgspekdtpkqFSQAHVKAFLSKldslpnfkgmpiclvneygtsknLAKRVKKFVEKdaknwsgpgsypstksfhTNRLQAKRQLRRFIsdvdssylppegcpnykppddKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSAClagddlrkggelhhKTLRTGLHHTEMKAVALGlislpdgmpvRVIRSARMCGY
masriftkalncrnharscfTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWqgkesidegRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAHNSGTSNSHPSFDQKSVNVDASLVALVQLSSSMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPVGSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVekdaknwsgpgsypstksfhTNRLQAKRQLRRFISDvdssylppegcpnykpPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALglislpdgmpvRVIRSARMCGY
MASRIFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAHNSGTSNSHPSFDQKSVNVDaslvalvqlsssMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKekfepvgfvvgfpvgspeKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIRSARMCGY
****IFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAH*****************VDASLVALVQL***********DTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPV*************AHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFV********************************FIS***********C*NYKPPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIR*******
***RIFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAH**************SVNVDASLVALVQLSSSMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPV****************KAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHT**LQAKRQLRRFI******************PDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIRSARMCGY
MASRIFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAHNSGTSNSHPSFDQKSVNVDASLVALVQLSSSMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPVGSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIRSARMCGY
**SRIFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAHN*******P*FD*KSVNVDASLVALVQLSSSMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPVGSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIRSARMCGY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRIFTKALNCRNHARSCFTRVFCSAATIKDEYCSTRTAKAIALKFTPPAPIDEQPLMGLHGYDFRHILLCARPQFSYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVWQGKESIDEGRFITKCAEEAMLHIKRRHNPFGIVLRYQVGDTPTKQFLFALDASTNFKGMPICFAHNSGTSNSHPSFDQKSVNVDASLVALVQLSSSMPIAGPPLDTSQLDIKLQPLMGLHCFKLDNILLCSRRGFWFLKLSLERRFFAANNYMTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVVGFPVGSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFIARLWAARRDVINGVVSIGEYVCVAEILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTIDLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGLISLPDGMPVRVIRSARMCGY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query587 2.2.26 [Sep-21-2011]
Q9C507 787 Putative pentatricopeptid yes no 0.120 0.090 0.356 0.0003
>sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E66 PE=3 SV=1 Back     alignment and function desciption
 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 42/87 (48%), Gaps = 16/87 (18%)

Query: 470 IKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFT-I 528
           IK   +V W+S+L                GFS NG   EA+ LF  M   Y+E NE T +
Sbjct: 465 IKHRSVVTWNSMLC---------------GFSQNGNSVEAISLFDYMYHSYLEMNEVTFL 509

Query: 529 DLCSACLAGDDLRKGGELHHKTLRTGL 555
            +  AC +   L KG  +HHK + +GL
Sbjct: 510 AVIQACSSIGSLEKGKWVHHKLIISGL 536

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query587
296084954 930 unnamed protein product [Vitis vinifera] 0.119 0.075 0.465 2e-08
225436291 906 PREDICTED: pentatricopeptide repeat-cont 0.119 0.077 0.465 2e-08
115446475 787 Os02g0529900 [Oryza sativa Japonica Grou 0.117 0.087 0.352 0.0001
125539724 787 hypothetical protein OsI_07491 [Oryza sa 0.117 0.087 0.352 0.0001
297743473630 unnamed protein product [Vitis vinifera] 0.151 0.141 0.351 0.0002
225459405595 PREDICTED: pentatricopeptide repeat-cont 0.172 0.169 0.282 0.0005
297740419501 unnamed protein product [Vitis vinifera] 0.224 0.263 0.242 0.0008
>gi|296084954|emb|CBI28363.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 67.8 bits (164), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 52/86 (60%), Gaps = 16/86 (18%)

Query: 470 IKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTI- 528
           +++PD   WS+L               ISG S NG +AEAL LF+ M+ D I+ANEFT  
Sbjct: 424 VEQPDTAPWSAL---------------ISGHSWNGCFAEALKLFRKMQFDGIKANEFTFT 468

Query: 529 DLCSACLAGDDLRKGGELHHKTLRTG 554
            +  ACLA ++LRKG ELH K LR+G
Sbjct: 469 SVILACLALENLRKGKELHCKILRSG 494

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225436291|ref|XP_002269762.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|115446475|ref|NP_001047017.1| Os02g0529900 [Oryza sativa Japonica Group] gi|49388326|dbj|BAD25438.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|113536548|dbj|BAF08931.1| Os02g0529900 [Oryza sativa Japonica Group] gi|125582364|gb|EAZ23295.1| hypothetical protein OsJ_06992 [Oryza sativa Japonica Group] gi|215696993|dbj|BAG90987.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125539724|gb|EAY86119.1| hypothetical protein OsI_07491 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297743473|emb|CBI36340.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459405|ref|XP_002284293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18520-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740419|emb|CBI30601.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query587
TAIR|locus:2098901783 AT3G61170 [Arabidopsis thalian 0.056 0.042 0.5 2.9e-05
TAIR|locus:2038603 868 AT2G27610 "AT2G27610" [Arabido 0.100 0.067 0.333 0.0004
TAIR|locus:2196583 866 ECB2 "EARLY CHLOROPLAST BIOGEN 0.161 0.109 0.274 0.00098
TAIR|locus:2098901 AT3G61170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 94 (38.1 bits), Expect = 2.9e-05, Sum P(2) = 2.9e-05
 Identities = 17/34 (50%), Positives = 26/34 (76%)

Query:   554 GL-HHTEMKAVALGLISLPDGMPVRVIRSARMCG 586
             GL +H+E  AVA GL+ +P G P+R+I++ R+CG
Sbjct:   695 GLAYHSEKLAVAFGLLVVPSGAPIRIIKNLRVCG 728
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196583 ECB2 "EARLY CHLOROPLAST BIOGENESIS2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query587
PRK00109138 PRK00109, PRK00109, Holliday junction resolvase-li 3e-09
COG0816141 COG0816, COG0816, Predicted endonuclease involved 3e-08
pfam03652134 pfam03652, UPF0081, Uncharacterized protein family 5e-08
smart0073299 smart00732, YqgFc, Likely ribonuclease with RNase 2e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 5e-04
>gnl|CDD|234639 PRK00109, PRK00109, Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information 
 Score = 55.5 bits (135), Expect = 3e-09
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 21/111 (18%)

Query: 265 MTIVALDVGKKYTGVAV-----WH-QGMEDIEAESTFFMEDMEEQMLNIKEKFEPVGFVV 318
             I+ LDVG K  GVAV        Q +E I+  +     D  +++  + ++++P G VV
Sbjct: 4   GRILGLDVGTKRIGVAVSDPLGGTAQPLETIKRNN--GTPDW-DRLEKLIKEWQPDGLVV 60

Query: 319 GFPV---GSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSK 366
           G P+   G+              + F ++L+    F G+P+ LV+E  ++ 
Sbjct: 61  GLPLNMDGTE------GPRTERARKFANRLEGR--F-GLPVVLVDERLSTV 102

Length = 138
>gnl|CDD|223886 COG0816, COG0816, Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>gnl|CDD|217659 pfam03652, UPF0081, Uncharacterized protein family (UPF0081) Back     alignment and domain information
>gnl|CDD|128971 smart00732, YqgFc, Likely ribonuclease with RNase H fold Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 587
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PF1304150 PPR_2: PPR repeat family 99.39
PF1304150 PPR_2: PPR repeat family 98.96
PRK11788389 tetratricopeptide repeat protein; Provisional 98.82
PRK11788389 tetratricopeptide repeat protein; Provisional 98.7
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.46
PF1285434 PPR_1: PPR repeat 98.45
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.38
KOG4422 625 consensus Uncharacterized conserved protein [Funct 98.38
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.35
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.32
PF1285434 PPR_1: PPR repeat 98.18
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.07
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.99
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.87
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.61
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.48
KOG4422 625 consensus Uncharacterized conserved protein [Funct 97.38
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.27
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 96.8
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 96.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 96.25
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 96.19
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.05
PRK10747398 putative protoheme IX biogenesis protein; Provisio 95.39
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 95.22
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 95.2
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 94.99
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 94.75
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 94.6
PF06239228 ECSIT: Evolutionarily conserved signalling interme 94.48
KOG1126638 consensus DNA-binding cell division cycle control 94.47
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 94.17
PRK10747398 putative protoheme IX biogenesis protein; Provisio 94.02
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 93.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 93.72
PF06239228 ECSIT: Evolutionarily conserved signalling interme 93.55
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 93.54
PRK12370553 invasion protein regulator; Provisional 93.36
PRK14574 822 hmsH outer membrane protein; Provisional 92.93
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 92.83
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 92.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 92.58
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 92.23
PRK14574 822 hmsH outer membrane protein; Provisional 91.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 91.83
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 91.39
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 91.23
COG0816141 Predicted endonuclease involved in recombination ( 90.62
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 90.16
TIGR02552135 LcrH_SycD type III secretion low calcium response 89.9
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 89.88
KOG2003840 consensus TPR repeat-containing protein [General f 89.18
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 89.18
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 89.14
KOG1129478 consensus TPR repeat-containing protein [General f 89.03
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 88.82
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 88.57
PRK15359144 type III secretion system chaperone protein SscB; 88.48
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 88.22
PRK00109138 Holliday junction resolvase-like protein; Reviewed 87.96
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 87.58
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 87.3
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 86.9
PRK10370198 formate-dependent nitrite reductase complex subuni 86.58
PF03704146 BTAD: Bacterial transcriptional activator domain; 86.43
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 86.38
PRK12370553 invasion protein regulator; Provisional 85.31
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 83.4
PF13170297 DUF4003: Protein of unknown function (DUF4003) 82.89
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 81.6
cd05804355 StaR_like StaR_like; a well-conserved protein foun 81.29
PRK11189296 lipoprotein NlpI; Provisional 80.79
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 80.6
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.3e-40  Score=387.78  Aligned_cols=255  Identities=20%  Similarity=0.226  Sum_probs=245.2

Q ss_pred             ccCchHHHHHHHHHHhcCCCCceEEeccccCCC-CCCCCccchhhHHHHHHcCCCCCCCCCCchhHHHHhhhcCCcHHH-
Q 007864          293 STFFMEDMEEQMLNIKEKFEPVGFVVGFPVGSP-EKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKNLAK-  370 (587)
Q Consensus       293 s~k~~eal~~~~~m~~~G~~Pd~~Ty~sLL~ac-~~g~l~~A~~l~~~M~~~Gl~pd~~tynipiaLI~~y~k~G~l~e-  370 (587)
                      .+...+++..+.+|...|+.||.+||+++|++| +.++++.+.++|.+|.+.|+.||+.+||   +||++|+++|++++ 
T Consensus       165 ~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n---~Li~~y~k~g~~~~A  241 (857)
T PLN03077        165 AGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVN---ALITMYVKCGDVVSA  241 (857)
T ss_pred             CCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHh---HHHHHHhcCCCHHHH
Confidence            346788888899999999999999999999995 7899999999999999999999999999   99999999999999 


Q ss_pred             -H-HhcccCCCCCcchhh-hhcccCCChhHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCHHHH---HHHHHHH---
Q 007864          371 -R-VKKFVEKDAKNWSGP-GSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFI---ARLWAAR---  441 (587)
Q Consensus       371 -r-Fd~M~~pd~vtYNsL-~gy~r~G~~eeAl~Lf~eM~~~~~~Gv~~~~~~~~g~~~~~~Pd~~Ty---L~aca~~---  441 (587)
                       + |++|+.||+++||+| .+|+++|++++|+++|++|.+.   |+              .||.+||   |.+|++.   
T Consensus       242 ~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~---g~--------------~Pd~~ty~~ll~a~~~~g~~  304 (857)
T PLN03077        242 RLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMREL---SV--------------DPDLMTITSVISACELLGDE  304 (857)
T ss_pred             HHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHc---CC--------------CCChhHHHHHHHHHHhcCCh
Confidence             6 999999999999999 9999999999999999999999   99              9999999   9999887   


Q ss_pred             ---HHHHHHHHh--hCccHHHHHHHHHH-----------HHHhcCCCCChhhhHHHHHhHHhhcCcCHHHHHHHHHhcCC
Q 007864          442 ---RDVINGVVS--IGEYVCVAEILVML-----------LFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGW  505 (587)
Q Consensus       442 ---~~lh~~m~k--~~pd~~vynaLI~~-----------~vFd~M~~pdvvTyNsLI~gy~km~~~dvvsLI~gy~k~G~  505 (587)
                         +++|..+.+  +.||..+||+||++           ++|++|.+||+++||+|               |.||+++|+
T Consensus       305 ~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~l---------------i~~~~~~g~  369 (857)
T PLN03077        305 RLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAM---------------ISGYEKNGL  369 (857)
T ss_pred             HHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHH---------------HHHHHhCCC
Confidence               899999988  99999999999999           99999999999999999               999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCHHHH-HHHHHHhcCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHH-----------HHhcCC
Q 007864          506 YAEALGLFQTMRVDYIEANEFTI-DLCSACLAGDDLRKGGELHHKTLRTGLHHTEMKAVALGL-----------ISLPDG  573 (587)
Q Consensus       506 ~~eAl~Lf~eM~~~Gi~PD~~Ty-sLL~ac~~~G~l~~A~~l~~~M~k~G~~pd~~vynaLIa-----------l~vF~~  573 (587)
                      +++|+++|++|.+.|+.||..|| ++|.+|++.|++++|.++|++|.+.|+.||..+||+||.           .++|++
T Consensus       370 ~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~  449 (857)
T PLN03077        370 PDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHN  449 (857)
T ss_pred             HHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHh
Confidence            99999999999999999999999 999999999999999999999999999999999999993           599999


Q ss_pred             CCCCCeeec
Q 007864          574 MPVRVIRSA  582 (587)
Q Consensus       574 M~~r~vvs~  582 (587)
                      |.++|+++|
T Consensus       450 m~~~d~vs~  458 (857)
T PLN03077        450 IPEKDVISW  458 (857)
T ss_pred             CCCCCeeeH
Confidence            999999875

>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query587
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 1e-07
1vhx_A150 Putative holliday junction resolvase; structural g 4e-07
1nu0_A138 Hypothetical protein YQGF; structural genomics, st 9e-06
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 56.4 bits (135), Expect = 2e-08
 Identities = 80/596 (13%), Positives = 179/596 (30%), Gaps = 189/596 (31%)

Query: 59  MGLHGYDFRHILLCARPQF-----SYLKMNLEQRFFSPKQHQNVIEVEVCGLLSKFTVW- 112
            G H Y ++ IL      F          ++ +   S ++  ++I  +     +    W 
Sbjct: 11  TGEHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWT 70

Query: 113 ---QGKESIDEGRFI----------------TKCAEEAM---LHIKRRHNPFG---IVLR 147
              + +E +   +F+                T+  + +M   ++I++R   +    +  +
Sbjct: 71  LLSKQEEMVQ--KFVEEVLRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAK 128

Query: 148 YQVGDTPT----KQFLFALDASTN--FKGMPICFAHNSGTSNSHPSFDQKSVNVDASLVA 201
           Y V         +Q L  L  + N    G+        G          K+      +  
Sbjct: 129 YNVSRLQPYLKLRQALLELRPAKNVLIDGVLGS-----G----------KTW-----VAL 168

Query: 202 LVQLSSSMPIAGPP-----LDTSQLDIK---LQPLMGLHCFKLDNILLCSRRGFWFLKLS 253
            V   S             L+    +     L+ L  L  +++D            +KL 
Sbjct: 169 DV-CLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKL-LYQIDPNWTSRSDHSSNIKLR 226

Query: 254 LE------RRFFAANNYMT--IVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDMEEQML 305
           +       RR   +  Y    +V L          V +   +   A   F   ++  ++L
Sbjct: 227 IHSIQAELRRLLKSKPYENCLLV-LL--------NVQNA--KAWNA---F---NLSCKIL 269

Query: 306 NIKEKFEPVGFVVGFPVGS--PEKDTPKQFSQAHVKAFLSK-----LDSLPN--FKGMP- 355
            +  +F+ V   +     +           +   VK+ L K        LP       P 
Sbjct: 270 -LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPR 328

Query: 356 -ICLVNEYGTSKNLAKRVKKFVEKDAKNWSGPGSYPSTKSFHTNRLQAKRQLRRFISDVD 414
            + ++         A+ ++  +     NW            H N  +    +   ++ ++
Sbjct: 329 RLSII---------AESIRDGLAT-WDNWK-----------HVNCDKLTTIIESSLNVLE 367

Query: 415 SSYLPPEGCPNYKP----PDD-----KFIARLWAA--RRDVINGVVSIGEYVCVAE---- 459
               P E    +      P         ++ +W    + DV+  V  + +Y  V +    
Sbjct: 368 ----PAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKE 423

Query: 460 --ILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVV---LVISGFSLNG---------W 505
             I +  ++L+   + +     +  ++H     R +V    +   F  +          +
Sbjct: 424 STISIPSIYLELKVKLE-----NEYALH-----RSIVDHYNIPKTFDSDDLIPPYLDQYF 473

Query: 506 Y------------AEALGLFQTMRVDY--IEA---NEFTIDLCSACLAGD--DLRK 542
           Y             E + LF+ + +D+  +E    ++ T    S  +      L+ 
Sbjct: 474 YSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKF 529
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Length = 98 Back     alignment and structure
>1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 Length = 150 Back     alignment and structure
>1nu0_A Hypothetical protein YQGF; structural genomics, structure 2 function project, S2F, unknown function; 1.60A {Escherichia coli} SCOP: c.55.3.8 PDB: 1nmn_A 1ovq_A Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query587
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.89
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.46
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.42
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.48
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.41
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.4
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.37
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.28
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.1
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.98
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.89
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.83
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 97.82
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.78
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.69
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 97.6
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.59
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 97.56
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 97.52
2gw1_A 514 Mitochondrial precursor proteins import receptor; 97.47
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 97.43
4eqf_A365 PEX5-related protein; accessory protein, tetratric 97.39
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 97.33
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 97.26
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.23
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 97.19
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 97.15
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 97.15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 97.13
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 97.02
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.96
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.89
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 96.86
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.85
3u4t_A272 TPR repeat-containing protein; structural genomics 96.82
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.74
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 96.73
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 96.64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.62
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.6
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 96.58
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.5
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 96.45
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.41
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 96.18
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 96.15
3u4t_A272 TPR repeat-containing protein; structural genomics 96.08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.44
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.42
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.37
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.33
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 95.25
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.18
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 95.08
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.01
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 94.89
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 94.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 94.82
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 94.73
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 94.71
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.71
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 94.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.4
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 94.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.32
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.19
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 94.19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 94.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 94.12
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.02
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 94.0
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 93.98
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 93.97
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 93.89
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 93.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 93.7
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 93.63
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 93.57
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 93.55
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 92.8
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 92.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 92.11
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 91.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 91.74
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 91.47
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 91.34
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 90.99
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 90.98
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 90.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 90.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 90.41
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 90.4
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 90.36
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 90.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 90.25
4g1t_A472 Interferon-induced protein with tetratricopeptide 89.92
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 89.9
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 89.87
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 89.83
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 89.79
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 89.47
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 89.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 89.16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 88.39
3u3w_A293 Transcriptional activator PLCR protein; ternary co 88.18
4g1t_A 472 Interferon-induced protein with tetratricopeptide 87.62
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 87.52
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 87.51
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 87.47
3u3w_A293 Transcriptional activator PLCR protein; ternary co 87.38
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 87.15
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 86.84
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 86.7
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 86.59
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 86.38
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 85.71
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 85.6
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 85.0
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 84.74
2kat_A115 Uncharacterized protein; NESG, structure, structur 84.46
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 84.45
2l6j_A111 TPR repeat-containing protein associated with HSP; 84.43
3k9i_A117 BH0479 protein; putative protein binding protein, 84.34
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 84.17
2l6j_A111 TPR repeat-containing protein associated with HSP; 83.69
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 83.5
3q49_B137 STIP1 homology and U box-containing protein 1; E3 83.43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 83.37
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 82.86
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 82.18
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 81.74
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 81.54
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 81.22
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 81.21
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 81.07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 80.93
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 80.33
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 80.12
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=99.94  E-value=2.2e-27  Score=260.61  Aligned_cols=172  Identities=9%  Similarity=0.021  Sum_probs=156.5

Q ss_pred             EeccccCC-CCCCCCccchhhHHHHHHcCCCCCCCCCCchhHHHHhhhcCCc---------HHH--H-Hhccc----CCC
Q 007864          317 VVGFPVGS-PEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSKN---------LAK--R-VKKFV----EKD  379 (587)
Q Consensus       317 Ty~sLL~a-c~~g~l~~A~~l~~~M~~~Gl~pd~~tynipiaLI~~y~k~G~---------l~e--r-Fd~M~----~pd  379 (587)
                      +++.+|++ |+.|++++|.++|++|.+.|+.||.++||   +||++|++.+.         +++  + |++|.    .||
T Consensus        28 ~l~~~id~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn---~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd  104 (501)
T 4g26_A           28 LLKQKLDMCSKKGDVLEALRLYDEARRNGVQLSQYHYN---VLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPN  104 (501)
T ss_dssp             HHHHHHHHTTTSCCHHHHHHHHHHHHHHTCCCCHHHHH---HHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCC
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHhHHH---HHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCC
Confidence            46777888 58999999999999999999999999999   99999998765         344  5 88886    478


Q ss_pred             CCcchhh-hhcccCCChhHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHhhCccHHHH
Q 007864          380 AKNWSGP-GSYPSTKSFHTNRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFIARLWAARRDVINGVVSIGEYVCVA  458 (587)
Q Consensus       380 ~vtYNsL-~gy~r~G~~eeAl~Lf~eM~~~~~~Gv~~~~~~~~g~~~~~~Pd~~TyL~aca~~~~lh~~m~k~~pd~~vy  458 (587)
                      .+|||+| .+|++.|++++|+++|++|.+.   |+                                             
T Consensus       105 ~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~---g~---------------------------------------------  136 (501)
T 4g26_A          105 EATFTNGARLAVAKDDPEMAFDMVKQMKAF---GI---------------------------------------------  136 (501)
T ss_dssp             HHHHHHHHHHHHHHTCHHHHHHHHHHHHHT---TC---------------------------------------------
T ss_pred             HHHHHHHHHHHHhcCCHHHHHHHHHHHHHc---CC---------------------------------------------
Confidence            8888888 8888888888888888888888   88                                             


Q ss_pred             HHHHHHHHHhcCCCCChhhhHHHHHhHHhhcCcCHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCHHHH-HHHHHHhcC
Q 007864          459 EILVMLLFLDGIKRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEFTI-DLCSACLAG  537 (587)
Q Consensus       459 naLI~~~vFd~M~~pdvvTyNsLI~gy~km~~~dvvsLI~gy~k~G~~~eAl~Lf~eM~~~Gi~PD~~Ty-sLL~ac~~~  537 (587)
                                   .||++|||+|               |.||++.|++++|+++|++|.+.|+.||..|| +||++|++.
T Consensus       137 -------------~Pd~~tyn~l---------------I~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~  188 (501)
T 4g26_A          137 -------------QPRLRSYGPA---------------LFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDT  188 (501)
T ss_dssp             -------------CCCHHHHHHH---------------HHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHT
T ss_pred             -------------CCccceehHH---------------HHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhC
Confidence                         4677889999               99999999999999999999999999999999 999999999


Q ss_pred             CCHHHHHHHHHHHHHcCCCCCHHHHHHHHH
Q 007864          538 DDLRKGGELHHKTLRTGLHHTEMKAVALGL  567 (587)
Q Consensus       538 G~l~~A~~l~~~M~k~G~~pd~~vynaLIa  567 (587)
                      |++++|.+++++|.+.|+.|+..||++|+.
T Consensus       189 g~~d~A~~ll~~Mr~~g~~ps~~T~~~l~~  218 (501)
T 4g26_A          189 KNADKVYKTLQRLRDLVRQVSKSTFDMIEE  218 (501)
T ss_dssp             TCHHHHHHHHHHHHHHTSSBCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhCCCcCHHHHHHHHH
Confidence            999999999999999999999999999984
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 587
d1iv0a_98 c.55.3.8 (A:) Hypothetical protein, YqgF homologue 5e-07
d1vhxa_140 c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Ba 5e-06
d1nu0a_138 c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Es 4e-04
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Putative Holliday junction resolvase RuvX
domain: Hypothetical protein, YqgF homologue
species: Thermus thermophilus [TaxId: 274]

 Score = 46.1 bits (109), Expect = 5e-07
 Identities = 25/105 (23%), Positives = 45/105 (42%), Gaps = 10/105 (9%)

Query: 265 MTIVALDVGKKYTGVAVWHQGMEDIEAESTFFMEDME---EQMLNIKEKFEPVGFVVGFP 321
           M + ALDVG+   G+AV  +G+           + +E   E +L+   +      VVG P
Sbjct: 1   MRVGALDVGEARIGLAVGEEGVPLASGRGYLVRKTLEEDVEALLDFVRREGLGKLVVGLP 60

Query: 322 VGSPEKDTPKQFSQAHVKAFLSKLDSLPNFKGMPICLVNEYGTSK 366
           + +  K++        V   +  L      +G+ + L +E  T+K
Sbjct: 61  LRTDLKESA---QAGKVLPLVEAL----RARGVEVELWDERFTTK 98
>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} Length = 140 Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query587
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.27
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus ther 95.74
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 94.73
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 94.7
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 94.34
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 93.28
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 92.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 91.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 91.3
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 88.89
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 88.48
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 87.9
d1vhxa_140 Hypothetical protein YrrK (RuvX) {Bacillus subtili 87.69
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.67
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.66
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 86.07
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 85.73
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 85.37
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 84.92
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 84.85
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 83.54
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 82.36
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.97  E-value=0.0029  Score=59.68  Aligned_cols=182  Identities=11%  Similarity=-0.027  Sum_probs=117.9

Q ss_pred             CCCCCccchhhHHHHHHcCCCCC-CCCCCchhHHHHhhhcCCcHHH--H-Hhccc---CCCCCcchhh-hhcccCCChhH
Q 007864          326 EKDTPKQFSQAHVKAFLSKLDSL-PNFKGMPICLVNEYGTSKNLAK--R-VKKFV---EKDAKNWSGP-GSYPSTKSFHT  397 (587)
Q Consensus       326 ~~g~l~~A~~l~~~M~~~Gl~pd-~~tynipiaLI~~y~k~G~l~e--r-Fd~M~---~pd~vtYNsL-~gy~r~G~~ee  397 (587)
                      ..|..+.|...+...++..  |+ ...+.   .+-..|...|++++  . |+...   ..+...|..+ ..|.+.|++++
T Consensus       181 ~~~~~~~A~~~~~~al~~~--p~~~~~~~---~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  255 (388)
T d1w3ba_         181 AQGEIWLAIHHFEKAVTLD--PNFLDAYI---NLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDL  255 (388)
T ss_dssp             TTTCHHHHHHHHHHHHHHC--TTCHHHHH---HHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHH
T ss_pred             ccCcHHHHHHHHHHHHHhC--cccHHHHH---HHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHH
Confidence            4677777777777776542  32 23444   66677777888777  4 55443   3455667777 88888888888


Q ss_pred             HHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCHHHH---HH-HHHHHHHHHHHHHhhCccHHHHHHHHHHHHHhc---C
Q 007864          398 NRLQAKRQLRRFISDVDSSYLPPEGCPNYKPPDDKFI---AR-LWAARRDVINGVVSIGEYVCVAEILVMLLFLDG---I  470 (587)
Q Consensus       398 Al~Lf~eM~~~~~~Gv~~~~~~~~g~~~~~~Pd~~Ty---L~-aca~~~~lh~~m~k~~pd~~vynaLI~~~vFd~---M  470 (587)
                      |++.|++..+.                   .|+....   +. .+.+..... ...               +.|+.   .
T Consensus       256 A~~~~~~al~~-------------------~p~~~~~~~~l~~~~~~~~~~~-~A~---------------~~~~~~~~~  300 (388)
T d1w3ba_         256 AIDTYRRAIEL-------------------QPHFPDAYCNLANALKEKGSVA-EAE---------------DCYNTALRL  300 (388)
T ss_dssp             HHHHHHHHHHT-------------------CSSCHHHHHHHHHHHHHHSCHH-HHH---------------HHHHHHHHH
T ss_pred             HHHHHHHHHHh-------------------CCCCHHHHHHHHHHHHHcCCHH-HHH---------------HHHHhhhcc
Confidence            88888877765                   5554332   11 111110000 000               11111   1


Q ss_pred             CCCChhhhHHHHHhHHhhcCcCHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCCCHH-HH-HHHHHHhcCCCHHHHHHHHH
Q 007864          471 KRPDLVAWSSLLSVHEEWASRRVVLVISGFSLNGWYAEALGLFQTMRVDYIEANEF-TI-DLCSACLAGDDLRKGGELHH  548 (587)
Q Consensus       471 ~~pdvvTyNsLI~gy~km~~~dvvsLI~gy~k~G~~~eAl~Lf~eM~~~Gi~PD~~-Ty-sLL~ac~~~G~l~~A~~l~~  548 (587)
                      ...+...|..+               ...|.+.|++++|++.|++..+  +.|+.. ++ .+-..+.+.|++++|.+.++
T Consensus       301 ~~~~~~~~~~l---------------~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~la~~~~~~g~~~~A~~~~~  363 (388)
T d1w3ba_         301 CPTHADSLNNL---------------ANIKREQGNIEEAVRLYRKALE--VFPEFAAAHSNLASVLQQQGKLQEALMHYK  363 (388)
T ss_dssp             CTTCHHHHHHH---------------HHHHHTTTCHHHHHHHHHHHTT--SCTTCHHHHHHHHHHHHTTTCCHHHHHHHH
T ss_pred             CCccchhhhHH---------------HHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            12455677777               8899999999999999998765  467654 55 88889999999999999999


Q ss_pred             HHHHcCCCCC-HHHHHHHH
Q 007864          549 KTLRTGLHHT-EMKAVALG  566 (587)
Q Consensus       549 ~M~k~G~~pd-~~vynaLI  566 (587)
                      +.++.  .|+ ...+..|+
T Consensus       364 ~al~l--~P~~~~a~~~lg  380 (388)
T d1w3ba_         364 EAIRI--SPTFADAYSNMG  380 (388)
T ss_dssp             HHHTT--CTTCHHHHHHHH
T ss_pred             HHHHh--CCCCHHHHHHHH
Confidence            98874  564 44555554
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vhxa_ c.55.3.8 (A:) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure