Citrus Sinensis ID: 008350
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 569 | 2.2.26 [Sep-21-2011] | |||||||
| Q9M548 | 626 | DNA (cytosine-5)-methyltr | yes | no | 0.957 | 0.870 | 0.583 | 0.0 | |
| Q9LXE5 | 624 | DNA (cytosine-5)-methyltr | no | no | 0.957 | 0.873 | 0.573 | 0.0 | |
| Q4W5Z4 | 877 | DNA (cytosine-5)-methyltr | yes | no | 0.181 | 0.117 | 0.341 | 6e-10 | |
| Q9Y6K1 | 912 | DNA (cytosine-5)-methyltr | yes | no | 0.181 | 0.112 | 0.333 | 1e-09 | |
| Q1LZ53 | 908 | DNA (cytosine-5)-methyltr | no | no | 0.181 | 0.113 | 0.333 | 1e-09 | |
| O88508 | 908 | DNA (cytosine-5)-methyltr | yes | no | 0.181 | 0.113 | 0.333 | 1e-09 | |
| Q9UBC3 | 853 | DNA (cytosine-5)-methyltr | no | no | 0.191 | 0.127 | 0.319 | 4e-09 | |
| O88509 | 859 | DNA (cytosine-5)-methyltr | no | no | 0.191 | 0.126 | 0.302 | 5e-09 | |
| P09915 | 503 | Modification methylase Rh | yes | no | 0.179 | 0.202 | 0.330 | 1e-08 | |
| P00476 | 439 | Modification methylase SP | yes | no | 0.179 | 0.232 | 0.339 | 3e-08 |
| >sp|Q9M548|DRM2_ARATH DNA (cytosine-5)-methyltransferase DRM2 OS=Arabidopsis thaliana GN=DRM2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 655 bits (1690), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 332/569 (58%), Positives = 418/569 (73%), Gaps = 24/569 (4%)
Query: 8 MGFSEEVVAKAIQENGEQ-NTDLILEALLKHSASSSASSSKSKLIDHFVGMGFSVDMVAK 66
MGF E++++AI+E G T +I++ + K+S+ A SSKSK IDHF+ MGF + V K
Sbjct: 71 MGFPVEMISRAIKETGPNVETSVIIDTISKYSSDCEAGSSKSKAIDHFLAMGFDEEKVVK 130
Query: 67 AIQENGEENTDSILETLLTY-SALGQSSQAEQHINSDQNSPELDGSFLDGFSDTDSFEGE 125
AIQE+GE+N ++I LL+ A + E+ D +S + D ++ D + D
Sbjct: 131 AIQEHGEDNMEAIANALLSCPEAKKLPAAVEEEDGIDWSSSDDDTNYTDMLNSDDE---- 186
Query: 126 EITNPDPDKEE---KLVSLASMGYSVQEASIAMERCGPNTSIAELTDFICAAQMAKAADA 182
DP+ E K+ SL MG+S EAS+A+ERCG N IAELTDF+CAAQMA+
Sbjct: 187 ----KDPNSNENGSKIRSLVKMGFSELEASLAVERCGENVDIAELTDFLCAAQMAREFSE 242
Query: 183 LLAEIED-KPRPKPSNGYHKHKKRRMLDYEKPPI---DEPIRLPNPMIGFGVPSNPDVIV 238
E E+ KPR H KKRR +P DEPIRLPNPMIGFGVP+ P +I
Sbjct: 243 FYTEHEEQKPR-------HNIKKRRFESKGEPRSSVDDEPIRLPNPMIGFGVPNEPGLIT 295
Query: 239 HRSLPEAAAGPPYFYYENVALAPKGVWDTISRFLYDVEPEFVDSKYFCAAARKRGYVHNL 298
HRSLPE A GPP+FYYENVAL PKGVW+TISR L+++ PEFVDSKYFC AARKRGY+HNL
Sbjct: 296 HRSLPELARGPPFFYYENVALTPKGVWETISRHLFEIPPEFVDSKYFCVAARKRGYIHNL 355
Query: 299 PIKNRHHLVPLPPQNIYEALPLSRKWWPSWDTRSHLNCLQTCIASAKLTERIRKALEECD 358
PI NR + P P I++A PLS++WWP WD R+ LNC+ TC SA+LT RIR ALE +
Sbjct: 356 PINNRFQIQPPPKYTIHDAFPLSKRWWPEWDKRTKLNCILTCTGSAQLTNRIRVALEPYN 415
Query: 359 GEPEPPHHVQKFVMDECRKWNLVWVGRNKLAPLEPDEVEMLLGFPKNHTRGGGISRTDRY 418
EPEPP HVQ++V+D+C+KWNLVWVG+NK APLEPDE+E +LGFPKNHTRGGG+SRT+R+
Sbjct: 416 EEPEPPKHVQRYVIDQCKKWNLVWVGKNKAAPLEPDEMESILGFPKNHTRGGGMSRTERF 475
Query: 419 KSLGNSFQVDTVAYHLSVLKEMYPDGINVLSLFSGIGGAEVALHRLGVRMKNVVSVDISE 478
KSLGNSFQVDTVAYHLSVLK ++P GINVLSLF+GIGG EVALHRL ++MK VVSV+IS+
Sbjct: 476 KSLGNSFQVDTVAYHLSVLKPIFPHGINVLSLFTGIGGGEVALHRLQIKMKLVVSVEISK 535
Query: 479 VNRNIVRSWWEQTNQKGTLIDFADVQQLDANRIEQMINAFGGFDLVIGGSPCNNLAGSNR 538
VNRNI++ +WEQTNQ G LI+F+D+Q L + IE ++ +GGFDLVIGGSPCNNLAG NR
Sbjct: 536 VNRNILKDFWEQTNQTGELIEFSDIQHLTNDTIEGLMEKYGGFDLVIGGSPCNNLAGGNR 595
Query: 539 HSRDGLEGKESSLFYDYFRILDLVKNMMQ 567
SR GLEG +SSLF++Y RIL++V+ M+
Sbjct: 596 VSRVGLEGDQSSLFFEYCRILEVVRARMR 624
|
Involved in de novo DNA methylation. Controls asymmetric and CpNpG methylation. Required for FWA gene silencing but not for the maintenance of SUP gene silencing. Functionally redundant to CMT3 to maintain non-CpG methylation. Involved in RNA-directed DNA methylation. Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 3EC: 7 |
| >sp|Q9LXE5|DRM1_ARATH DNA (cytosine-5)-methyltransferase DRM1 OS=Arabidopsis thaliana GN=DRM1 PE=4 SV=2 | Back alignment and function description |
|---|
| >sp|Q4W5Z4|DNM3A_CHICK DNA (cytosine-5)-methyltransferase 3A OS=Gallus gallus GN=DNMT3A PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Y6K1|DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens GN=DNMT3A PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q1LZ53|DNM3A_RAT DNA (cytosine-5)-methyltransferase 3A OS=Rattus norvegicus GN=Dnmt3a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O88508|DNM3A_MOUSE DNA (cytosine-5)-methyltransferase 3A OS=Mus musculus GN=Dnmt3a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9UBC3|DNM3B_HUMAN DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens GN=DNMT3B PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O88509|DNM3B_MOUSE DNA (cytosine-5)-methyltransferase 3B OS=Mus musculus GN=Dnmt3b PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P09915|MTBR_BPRH1 Modification methylase Rho11sI OS=Bacillus phage rho11s PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|P00476|MTBS_BPSPR Modification methylase SPRI OS=Bacillus phage SPR PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 569 | ||||||
| 330370545 | 636 | DNA (cytosine-5)-methyltransferase DRM1/ | 0.994 | 0.889 | 0.732 | 0.0 | |
| 255560872 | 686 | conserved hypothetical protein [Ricinus | 0.992 | 0.823 | 0.717 | 0.0 | |
| 341868933 | 603 | domain rearranged methyltransferase [Vit | 0.929 | 0.877 | 0.714 | 0.0 | |
| 359488834 | 616 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.929 | 0.858 | 0.712 | 0.0 | |
| 449446682 | 586 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.931 | 0.904 | 0.713 | 0.0 | |
| 356511676 | 590 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.913 | 0.881 | 0.690 | 0.0 | |
| 356573315 | 625 | PREDICTED: DNA (cytosine-5)-methyltransf | 0.915 | 0.833 | 0.683 | 0.0 | |
| 233770214 | 596 | DRM-type cytosine DNA-methyltransferase | 0.929 | 0.887 | 0.632 | 0.0 | |
| 233770216 | 596 | DRM-type cytosine DNA-methyltransferase | 0.927 | 0.885 | 0.632 | 0.0 | |
| 411012955 | 930 | DRM-type cytosine DNA-methyltransferase | 0.892 | 0.546 | 0.639 | 0.0 |
| >gi|330370545|gb|AEC12442.1| DNA (cytosine-5)-methyltransferase DRM1/2 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Score = 842 bits (2176), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 425/580 (73%), Positives = 494/580 (85%), Gaps = 14/580 (2%)
Query: 1 MIDHFVGMGFSEEVVAKAIQENGEQNTDLILEALLKHSASSSASSSKSKLIDHFVGMGFS 60
+IDHFVGMGFS+E+V KAI+ENGE+N++LILEALL++SASS ASSS SKLIDHFVGMGFS
Sbjct: 59 LIDHFVGMGFSQELVTKAIEENGEENSNLILEALLQYSASSLASSSNSKLIDHFVGMGFS 118
Query: 61 VDMVAKAIQENGEENTDSILETLLTYSALGQSSQAEQHINSDQNSPELDGSFLDGFSDTD 120
+MV KA+QENGE NTD+ILETLLTYSAL +S+ +QH +SD S + +G+FLD F+D D
Sbjct: 119 EEMVLKAVQENGEGNTDTILETLLTYSALEKSAPVQQHADSDDFSSDYEGNFLDDFTDID 178
Query: 121 SF-EGEEITNPDPDKEEKLVSLASMGYSVQEASIAMERCGPNTSIAELTDFICAAQMAKA 179
S + EEI NP D+E KL+ L MGYS EAS+AMERCGP++SIAELTDFICAAQMAKA
Sbjct: 179 SSSDTEEIINPGSDEESKLLYLTKMGYSEAEASVAMERCGPDSSIAELTDFICAAQMAKA 238
Query: 180 ADALLAEIEDKPRPKPSN-------GYHKHKKRRMLDYEKP---PIDEPIRLPNPMIGFG 229
ADAL + KP SN GY K+++ + EK +D+ + LPNPMIGFG
Sbjct: 239 ADALFPVEDRKPFCNGSNYNKRRNLGYDLWKRKKQMKLEKKLLNEVDDALHLPNPMIGFG 298
Query: 230 VPSNPDVIVHRSLPEAAAGPPYFYYENVALAPKGVWDTISRFLYDVEPEFVDSKYFCAAA 289
VP+ PD+I R+LPEAA GPPYFYYENVALAPKGVW TISRFLYDVEPEFVDSK+FCAAA
Sbjct: 299 VPTEPDLITQRTLPEAAVGPPYFYYENVALAPKGVWSTISRFLYDVEPEFVDSKFFCAAA 358
Query: 290 RKRGYVHNLPIKNRHHLVPLPPQNIYEALPLSRKWWPSWDTRSHLNCLQTCIASAKLTER 349
RKRGY+HNLPI+NR L+P PP+ I+EA PL+RKWWPSWD R+ LNC+QTC ASA+LTER
Sbjct: 359 RKRGYIHNLPIENRFPLLPFPPRTIHEAFPLTRKWWPSWDPRTKLNCIQTCTASARLTER 418
Query: 350 IRKALEECDGEPEPPHHVQKFVMDECRKWNLVWVGRNKLAPLEPDEVEMLLGFPKNHTRG 409
IRKALE DGEP P +VQK+V+DECRKWNLVWVGRNK+APLE DEVEMLLGFPKNHTRG
Sbjct: 419 IRKALEAYDGEP--PLNVQKYVLDECRKWNLVWVGRNKVAPLEADEVEMLLGFPKNHTRG 476
Query: 410 GGISRTDRYKSLGNSFQVDTVAYHLSVLKEMYPDGINVLSLFSGIGGAEVALHRLGVRMK 469
GG+SRTDRYKSLGNSFQVDTVAYHLSVLK+M+P GIN+LSLFSGIGGAEVALHRLG+ +K
Sbjct: 477 GGMSRTDRYKSLGNSFQVDTVAYHLSVLKDMFPGGINLLSLFSGIGGAEVALHRLGIPLK 536
Query: 470 NVVSVDISEVNRNIVRSWWEQTNQKGTLIDFADVQQLDANRIEQMINAFGGFDLVIGGSP 529
NVVSV+ISEVNRNIVR WWEQTNQ+GTLID ADVQ+L+ +R+EQ+++ FGGFDLV+GGSP
Sbjct: 537 NVVSVEISEVNRNIVRGWWEQTNQRGTLIDIADVQELNGDRLEQLMSRFGGFDLVVGGSP 596
Query: 530 CNNLAGSNRHSRDGLEGKESSLFYDYFRILDLVKNMMQRN 569
CNNLAGSNRH RDGLEGKESSLF+DY RILDLV+ MQRN
Sbjct: 597 CNNLAGSNRHHRDGLEGKESSLFFDYCRILDLVR-CMQRN 635
|
Source: Gossypium hirsutum Species: Gossypium hirsutum Genus: Gossypium Family: Malvaceae Order: Malvales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255560872|ref|XP_002521449.1| conserved hypothetical protein [Ricinus communis] gi|223539348|gb|EEF40939.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|341868933|gb|AEK98590.1| domain rearranged methyltransferase [Vitis amurensis] | Back alignment and taxonomy information |
|---|
| >gi|359488834|ref|XP_002273972.2| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449446682|ref|XP_004141100.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Cucumis sativus] gi|449515567|ref|XP_004164820.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356511676|ref|XP_003524549.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356573315|ref|XP_003554807.1| PREDICTED: DNA (cytosine-5)-methyltransferase DRM2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|233770214|gb|ACQ91180.1| DRM-type cytosine DNA-methyltransferase [Fragaria x ananassa] gi|233770218|gb|ACQ91182.1| DRM-type cytosine DNA-methyltransferase [Fragaria x ananassa] | Back alignment and taxonomy information |
|---|
| >gi|233770216|gb|ACQ91181.1| DRM-type cytosine DNA-methyltransferase [Fragaria x ananassa] | Back alignment and taxonomy information |
|---|
| >gi|411012955|gb|AFV99134.1| DRM-type cytosine DNA-methyltransferase 2 [Malus x domestica] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 569 | ||||||
| TAIR|locus:2222627 | 626 | DRM2 "domains rearranged methy | 0.963 | 0.875 | 0.561 | 6.6e-168 | |
| TAIR|locus:2150991 | 624 | DRM1 "domains rearranged methy | 0.961 | 0.876 | 0.543 | 1.1e-158 | |
| TAIR|locus:2089075 | 710 | DRM3 "domains rearranged methy | 0.583 | 0.467 | 0.414 | 2.5e-75 | |
| ZFIN|ZDB-GENE-990712-11 | 1448 | dnmt3 "DNA (cytosine-5-)-methy | 0.191 | 0.075 | 0.369 | 4.8e-09 | |
| ZFIN|ZDB-GENE-050314-2 | 1297 | dnmt5 "DNA (cytosine-5-)-methy | 0.191 | 0.084 | 0.336 | 4e-08 | |
| ZFIN|ZDB-GENE-050314-3 | 978 | dnmt3ab "DNA (cytosine-5-)-met | 0.181 | 0.105 | 0.367 | 4.7e-08 | |
| UNIPROTKB|J9PAS3 | 701 | DNMT3B "Uncharacterized protei | 0.191 | 0.155 | 0.319 | 4.7e-07 | |
| UNIPROTKB|F1PRE8 | 849 | DNMT3B "Uncharacterized protei | 0.191 | 0.128 | 0.319 | 6.1e-07 | |
| UNIPROTKB|F1S513 | 852 | DNMT3B "Uncharacterized protei | 0.191 | 0.127 | 0.319 | 6.1e-07 | |
| UNIPROTKB|F1PRE9 | 855 | DNMT3B "Uncharacterized protei | 0.191 | 0.127 | 0.319 | 6.1e-07 |
| TAIR|locus:2222627 DRM2 "domains rearranged methyltransferase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1633 (579.9 bits), Expect = 6.6e-168, P = 6.6e-168
Identities = 318/566 (56%), Positives = 402/566 (71%)
Query: 8 MGFSEEVVAKAIQENGEQ-NTDLILEXXXXXXXXXXXXXXXXXXIDHFVGMGFSVDMVAK 66
MGF E++++AI+E G T +I++ IDHF+ MGF + V K
Sbjct: 71 MGFPVEMISRAIKETGPNVETSVIIDTISKYSSDCEAGSSKSKAIDHFLAMGFDEEKVVK 130
Query: 67 AIQENGEENTDSILETLLTY-SALGQSSQAEQHINSDQNSPELDGSFLDGFSDTDSFEGE 125
AIQE+GE+N ++I LL+ A + E+ D +S + D ++ D + D E +
Sbjct: 131 AIQEHGEDNMEAIANALLSCPEAKKLPAAVEEEDGIDWSSSDDDTNYTDMLNSDD--EKD 188
Query: 126 EITNPDPDKEEKLVSLASMGYSVQEASIAMERCGPNTSIAELTDFICXXXXXXXXXXXXX 185
+N + K+ SL MG+S EAS+A+ERCG N IAELTDF+C
Sbjct: 189 PNSN---ENGSKIRSLVKMGFSELEASLAVERCGENVDIAELTDFLCAAQMAREFSEFYT 245
Query: 186 EIED-KPRPKPSNGYHKHKKRRMLDYEKPPI---DEPIRLPNPMIGFGVPSNPDVIVHRS 241
E E+ KPR H KKRR +P DEPIRLPNPMIGFGVP+ P +I HRS
Sbjct: 246 EHEEQKPR-------HNIKKRRFESKGEPRSSVDDEPIRLPNPMIGFGVPNEPGLITHRS 298
Query: 242 LPEAAAGPPYFYYENVALAPKGVWDTISRFLYDVEPEFVDSKYFCAAARKRGYVHNLPIK 301
LPE A GPP+FYYENVAL PKGVW+TISR L+++ PEFVDSKYFC AARKRGY+HNLPI
Sbjct: 299 LPELARGPPFFYYENVALTPKGVWETISRHLFEIPPEFVDSKYFCVAARKRGYIHNLPIN 358
Query: 302 NRHHLVPLPPQNIYEALPLSRKWWPSWDTRSHLNCLQTCIASAKLTERIRKALEECDGEP 361
NR + P P I++A PLS++WWP WD R+ LNC+ TC SA+LT RIR ALE + EP
Sbjct: 359 NRFQIQPPPKYTIHDAFPLSKRWWPEWDKRTKLNCILTCTGSAQLTNRIRVALEPYNEEP 418
Query: 362 EPPHHVQKFVMDECRKWNLVWVGRNKLAPLEPDEVEMLLGFPKNHTRGGGISRTDRYKSL 421
EPP HVQ++V+D+C+KWNLVWVG+NK APLEPDE+E +LGFPKNHTRGGG+SRT+R+KSL
Sbjct: 419 EPPKHVQRYVIDQCKKWNLVWVGKNKAAPLEPDEMESILGFPKNHTRGGGMSRTERFKSL 478
Query: 422 GNSFQVDTVAYHLSVLKEMYPDGINVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNR 481
GNSFQVDTVAYHLSVLK ++P GINVLSLF+GIGG EVALHRL ++MK VVSV+IS+VNR
Sbjct: 479 GNSFQVDTVAYHLSVLKPIFPHGINVLSLFTGIGGGEVALHRLQIKMKLVVSVEISKVNR 538
Query: 482 NIVRSWWEQTNQKGTLIDFADVQQLDANRIEQMINAFGGFDLVIGGSPCNNLAGSNRHSR 541
NI++ +WEQTNQ G LI+F+D+Q L + IE ++ +GGFDLVIGGSPCNNLAG NR SR
Sbjct: 539 NILKDFWEQTNQTGELIEFSDIQHLTNDTIEGLMEKYGGFDLVIGGSPCNNLAGGNRVSR 598
Query: 542 DGLEGKESSLFYDYFRILDLVKNMMQ 567
GLEG +SSLF++Y RIL++V+ M+
Sbjct: 599 VGLEGDQSSLFFEYCRILEVVRARMR 624
|
|
| TAIR|locus:2150991 DRM1 "domains rearranged methylase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089075 DRM3 "domains rearranged methyltransferase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-990712-11 dnmt3 "DNA (cytosine-5-)-methyltransferase 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050314-2 dnmt5 "DNA (cytosine-5-)-methyltransferase 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050314-3 dnmt3ab "DNA (cytosine-5-)-methyltransferase 3 alpha b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9PAS3 DNMT3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRE8 DNMT3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S513 DNMT3B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PRE9 DNMT3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9M548 | DRM2_ARATH | 2, ., 1, ., 1, ., 3, 7 | 0.5834 | 0.9578 | 0.8706 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1.37 | 0.946 |
| 3rd Layer | 2.1.1 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00020712001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (558 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 569 | |||
| COG0270 | 328 | COG0270, Dcm, Site-specific DNA methylase [DNA rep | 4e-12 | |
| cd00315 | 275 | cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specifi | 2e-10 | |
| pfam00145 | 320 | pfam00145, DNA_methylase, C-5 cytosine-specific DN | 4e-09 | |
| TIGR00675 | 315 | TIGR00675, dcm, DNA-methyltransferase (dcm) | 2e-07 |
| >gnl|CDD|223348 COG0270, Dcm, Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 67.5 bits (165), Expect = 4e-12
Identities = 31/137 (22%), Positives = 55/137 (40%), Gaps = 28/137 (20%)
Query: 445 INVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNRNIVRSWWEQTNQKGTLIDFADVQ 504
+ V+ LF+GIGG + G + V + +I + N I D++
Sbjct: 4 MKVIDLFAGIGGLSLGFEEAGFEI--VFANEIDPPAVATYK-----ANFPHGDIILGDIK 56
Query: 505 QLDANRIEQMINAFGGFDLVIGGSPCNN--LAGSNRHSRDGLEGKESSLFYDYFRILDL- 561
+LD + D++IGG PC + +AG R G + SLF ++ R+++
Sbjct: 57 ELDGEALR-----KSDVDVLIGGPPCQDFSIAGKRR----GYDDPRGSLFLEFIRLIEQL 107
Query: 562 ---------VKNMMQRN 569
VK ++
Sbjct: 108 RPKFFVLENVKGLLSSK 124
|
Length = 328 |
| >gnl|CDD|238192 cd00315, Cyt_C5_DNA_methylase, Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >gnl|CDD|215747 pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase | Back alignment and domain information |
|---|
| >gnl|CDD|233085 TIGR00675, dcm, DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 569 | |||
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 99.9 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 99.89 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 99.86 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 99.85 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 99.84 | |
| KOG0919 | 338 | consensus C-5 cytosine-specific DNA methylase [Tra | 99.3 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 99.18 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 99.11 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 99.05 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 99.04 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 98.94 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 98.74 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 98.57 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 98.46 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 98.32 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.26 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 98.13 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 98.1 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 97.98 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 97.98 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 97.97 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 97.93 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 97.92 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 97.86 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 97.86 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 97.83 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 97.73 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.62 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 97.61 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 97.61 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 97.6 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 97.6 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 97.52 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 97.49 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 97.49 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 97.46 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 97.44 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 97.39 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 97.38 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 97.35 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 97.32 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 97.27 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 97.24 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 97.2 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 97.2 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 97.2 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 97.19 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 97.17 | |
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 97.13 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 97.1 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 97.08 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 97.08 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 97.07 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 97.04 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 97.04 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.03 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 97.02 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 97.02 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 97.01 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 96.99 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 96.89 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 96.86 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 96.83 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 96.74 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 96.72 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 96.71 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.71 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 96.53 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 96.52 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 96.51 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 96.5 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 96.46 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 96.41 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 96.29 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 96.24 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 96.23 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 96.22 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 96.18 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 96.11 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 96.1 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 96.09 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 96.09 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 96.08 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 96.08 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 96.05 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 96.05 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 96.04 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 96.04 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 96.04 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 95.9 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 95.89 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 95.88 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.85 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 95.84 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 95.82 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 95.8 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 95.8 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 95.74 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 95.7 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 95.67 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 95.65 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 95.43 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 95.38 | |
| KOG0944 | 763 | consensus Ubiquitin-specific protease UBP14 [Postt | 95.38 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.35 | |
| KOG0944 | 763 | consensus Ubiquitin-specific protease UBP14 [Postt | 95.3 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 95.24 | |
| PRK00117 | 157 | recX recombination regulator RecX; Reviewed | 95.2 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 95.16 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 95.15 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 95.12 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 95.08 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 95.04 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 94.93 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 94.92 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 94.91 | |
| KOG1227 | 351 | consensus Putative methyltransferase [General func | 94.66 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 94.63 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 94.54 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 94.42 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 94.41 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 94.38 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 94.36 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 94.3 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 94.28 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 94.2 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 94.19 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 94.14 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 93.99 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 93.87 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 93.72 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 93.61 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 93.49 | |
| cd04708 | 202 | BAH_plantDCM_II BAH, or Bromo Adjacent Homology do | 93.46 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 93.26 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 93.15 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 93.12 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 93.08 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 93.02 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 93.0 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 92.96 | |
| PRK14135 | 263 | recX recombination regulator RecX; Provisional | 92.85 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 92.68 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 92.58 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 92.52 | |
| PRK04266 | 226 | fibrillarin; Provisional | 92.48 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 92.37 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 92.37 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 92.35 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 92.34 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 92.04 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 92.0 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 91.86 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 91.8 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 91.76 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 91.58 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 91.43 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 91.35 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 91.34 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 91.24 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 91.23 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 91.22 | |
| PRK14135 | 263 | recX recombination regulator RecX; Provisional | 91.15 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 91.07 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 91.05 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 90.98 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 90.93 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 90.83 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 90.79 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 90.58 | |
| PF07499 | 47 | RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 | 90.56 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 90.49 | |
| KOG1122 | 460 | consensus tRNA and rRNA cytosine-C5-methylase (nuc | 90.42 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 90.36 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 90.27 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 90.27 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 90.12 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 89.93 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 89.92 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 89.91 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 89.78 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 89.74 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 89.71 | |
| PRK00117 | 157 | recX recombination regulator RecX; Reviewed | 89.64 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 89.29 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 89.28 | |
| PLN02476 | 278 | O-methyltransferase | 88.97 | |
| PF02536 | 345 | mTERF: mTERF; InterPro: IPR003690 This family curr | 88.57 | |
| PLN02366 | 308 | spermidine synthase | 88.07 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 87.96 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 87.73 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 87.28 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 87.26 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 87.12 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 86.15 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 85.97 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 85.53 | |
| PF07499 | 47 | RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 | 85.43 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 85.26 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 84.41 | |
| KOG2078 | 495 | consensus tRNA modification enzyme [RNA processing | 83.69 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 83.62 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 83.59 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 83.01 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 82.88 | |
| KOG2198 | 375 | consensus tRNA cytosine-5-methylases and related e | 82.4 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 82.26 | |
| PF02086 | 260 | MethyltransfD12: D12 class N6 adenine-specific DNA | 81.89 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 81.75 | |
| PRK14134 | 283 | recX recombination regulator RecX; Provisional | 81.68 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 81.37 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 81.33 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 81.13 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 81.1 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 81.06 | |
| PRK14136 | 309 | recX recombination regulator RecX; Provisional | 80.64 | |
| PRK13699 | 227 | putative methylase; Provisional | 80.47 |
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
Probab=99.90 E-value=5.8e-24 Score=218.59 Aligned_cols=106 Identities=28% Similarity=0.596 Sum_probs=90.5
Q ss_pred cceeccccChhHHHHHHHHcCCceeEEEeeccCHHHHHHHHHHHhhcCCCCcccccccccccchhhHHHHHhccCCeeEE
Q 008350 445 INVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNRNIVRSWWEQTNQKGTLIDFADVQQLDANRIEQMINAFGGFDLV 524 (569)
Q Consensus 445 i~vlDLFSGiGG~slGl~~aGi~~k~V~avEid~~A~~t~~~n~~~~N~~~~~~~~~DI~~i~~~~l~~~~~~~g~~Dll 524 (569)
++++||||||||+++||+++|+ ++++|+|+++.|+++|+.|+. .+.++||++++...++. ++|||
T Consensus 1 ~~~~dlFsG~Gg~~~g~~~ag~--~~~~a~e~~~~a~~~y~~N~~-------~~~~~Di~~~~~~~l~~------~~D~l 65 (335)
T PF00145_consen 1 MKVIDLFSGIGGFSLGLEQAGF--EVVWAVEIDPDACETYKANFP-------EVICGDITEIDPSDLPK------DVDLL 65 (335)
T ss_dssp EEEEEET-TTTHHHHHHHHTTE--EEEEEEESSHHHHHHHHHHHT-------EEEESHGGGCHHHHHHH------T-SEE
T ss_pred CcEEEEccCccHHHHHHHhcCc--EEEEEeecCHHHHHhhhhccc-------ccccccccccccccccc------cceEE
Confidence 5799999999999999999996 699999999999999998753 57899999999887662 59999
Q ss_pred EEcCCCCccccCCCCCCCCCCCCccchHHHHHHHHHHhccccc
Q 008350 525 IGGSPCNNLAGSNRHSRDGLEGKESSLFYDYFRILDLVKNMMQ 567 (569)
Q Consensus 525 iGGpPCQ~fS~ag~~kr~Gl~d~r~~Lf~~~~rII~~vrPk~~ 567 (569)
+||||||+||.+|+ ++|.+|+|+.||++|+|+|+.+||++.
T Consensus 66 ~ggpPCQ~fS~ag~--~~~~~d~r~~L~~~~~~~v~~~~Pk~~ 106 (335)
T PF00145_consen 66 IGGPPCQGFSIAGK--RKGFDDPRNSLFFEFLRIVKELKPKYF 106 (335)
T ss_dssp EEE---TTTSTTST--HHCCCCHTTSHHHHHHHHHHHHS-SEE
T ss_pred EeccCCceEecccc--ccccccccchhhHHHHHHHhhccceEE
Confidence 99999999999996 668899999999999999999999973
|
1.1.37 from EC) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [, , ]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [, ]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A []: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.; GO: 0003677 DNA binding, 0006306 DNA methylation; PDB: 4DA4_A 3PT6_B 3AV6_A 3AV5_A 3AV4_A 3PT9_A 1DCT_A 3LX6_A 3ME5_A 2QRV_A .... |
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >KOG0919 consensus C-5 cytosine-specific DNA methylase [Transcription] | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK00117 recX recombination regulator RecX; Reviewed | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >KOG1227 consensus Putative methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK14135 recX recombination regulator RecX; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK14135 recX recombination regulator RecX; Provisional | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK00117 recX recombination regulator RecX; Reviewed | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF02536 mTERF: mTERF; InterPro: IPR003690 This family currently contains one sequence of known function human mitochondrial transcription termination factor (mTERF), a multizipper protein but binds to DNA as a monomer, with evidence pointing to intramolecular leucine zipper interactions [] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2078 consensus tRNA modification enzyme [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PRK14134 recX recombination regulator RecX; Provisional | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK14136 recX recombination regulator RecX; Provisional | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 569 | ||||
| 2qrv_A | 295 | Structure Of Dnmt3a-Dnmt3l C-Terminal Domain Comple | 3e-10 | ||
| 1dct_A | 324 | Dna (Cytosine-5) Methylase From Haeiii Covalently B | 6e-06 | ||
| 3ubt_Y | 331 | Crystal Structure Of C71s Mutant Of Dna Cytosine-5 | 1e-04 | ||
| 3g7u_A | 376 | Crystal Structure Of Putative Dna Modification Meth | 5e-04 |
| >pdb|2QRV|A Chain A, Structure Of Dnmt3a-Dnmt3l C-Terminal Domain Complex Length = 295 | Back alignment and structure |
|
| >pdb|1DCT|A Chain A, Dna (Cytosine-5) Methylase From Haeiii Covalently Bound To Dna Length = 324 | Back alignment and structure |
| >pdb|3UBT|Y Chain Y, Crystal Structure Of C71s Mutant Of Dna Cytosine-5 Methyltransferase M.Haeiii Bound To Dna Length = 331 | Back alignment and structure |
| >pdb|3G7U|A Chain A, Crystal Structure Of Putative Dna Modification Methyltransferase Encoded Within Prophage Cp-933r (E.Coli) Length = 376 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
Score = 114 bits (286), Expect = 2e-28
Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 13/134 (9%)
Query: 430 VAYHLSVLKEMYPDGINVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNRNIVRSWWE 489
+H+ K I VLSLF GI + L LG+++ ++ ++ E + +
Sbjct: 5 HHHHMPAEKRK---PIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITV-----G 56
Query: 490 QTNQKGTLIDFADVQQLDANRIEQMINAFGGFDLVIGGSPCNNLAGSNRHSRDGLEGKES 549
+G ++ DV+ + I++ +G FDLVIGGSPCN+L+ N R GL
Sbjct: 57 MVRHQGKIMYVGDVRSVTQKHIQE----WGPFDLVIGGSPCNDLSIVNPA-RKGLYEGTG 111
Query: 550 SLFYDYFRILDLVK 563
LF++++R+L +
Sbjct: 112 RLFFEFYRLLHDAR 125
|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Length = 343 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Length = 327 | Back alignment and structure |
|---|
| >1dct_A Protein (modification methylase HAEIII); enzyme, cytosine methylase, transferase/DNA complex; HET: DNA C49 5CM; 2.80A {Haemophilus influenzae biotypeaegyptius} SCOP: c.66.1.26 Length = 324 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Length = 376 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Length = 327 | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Length = 482 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 230 | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Length = 230 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 569 | |||
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 99.91 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 99.91 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 99.89 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 99.88 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 99.87 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 99.86 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 99.86 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 99.86 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 99.86 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 99.85 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 99.83 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 99.78 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 99.75 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 99.72 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 99.39 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 99.16 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 98.95 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 98.89 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 98.68 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 98.67 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 98.55 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 98.52 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 98.51 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 98.46 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 98.44 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 98.4 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 98.34 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 98.28 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 98.24 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 98.22 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 98.2 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 98.18 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 98.17 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 98.1 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 98.01 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 97.94 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 97.93 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 97.89 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.88 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.84 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 97.8 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 97.78 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 97.76 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 97.75 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 97.73 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 97.71 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 97.67 | |
| 2qrv_B | 230 | DNA (cytosine-5)-methyltransferase 3-like; DNA met | 97.66 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 97.66 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 97.66 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 97.65 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 97.62 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 97.61 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 97.61 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 97.6 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 97.56 | |
| 4dkj_A | 403 | Cytosine-specific methyltransferase; CG-specificit | 97.53 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 97.53 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 97.53 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 97.52 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 97.52 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 97.51 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 97.5 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 97.49 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 97.45 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 97.43 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 97.43 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 97.43 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 97.43 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 97.42 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 97.42 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 97.41 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 97.39 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 97.38 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 97.36 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 97.36 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 97.32 | |
| 4ft4_B | 784 | DNA (cytosine-5)-methyltransferase 1; chromodomain | 97.3 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 97.3 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 97.29 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 97.29 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 97.26 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 97.25 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 97.24 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 97.24 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 97.22 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 97.22 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 97.21 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 97.17 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 97.16 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 97.13 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 97.11 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 97.09 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 97.09 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 97.07 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 97.06 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 97.05 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 97.05 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 97.02 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 97.02 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 97.01 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 97.01 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 96.98 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 96.98 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.97 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 96.95 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 96.9 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.9 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 96.88 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 96.88 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 96.88 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.88 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 96.85 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 96.85 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.84 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 96.84 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 96.83 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 96.83 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 96.82 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 96.82 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 96.78 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 96.72 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 96.72 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 96.71 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 96.65 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 96.64 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 96.63 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 96.63 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 96.62 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 96.6 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 96.59 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 96.59 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 96.58 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 96.58 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 96.58 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.58 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 96.57 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 96.54 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 96.53 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 96.52 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 96.52 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 96.52 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 96.49 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 96.48 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 96.48 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 96.47 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 96.46 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 96.46 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 96.44 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 96.43 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 96.43 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 96.41 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 96.39 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 96.37 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 96.36 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 96.32 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 96.31 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 96.31 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 96.3 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 96.3 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 96.3 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 96.3 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 96.26 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 96.25 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 96.25 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 96.24 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 96.23 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 96.23 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 96.23 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 96.23 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 96.22 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 96.21 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 96.21 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 96.2 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 96.18 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 96.17 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 96.16 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 96.15 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 96.15 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 96.14 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 96.13 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 96.12 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 96.07 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 96.07 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 96.06 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 96.06 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 96.06 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 96.05 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 96.01 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 96.0 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 95.99 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 95.99 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 95.98 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 95.98 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 95.97 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 95.97 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 95.96 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.95 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 95.95 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 95.93 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 95.93 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 95.93 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 95.92 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 95.92 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 95.91 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 95.91 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 95.9 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 95.9 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 95.89 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 95.88 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 95.88 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 95.88 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 95.87 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 95.86 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.85 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 95.84 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 95.82 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 95.81 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 95.8 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 95.76 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.74 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 95.71 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 95.7 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 95.7 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 95.67 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 95.66 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 95.65 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 95.64 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 95.59 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 95.58 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 95.56 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 95.56 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 95.56 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 95.55 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 95.55 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 95.55 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 95.52 | |
| 4fp9_B | 335 | Mterf domain-containing protein 2; modification en | 95.5 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 95.44 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 95.44 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 95.42 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 95.4 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 95.39 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 95.38 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 95.36 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 95.35 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 95.35 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 95.33 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 95.31 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 95.31 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 95.29 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 95.25 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 95.23 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 95.22 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 95.22 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 95.2 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.19 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.19 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 95.16 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 95.16 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 95.13 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 95.13 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 95.11 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 95.11 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 95.11 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 95.1 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 95.09 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 95.06 | |
| 3av4_A | 1330 | DNA (cytosine-5)-methyltransferase 1; CXXC-type zi | 95.02 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 95.0 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 94.96 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 94.93 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 94.93 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 94.88 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 94.86 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 94.86 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 94.85 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 94.84 | |
| 3swr_A | 1002 | DNA (cytosine-5)-methyltransferase 1; epigenetics, | 94.84 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 94.82 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 94.79 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 94.77 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 94.76 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.76 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 94.75 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 94.75 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 94.68 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 94.61 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 94.59 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 94.56 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 94.54 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 94.51 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 94.51 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 94.47 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 94.45 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 94.42 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 94.4 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 94.39 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.33 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 94.29 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 94.25 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 94.24 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 94.22 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 94.05 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 94.02 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 94.0 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 93.99 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 93.96 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 93.96 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 93.95 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 93.94 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 93.88 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 93.85 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 93.83 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 93.8 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 93.73 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 93.72 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 93.67 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 93.64 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 93.6 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 93.6 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 93.51 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 93.39 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 93.34 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 93.2 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 93.13 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 93.07 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 92.99 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 92.99 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 92.96 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 92.96 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 92.88 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 92.7 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 92.7 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 92.64 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 92.44 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 92.21 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 91.92 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 91.81 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 91.48 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 91.34 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 91.25 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 91.0 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 90.8 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 90.46 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 90.4 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 90.37 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 90.2 | |
| 3dfg_A | 162 | Xcrecx, regulatory protein RECX; RECX RECA, homolo | 90.12 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 89.97 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 89.22 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 89.11 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 89.05 | |
| 3m66_A | 270 | Mterf3, mterf domain-containing protein 1, mitocho | 88.68 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 87.48 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 87.43 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 87.34 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 87.03 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 86.33 | |
| 1ixs_A | 62 | Holliday junction DNA helicase RUVA; heterodimeric | 86.24 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 86.2 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 85.92 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 85.91 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 85.82 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 85.35 | |
| 3d5l_A | 221 | Regulatory protein RECX; PSI-II, NYSGXRC, DNA repa | 85.06 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 84.74 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 84.41 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 83.7 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 83.36 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 83.16 | |
| 4fp9_B | 335 | Mterf domain-containing protein 2; modification en | 82.97 | |
| 3e3v_A | 177 | Regulatory protein RECX; PSI-II, NYSGXRC, structur | 82.16 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 80.55 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 80.08 |
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
Probab=99.91 E-value=3e-25 Score=228.93 Aligned_cols=106 Identities=24% Similarity=0.483 Sum_probs=96.0
Q ss_pred cceeccccChhHHHHHHHHcCCceeEEEeeccCHHHHHHHHHHHhhcCCCCcccccccccccchhhHHHHHhccCCeeEE
Q 008350 445 INVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNRNIVRSWWEQTNQKGTLIDFADVQQLDANRIEQMINAFGGFDLV 524 (569)
Q Consensus 445 i~vlDLFSGiGG~slGl~~aGi~~k~V~avEid~~A~~t~~~n~~~~N~~~~~~~~~DI~~i~~~~l~~~~~~~g~~Dll 524 (569)
|+|+||||||||+++||+++|+ ++|+|+|+++.|+++|+.| ++. .++.+||++++.+.+ +++|+|
T Consensus 1 mkvidLFsG~GG~~~G~~~aG~--~~v~a~e~d~~a~~ty~~N-----~~~-~~~~~DI~~i~~~~~-------~~~D~l 65 (331)
T 3ubt_Y 1 MNLISLFSGAGGLDLGFQKAGF--RIICANEYDKSIWKTYESN-----HSA-KLIKGDISKISSDEF-------PKCDGI 65 (331)
T ss_dssp CEEEEESCTTCHHHHHHHHTTC--EEEEEEECCTTTHHHHHHH-----CCS-EEEESCGGGCCGGGS-------CCCSEE
T ss_pred CeEEEeCcCccHHHHHHHHCCC--EEEEEEeCCHHHHHHHHHH-----CCC-CcccCChhhCCHhhC-------CcccEE
Confidence 5799999999999999999998 6899999999999999976 443 478899999987654 589999
Q ss_pred EEcCCCCccccCCCCCCCCCCCCccchHHHHHHHHHHhccccc
Q 008350 525 IGGSPCNNLAGSNRHSRDGLEGKESSLFYDYFRILDLVKNMMQ 567 (569)
Q Consensus 525 iGGpPCQ~fS~ag~~kr~Gl~d~r~~Lf~~~~rII~~vrPk~~ 567 (569)
+||||||+||.||+ ++|++|+|+.||++|+|+|+.+||++.
T Consensus 66 ~ggpPCQ~fS~ag~--~~g~~d~R~~L~~~~~r~i~~~~Pk~~ 106 (331)
T 3ubt_Y 66 IGGPPSQSWSEGGS--LRGIDDPRGKLFYEYIRILKQKKPIFF 106 (331)
T ss_dssp ECCCCGGGTEETTE--ECCTTCGGGHHHHHHHHHHHHHCCSEE
T ss_pred EecCCCCCcCCCCC--ccCCCCchhHHHHHHHHHHhccCCeEE
Confidence 99999999999996 678999999999999999999999973
|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >2qrv_B DNA (cytosine-5)-methyltransferase 3-like; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >4dkj_A Cytosine-specific methyltransferase; CG-specificity, DNA intercalation, CPG sequence, cytosine C5 methylation; HET: DNA C37 5CM SAH; 2.15A {Mycoplasma penetrans} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3dfg_A Xcrecx, regulatory protein RECX; RECX RECA, homologous recombination, tandem repeats, three-helix bundle, cytoplasm; 1.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3m66_A Mterf3, mterf domain-containing protein 1, mitochondrial; mitochondrion, DNA binding protein, transcription factor, transcription termination; 1.60A {Homo sapiens} PDB: 3opg_A 3my3_A | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3d5l_A Regulatory protein RECX; PSI-II, NYSGXRC, DNA repair, 10123K, structural genomi protein structure initiative; 2.35A {Lactobacillus reuteri} | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >4fp9_B Mterf domain-containing protein 2; modification enzyme, transferase; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3e3v_A Regulatory protein RECX; PSI-II, NYSGXRC, structural genomics, protein initiative; 2.04A {Lactobacillus salivarius} | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 569 | ||||
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 1e-07 | |
| d1g55a_ | 343 | c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: | 1e-05 | |
| d1dcta_ | 324 | c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus a | 2e-06 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 4e-06 | |
| d2c7pa1 | 327 | c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilu | 1e-04 | |
| d1wgna_ | 63 | a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 | 0.001 | |
| d1whca_ | 64 | a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus | 0.003 | |
| d1whca_ | 64 | a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus | 0.004 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 51.6 bits (122), Expect = 1e-07
Identities = 19/95 (20%), Positives = 39/95 (41%), Gaps = 10/95 (10%)
Query: 445 INVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNRNIVRSWWEQTNQKGTLIDFADVQ 504
+ VL L+SG+GG AL + + V ++D++ V + + N T + ++
Sbjct: 3 LRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYK-----YNFPHTQLLAKTIE 57
Query: 505 QLDANRIEQMINAFGGFDLVIGGSPCNNLAGSNRH 539
+ ++ FD+++ PC R
Sbjct: 58 GITLEEFDR-----LSFDMILMSPPCQPFTRIGRQ 87
|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Length = 343 | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Length = 324 | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Length = 327 | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 569 | |||
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 99.9 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 99.9 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 99.12 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 98.57 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 98.48 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 98.39 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.38 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 98.36 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 98.26 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 98.26 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 98.23 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 98.22 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 98.22 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 98.14 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 98.1 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 98.1 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 97.96 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 97.93 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 97.74 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 97.74 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 97.66 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 97.57 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 97.54 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.52 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 97.5 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 97.5 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 97.47 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 97.24 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 97.2 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 97.13 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 97.09 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 97.08 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 97.07 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 97.04 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 97.03 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 96.95 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 96.93 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 96.82 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 96.73 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.69 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 96.66 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 96.66 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 96.63 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 96.55 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 96.52 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 96.48 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 96.46 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 96.42 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 96.39 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 96.38 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 96.38 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 96.34 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 96.28 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 96.2 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 96.15 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 96.12 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 96.11 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 95.89 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 95.84 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 95.83 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 95.76 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 95.76 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 95.73 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 95.7 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 95.61 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 95.47 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 95.45 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 95.41 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 95.16 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 95.14 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 95.1 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 94.85 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 94.83 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 94.78 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 94.76 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 94.7 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 94.63 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 94.3 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 94.25 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 94.17 | |
| d2cosa1 | 41 | Serine/threonine protein kinase LATS2 {Mouse (Mus | 93.88 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 93.6 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 93.41 | |
| d2cosa1 | 41 | Serine/threonine protein kinase LATS2 {Mouse (Mus | 93.35 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 93.28 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 93.02 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 92.62 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 92.62 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 92.61 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 92.41 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 92.19 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 91.99 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 91.54 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 91.39 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 90.51 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 90.42 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 89.79 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 89.68 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 88.42 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 88.4 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 88.11 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 87.88 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 87.71 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 87.67 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 87.53 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 87.42 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 87.25 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 87.12 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 86.25 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 85.59 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 85.18 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 85.1 | |
| d1cuka1 | 48 | DNA helicase RuvA subunit, C-terminal domain {Esch | 84.62 | |
| d2dkla1 | 72 | Trinucleotide repeat containing 6c protein, TNRC6C | 84.59 | |
| d1vega_ | 83 | NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu | 84.02 | |
| d1vega_ | 83 | NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu | 82.02 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 81.5 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 80.01 |
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: C5 cytosine-specific DNA methylase, DCM domain: DNMT2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=5.9e-25 Score=222.77 Aligned_cols=111 Identities=19% Similarity=0.370 Sum_probs=84.7
Q ss_pred CcceeccccChhHHHHHHHHcCCceeEEEeeccCHHHHHHHHHHHhhcCCCCcccccccccccchhhHHHHHhccCCeeE
Q 008350 444 GINVLSLFSGIGGAEVALHRLGVRMKNVVSVDISEVNRNIVRSWWEQTNQKGTLIDFADVQQLDANRIEQMINAFGGFDL 523 (569)
Q Consensus 444 ~i~vlDLFSGiGG~slGl~~aGi~~k~V~avEid~~A~~t~~~n~~~~N~~~~~~~~~DI~~i~~~~l~~~~~~~g~~Dl 523 (569)
+++|+|||||+||+++||+++|++.++++|+|+++.|+++|+.| |+++.++++||+++..+.++. +++||
T Consensus 2 p~kv~~lF~G~Gg~~~gl~~aG~~~~~~~a~E~~~~a~~~~~~n-----~~~~~~~~~di~~~~~~~~~~-----~~~Dl 71 (343)
T d1g55a_ 2 PLRVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYN-----FPHTQLLAKTIEGITLEEFDR-----LSFDM 71 (343)
T ss_dssp CEEEEEETCTTCHHHHHHHHHTCSEEEEEEECCCHHHHHHHHHH-----CTTSCEECSCGGGCCHHHHHH-----HCCSE
T ss_pred CCEEEEcCcCccHHHHHHHHcCCCCeEEEEEECCHHHHHHHHHH-----CCCCCcccCchhhCCHhHcCC-----CCccE
Confidence 58899999999999999999999888999999999999999965 677778899999999887764 47999
Q ss_pred EEEcCCCCccccCCCCCCCCCCCCccchHHHHHHHHHHh--cccc
Q 008350 524 VIGGSPCNNLAGSNRHSRDGLEGKESSLFYDYFRILDLV--KNMM 566 (569)
Q Consensus 524 liGGpPCQ~fS~ag~~kr~Gl~d~r~~Lf~~~~rII~~v--rPk~ 566 (569)
|+||||||+||.||+ ++|.+|+|+.||++|+++|+.+ ||++
T Consensus 72 l~ggpPCq~fS~ag~--~~~~~d~r~~l~~~~~~~i~~~~~kPk~ 114 (343)
T d1g55a_ 72 ILMSPPCQPFTRIGR--QGDMTDSRTNSFLHILDILPRLQKLPKY 114 (343)
T ss_dssp EEECCC--------------------CHHHHHHHHGGGCSSCCSE
T ss_pred EEeeccccccccccc--ccccccccccccchhhhhHhhhcCCCce
Confidence 999999999999996 6789999999999999999987 7986
|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|