Citrus Sinensis ID: 008755
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 554 | ||||||
| 225456155 | 590 | PREDICTED: translocon at the outer membr | 0.998 | 0.937 | 0.785 | 0.0 | |
| 255579275 | 589 | amidase, putative [Ricinus communis] gi| | 0.996 | 0.937 | 0.763 | 0.0 | |
| 224135565 | 592 | amidase family protein [Populus trichoca | 0.996 | 0.932 | 0.753 | 0.0 | |
| 224118646 | 593 | amidase family protein [Populus trichoca | 0.996 | 0.930 | 0.751 | 0.0 | |
| 357521651 | 594 | Glutamyl-tRNA(Gln) amidotransferase subu | 0.996 | 0.929 | 0.722 | 0.0 | |
| 449497473 | 591 | PREDICTED: translocon at the outer membr | 0.998 | 0.935 | 0.742 | 0.0 | |
| 356512970 | 587 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.960 | 0.906 | 0.706 | 0.0 | |
| 449439139 | 585 | PREDICTED: LOW QUALITY PROTEIN: transloc | 0.987 | 0.935 | 0.731 | 0.0 | |
| 356524688 | 591 | PREDICTED: glutamyl-tRNA(Gln) amidotrans | 0.960 | 0.900 | 0.726 | 0.0 | |
| 75336680 | 593 | RecName: Full=Translocon at the outer me | 0.998 | 0.932 | 0.701 | 0.0 |
| >gi|225456155|ref|XP_002282402.1| PREDICTED: translocon at the outer membrane of chloroplasts 64 [Vitis vinifera] gi|297734325|emb|CBI15572.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 442/563 (78%), Positives = 496/563 (88%), Gaps = 10/563 (1%)
Query: 1 MASQSANLWVLLGLGLAGILLMTKKLKKNIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTG 60
MAS SANLWVLLGLGLAG+LLMT+KLKK I++DFGAF+++LQLLPPPQP PPKAPHPLT
Sbjct: 1 MASSSANLWVLLGLGLAGVLLMTRKLKKTIREDFGAFVQRLQLLPPPQPAPPKAPHPLTN 60
Query: 61 LSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSI 120
LSFAVSD+FDIEGYVTGFG+P+WARTH ASRTS VVS LVEGGATC GKTVVDE AYSI
Sbjct: 61 LSFAVSDVFDIEGYVTGFGNPDWARTHDTASRTSPVVSALVEGGATCTGKTVVDEMAYSI 120
Query: 121 NGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGF 180
NG NKHY TPTNPAAPS++PGGSSSGAAVAVAA+ VDFSLG+DTVGGVRVP+AFCG++GF
Sbjct: 121 NGENKHYGTPTNPAAPSRIPGGSSSGAAVAVAANFVDFSLGLDTVGGVRVPAAFCGVIGF 180
Query: 181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
RPS+GAVSHMGII +S+SLDTVGWFA+DP ILR VGHVLLQL +A QRSPRQII ADDCF
Sbjct: 181 RPSHGAVSHMGIIHVSSSLDTVGWFAKDPSILRRVGHVLLQLTYAVQRSPRQIIFADDCF 240
Query: 241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFH--KTNGELKN--- 295
+ L+IP DRV QVV+KSTEKLFGRQVLK ENL Y DSKVPSLK FH KTNGE +N
Sbjct: 241 QSLRIPVDRVYQVVLKSTEKLFGRQVLKRENLENYLDSKVPSLKAFHSQKTNGETRNSLI 300
Query: 296 -----VMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
+M +QR+EFK+NH EWI SVKP LD IS+++ ++LE+++T IENC+S R E+R
Sbjct: 301 RSLVKIMHCLQRHEFKHNHEEWINSVKPILDASISSQLHDVLEVADTEIENCQSSRMEIR 360
Query: 351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
SA++SLLKDDGILV PT A PPPKLGGKE LSE+YQNR LLSIAS+SGCCQVTVPLG
Sbjct: 361 SALNSLLKDDGILVIPTVADPPPKLGGKESLSEEYQNRTLGLLSIASMSGCCQVTVPLGL 420
Query: 411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
YDK P SVSF+ARHGGDRFLLDTVQ MYASLQEQADIA KSKLS+N +++ SAEIAKEK
Sbjct: 421 YDKYPVSVSFMARHGGDRFLLDTVQTMYASLQEQADIAAKSKLSSNAVDRETSAEIAKEK 480
Query: 471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
GNQA+KDKQW KA+ FYTEAIKL+GNNATYYSNRAAAYLE GSFLQAEADCT+AINLDKK
Sbjct: 481 GNQAFKDKQWQKAVGFYTEAIKLSGNNATYYSNRAAAYLEMGSFLQAEADCTEAINLDKK 540
Query: 531 NVKAYLRRGTAREMLGYYKEAIE 553
NVKAYLRRGTAREMLGYYK+AIE
Sbjct: 541 NVKAYLRRGTAREMLGYYKDAIE 563
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255579275|ref|XP_002530483.1| amidase, putative [Ricinus communis] gi|223529980|gb|EEF31906.1| amidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224135565|ref|XP_002322105.1| amidase family protein [Populus trichocarpa] gi|222869101|gb|EEF06232.1| amidase family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224118646|ref|XP_002317872.1| amidase family protein [Populus trichocarpa] gi|222858545|gb|EEE96092.1| amidase family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357521651|ref|XP_003631114.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] gi|355525136|gb|AET05590.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449497473|ref|XP_004160411.1| PREDICTED: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356512970|ref|XP_003525187.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449439139|ref|XP_004137345.1| PREDICTED: LOW QUALITY PROTEIN: translocon at the outer membrane of chloroplasts 64-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356524688|ref|XP_003530960.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|75336680|sp|Q9MUK5.1|TOC64_PEA RecName: Full=Translocon at the outer membrane of chloroplasts 64 gi|7453538|gb|AAF62870.1|AF179282_1 Toc64 [Pisum sativum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 554 | ||||||
| TAIR|locus:2088600 | 589 | TOC64-III "translocon at the o | 0.998 | 0.938 | 0.630 | 8.2e-186 | |
| UNIPROTKB|Q9MUK5 | 593 | TOC64 "Translocon at the outer | 0.998 | 0.932 | 0.616 | 2.9e-183 | |
| TAIR|locus:2184757 | 603 | TOC64-V "AT5G09420" [Arabidops | 0.953 | 0.875 | 0.493 | 1.2e-134 | |
| TAIR|locus:2036029 | 425 | AMI1 "AT1G08980" [Arabidopsis | 0.729 | 0.950 | 0.465 | 6.8e-95 | |
| UNIPROTKB|Q60AB7 | 341 | MCA0950 "Amidase family protei | 0.592 | 0.961 | 0.311 | 2.4e-37 | |
| TIGR_CMR|DET_1335 | 486 | DET_1335 "glutamyl-tRNA(Gln) a | 0.196 | 0.224 | 0.376 | 7.8e-17 | |
| TIGR_CMR|CHY_1102 | 485 | CHY_1102 "glutamyl-tRNA(Gln) a | 0.333 | 0.381 | 0.310 | 2.1e-16 | |
| UNIPROTKB|Q936X3 | 457 | atzE "Biuret hydrolase" [Pseud | 0.258 | 0.312 | 0.326 | 3.2e-16 | |
| SGD|S000004907 | 464 | HER2 "Subunit of the trimeric | 0.216 | 0.258 | 0.382 | 3.4e-16 | |
| CGD|CAL0003013 | 450 | orf19.3956 [Candida albicans ( | 0.216 | 0.266 | 0.341 | 5.3e-15 |
| TAIR|locus:2088600 TOC64-III "translocon at the outer membrane of chloroplasts 64-III" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1802 (639.4 bits), Expect = 8.2e-186, P = 8.2e-186
Identities = 355/563 (63%), Positives = 417/563 (74%)
Query: 1 MASQSANXXXXXXXXXXXXXXMTKKLKKNIKQDFGAFIEXXXXXXXXXXXXXXXXXXXTG 60
MASQ+AN +TKKLKK +++DFGAFI+ TG
Sbjct: 1 MASQAANLWVLLGLGLAGILMLTKKLKKTVREDFGAFIDKLMLLPPPQPAPPKAPHPLTG 60
Query: 61 LSFAVSDLFDIEGYVTGFGHPEWXXXXXXXXXXXXXXXXLVEGGATCIGKTVVDEFAYSI 120
L+FAVSD+FDI GYVTGFGHP+W LVEGGATC+GKTVVDEFA+SI
Sbjct: 61 LTFAVSDVFDITGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDEFAFSI 120
Query: 121 NGTNKHYDTPTNPAAPSQMPXXXXXXXXXXXXXDLVDFSLGIDTVGGVRVPSAFCGILGF 180
+G NKHYD+PTNPAAP+++P + VDF+LGIDTVGGVRVP+ +CG+LGF
Sbjct: 121 SGENKHYDSPTNPAAPTRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF 180
Query: 181 RPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCF 240
+ SYGA+S+ GIIP+S+SLD+VGWFARDP LR VGHVLLQLPFA QR+PRQII+ADDCF
Sbjct: 181 KSSYGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIILADDCF 240
Query: 241 ELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFHKT----NGE---- 292
+LLKIP DR+ QVV KS EKLFGRQ+LKH+NL YF++KVPSLK F +T N +
Sbjct: 241 QLLKIPVDRITQVVTKSAEKLFGRQLLKHQNLETYFETKVPSLKEFARTKAIANTKVSTS 300
Query: 293 --LKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMR 350
L NVM+L+QR+EF NH +WI +VKPA+DP I +++ E E++ EN +IRNE R
Sbjct: 301 RLLANVMQLLQRHEFLQNHGDWINTVKPAIDPVILSQVCENPELTNEETENLNAIRNETR 360
Query: 351 SAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGY 410
AI SLLKDDGILV PT PPKLG KE+ SEDYQNRA SLLSIAS+SGCCQVTVPLG+
Sbjct: 361 VAIGSLLKDDGILVIPTLPAVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGH 420
Query: 411 YDKCPTSVSFIARHGGDRFLLDTVQNMYASLQEQADIATKSKLSTNTFNQKQSAEIAKEK 470
++KCP SVSFI RHGGDRFLLDTVQ MY SLQE + I T K S +++SAEIAKEK
Sbjct: 421 HEKCPISVSFIGRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEK 480
Query: 471 GNQAYKDKQWLKAISFYTEAIKLNGNNATYYSNRAAAYLESGSFLQAEADCTKAINLDKK 530
GNQA+K+K W KAI Y+EAIKL+ NNATYYSNRAAAYLE G FLQAE DCTKAI LDKK
Sbjct: 481 GNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKK 540
Query: 531 NVKAYLRRGTAREMLGYYKEAIE 553
NVKAYLRRGTAREMLG K AIE
Sbjct: 541 NVKAYLRRGTAREMLGDCKGAIE 563
|
|
| UNIPROTKB|Q9MUK5 TOC64 "Translocon at the outer membrane of chloroplasts 64" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184757 TOC64-V "AT5G09420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036029 AMI1 "AT1G08980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q60AB7 MCA0950 "Amidase family protein" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|DET_1335 DET_1335 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Dehalococcoides ethenogenes 195 (taxid:243164)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1102 CHY_1102 "glutamyl-tRNA(Gln) amidotransferase, A subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q936X3 atzE "Biuret hydrolase" [Pseudomonas sp. ADP (taxid:47660)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004907 HER2 "Subunit of the trimeric GatFAB AmidoTransferase(AdT) complex" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003013 orf19.3956 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 554 | |||
| PLN02722 | 422 | PLN02722, PLN02722, indole-3-acetamide amidohydrol | 0.0 | |
| PRK08310 | 395 | PRK08310, PRK08310, amidase; Provisional | 1e-121 | |
| COG0154 | 475 | COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransf | 1e-63 | |
| pfam01425 | 431 | pfam01425, Amidase, Amidase | 2e-54 | |
| PRK09201 | 465 | PRK09201, PRK09201, amidase; Provisional | 6e-43 | |
| TIGR00132 | 460 | TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) a | 2e-42 | |
| PRK07056 | 454 | PRK07056, PRK07056, amidase; Provisional | 2e-41 | |
| PRK06102 | 452 | PRK06102, PRK06102, hypothetical protein; Provisio | 6e-41 | |
| TIGR02715 | 452 | TIGR02715, amido_AtzE, amidohydrolase, AtzE family | 6e-40 | |
| PRK00012 | 459 | PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransf | 2e-38 | |
| PRK08186 | 600 | PRK08186, PRK08186, allophanate hydrolase; Provisi | 1e-37 | |
| TIGR02713 | 561 | TIGR02713, allophanate_hyd, allophanate hydrolase | 5e-37 | |
| PRK05962 | 424 | PRK05962, PRK05962, amidase; Validated | 6e-33 | |
| PRK07488 | 472 | PRK07488, PRK07488, indole acetimide hydrolase; Va | 5e-32 | |
| PRK07139 | 439 | PRK07139, PRK07139, amidase; Provisional | 3e-27 | |
| PRK07235 | 502 | PRK07235, PRK07235, amidase; Provisional | 6e-24 | |
| PRK12470 | 462 | PRK12470, PRK12470, amidase; Provisional | 5e-23 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 5e-22 | |
| PRK06170 | 490 | PRK06170, PRK06170, amidase; Provisional | 6e-22 | |
| PRK07486 | 484 | PRK07486, PRK07486, amidase; Provisional | 5e-21 | |
| PRK06169 | 466 | PRK06169, PRK06169, putative amidase; Provisional | 5e-21 | |
| PRK08137 | 497 | PRK08137, PRK08137, amidase; Provisional | 3e-19 | |
| PRK06707 | 536 | PRK06707, PRK06707, amidase; Provisional | 1e-18 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 8e-18 | |
| PRK06828 | 491 | PRK06828, PRK06828, amidase; Provisional | 1e-17 | |
| PRK06061 | 483 | PRK06061, PRK06061, amidase; Provisional | 7e-17 | |
| PRK07487 | 469 | PRK07487, PRK07487, amidase; Provisional | 2e-15 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 3e-14 | |
| PRK11910 | 615 | PRK11910, PRK11910, amidase; Provisional | 5e-14 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 1e-13 | |
| PRK07042 | 464 | PRK07042, PRK07042, amidase; Provisional | 1e-13 | |
| PRK07869 | 468 | PRK07869, PRK07869, amidase; Provisional | 1e-12 | |
| PRK06529 | 482 | PRK06529, PRK06529, amidase; Provisional | 4e-10 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 3e-09 | |
| PRK06565 | 566 | PRK06565, PRK06565, amidase; Validated | 7e-09 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 7e-08 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 6e-07 | |
| COG0457 | 291 | COG0457, NrfG, FOG: TPR repeat [General function p | 8e-06 | |
| PRK05962 | 424 | PRK05962, PRK05962, amidase; Validated | 1e-04 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 0.001 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 0.001 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 0.002 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 0.003 | |
| pfam13424 | 78 | pfam13424, TPR_12, Tetratricopeptide repeat | 0.003 | |
| COG2956 | 389 | COG2956, COG2956, Predicted N-acetylglucosaminyl t | 0.003 | |
| smart00028 | 34 | smart00028, TPR, Tetratricopeptide repeats | 0.004 |
| >gnl|CDD|166363 PLN02722, PLN02722, indole-3-acetamide amidohydrolase | Back alignment and domain information |
|---|
Score = 537 bits (1384), Expect = 0.0
Identities = 239/421 (56%), Positives = 303/421 (71%), Gaps = 16/421 (3%)
Query: 33 DFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASR 92
D+GAF+EK L P PL GL+FAV D+FD+EGYVTGFG+P+WARTHSAA+
Sbjct: 6 DYGAFMEKFVL----SPTSSSHDLPLHGLTFAVKDIFDVEGYVTGFGNPDWARTHSAATS 61
Query: 93 TSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVA 152
T+ V ++ GGATC+GKT++DE AYSING N HY TPTNP AP ++PGGSSSG+AVAV
Sbjct: 62 TAPAVLAVLRGGATCVGKTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVG 121
Query: 153 ADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKIL 212
A LVDFSLG DT G VRVP+++CGI GFRPS+GAVS +G+IP++ S DTVGWFARDP IL
Sbjct: 122 AKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVSTVGVIPMAQSFDTVGWFARDPVIL 181
Query: 213 RHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGR-QVLKHEN 271
+ VGHVLLQ P P QIIIA+DCF+L IP DR+VQV++KS EKLFG ++KH N
Sbjct: 182 KRVGHVLLQQPDVNPIKPSQIIIAEDCFQLSSIPHDRLVQVLVKSVEKLFGGGDIVKHVN 241
Query: 272 LGEYFDSKVPSLKGF-HKTNGE----------LKNVMRLIQRYEFKNNHNEWIESVKPAL 320
LG+Y + KVPSLK F K E L + MRL+QRYEFK NH EWI +VKP
Sbjct: 242 LGDYVEDKVPSLKHFMSKEIKEQEYNIPSLAALSSAMRLLQRYEFKINHGEWITAVKPEF 301
Query: 321 DPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEM 380
P IS I E + +E I+ C+S++ E+R+A+++LL + G+LV PT PPPKL
Sbjct: 302 GPGISERIWEAVRTTEEKIDACQSVKTELRAALTTLLGEFGVLVIPTVPGPPPKLQADPT 361
Query: 381 LSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS 440
E ++ RAFSLLSIA VSG CQV++PLG +D P SVS +A+HG D FLL+ V+++Y +
Sbjct: 362 TLESFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPVSVSLLAKHGSDGFLLNLVESLYGT 421
Query: 441 L 441
+
Sbjct: 422 I 422
|
Length = 422 |
| >gnl|CDD|181375 PRK08310, PRK08310, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223232 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|216494 pfam01425, Amidase, Amidase | Back alignment and domain information |
|---|
| >gnl|CDD|236409 PRK09201, PRK09201, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232842 TIGR00132, gatA, aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|235921 PRK07056, PRK07056, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235698 PRK06102, PRK06102, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233982 TIGR02715, amido_AtzE, amidohydrolase, AtzE family | Back alignment and domain information |
|---|
| >gnl|CDD|234572 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236177 PRK08186, PRK08186, allophanate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233981 TIGR02713, allophanate_hyd, allophanate hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236030 PRK07488, PRK07488, indole acetimide hydrolase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235945 PRK07139, PRK07139, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235979 PRK07235, PRK07235, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171524 PRK12470, PRK12470, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|235723 PRK06170, PRK06170, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236028 PRK07486, PRK07486, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180437 PRK06169, PRK06169, putative amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236161 PRK08137, PRK08137, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235855 PRK06707, PRK06707, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|180715 PRK06828, PRK06828, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235686 PRK06061, PRK06061, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236029 PRK07487, PRK07487, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|183377 PRK11910, PRK11910, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235915 PRK07042, PRK07042, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181154 PRK07869, PRK07869, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180608 PRK06529, PRK06529, amidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|180626 PRK06565, PRK06565, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 554 | |||
| PLN02722 | 422 | indole-3-acetamide amidohydrolase | 100.0 | |
| COG0154 | 475 | GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A su | 100.0 | |
| PRK09201 | 465 | amidase; Provisional | 100.0 | |
| TIGR02715 | 452 | amido_AtzE amidohydrolase, AtzE family. Members of | 100.0 | |
| PRK05962 | 424 | amidase; Validated | 100.0 | |
| PRK08310 | 395 | amidase; Provisional | 100.0 | |
| PRK06102 | 452 | hypothetical protein; Provisional | 100.0 | |
| PRK07487 | 469 | amidase; Provisional | 100.0 | |
| PRK06169 | 466 | putative amidase; Provisional | 100.0 | |
| PRK07056 | 454 | amidase; Provisional | 100.0 | |
| PRK07235 | 502 | amidase; Provisional | 100.0 | |
| PRK07486 | 484 | amidase; Provisional | 100.0 | |
| PRK06170 | 490 | amidase; Provisional | 100.0 | |
| PRK07042 | 464 | amidase; Provisional | 100.0 | |
| PRK12470 | 462 | amidase; Provisional | 100.0 | |
| PRK07488 | 472 | indole acetimide hydrolase; Validated | 100.0 | |
| TIGR00132 | 460 | gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) | 100.0 | |
| PRK06061 | 483 | amidase; Provisional | 100.0 | |
| PRK07869 | 468 | amidase; Provisional | 100.0 | |
| PRK06529 | 482 | amidase; Provisional | 100.0 | |
| PRK00012 | 459 | gatA aspartyl/glutamyl-tRNA amidotransferase subun | 100.0 | |
| PRK08186 | 600 | allophanate hydrolase; Provisional | 100.0 | |
| PRK07139 | 439 | amidase; Provisional | 100.0 | |
| PRK08137 | 497 | amidase; Provisional | 100.0 | |
| TIGR02713 | 561 | allophanate_hyd allophanate hydrolase. Allophanate | 100.0 | |
| PRK06828 | 491 | amidase; Provisional | 100.0 | |
| PF01425 | 441 | Amidase: Amidase; InterPro: IPR000120 Amidase sign | 100.0 | |
| PRK11910 | 615 | amidase; Provisional | 100.0 | |
| PRK06707 | 536 | amidase; Provisional | 100.0 | |
| PRK06565 | 566 | amidase; Validated | 100.0 | |
| KOG1211 | 506 | consensus Amidases [Translation, ribosomal structu | 100.0 | |
| KOG1212 | 560 | consensus Amidases [Translation, ribosomal structu | 100.0 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.52 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.37 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.37 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.37 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.34 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.33 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.3 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.25 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.24 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.24 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.19 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.17 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.17 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.15 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.15 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.12 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.1 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.09 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.07 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.02 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.01 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.0 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.99 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 98.98 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.98 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.97 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.97 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.96 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.94 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 98.94 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 98.93 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.92 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.92 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.92 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 98.92 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 98.91 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.91 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.91 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.91 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.9 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.9 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.86 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.86 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.85 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.84 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.84 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.84 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.84 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 98.84 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.84 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.81 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.8 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.79 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.78 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.77 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.77 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.76 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.75 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.72 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.72 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.71 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.71 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.69 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.67 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.65 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.63 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.61 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.59 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.59 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 98.59 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.58 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.56 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.56 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.54 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.53 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.52 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.49 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.48 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.47 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.47 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.45 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.43 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.41 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.41 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.39 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.37 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.36 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.36 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.36 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.35 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.34 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.3 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.3 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.3 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.28 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.26 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.25 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.25 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.24 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.21 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.2 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.2 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.2 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.19 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.18 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.17 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.17 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.13 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.12 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.12 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.1 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.1 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.09 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.09 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.08 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.05 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.05 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.04 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.03 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.03 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.02 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.01 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.01 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.01 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.99 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 97.98 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.98 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.92 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.91 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.9 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.89 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.88 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.88 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.87 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 97.86 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.86 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.85 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.85 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 97.83 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.83 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.83 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.83 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.82 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.8 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.8 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.78 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.76 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.75 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.73 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.73 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.72 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.7 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.7 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.67 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 97.63 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 97.62 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.59 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.59 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.58 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.57 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.57 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 97.56 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.55 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.51 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.5 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.46 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.45 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.42 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 97.4 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.38 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 97.38 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.37 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.37 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.34 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.33 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.29 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.28 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 97.27 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.27 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.23 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.13 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.12 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.09 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.08 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.08 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.07 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.07 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.05 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.04 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.03 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 96.87 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 96.87 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.79 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 96.79 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 96.77 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 96.75 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 96.72 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 96.71 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 96.71 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.71 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.71 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.7 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.68 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 96.58 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.54 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.49 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.43 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 96.41 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 96.28 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.25 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 96.24 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.23 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.15 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.13 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.12 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 96.11 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 95.98 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 95.94 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 95.92 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 95.91 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.88 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 95.86 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 95.84 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 95.82 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 95.74 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 95.71 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 95.71 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 95.7 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 95.43 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.38 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 95.32 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 95.27 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 95.25 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 95.23 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 95.12 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.12 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 94.95 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 94.92 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 94.74 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 94.54 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 94.48 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 94.44 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 94.29 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 94.26 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 94.26 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 94.21 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 93.99 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 93.95 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 93.65 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 93.56 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 93.51 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 93.37 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 93.04 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 93.02 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 93.02 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 92.96 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 92.95 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 92.86 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 92.83 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 92.82 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 92.75 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 92.71 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 92.67 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 92.63 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 92.39 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 92.33 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 92.32 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 92.05 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 91.69 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 91.64 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 91.58 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 91.49 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 91.29 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 91.28 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 91.21 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 90.97 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 90.95 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 90.87 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 90.85 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 90.46 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 90.45 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 90.19 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 90.17 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 89.63 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 89.6 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 89.42 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 89.39 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 89.04 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 88.34 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 88.33 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 88.3 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 88.03 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 88.0 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 87.95 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 86.78 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 86.71 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 86.65 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 86.54 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 85.59 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 85.43 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 84.71 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 83.24 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 82.47 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 82.29 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 81.92 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 81.33 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 80.7 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 80.42 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 80.13 |
| >PLN02722 indole-3-acetamide amidohydrolase | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.6e-89 Score=693.01 Aligned_cols=405 Identities=59% Similarity=1.011 Sum_probs=335.2
Q ss_pred ccCCcCceeeccccCCCCCCCCCCCCCCCCCceeeeccccccCCcccCCCChhhhhcCCCCCCCHHHHHHHHhCCCeeee
Q 008755 30 IKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIG 109 (554)
Q Consensus 30 ~~~~~~a~~~~~~~~~~~~~~~~~~~~pL~Gvp~~vKD~~~~~g~~tt~Gs~~~~~~~~~~~~da~~v~~L~~aGai~~g 109 (554)
.|+++|||++..+.+. ..+...|||+||||+|||+|+++|++||+||+.+.+.+.++.+||++|+|||++|||++|
T Consensus 3 ~~~~~~a~~~~~~~~~----~~~~~~gpL~GvPiaVKD~~~v~G~~Tt~GS~~~~~~~~~~~~dA~vV~rL~~AGAiilG 78 (422)
T PLN02722 3 TNPDYGAFMEKFVLSP----TSSSHDLPLHGLTFAVKDIFDVEGYVTGFGNPDWARTHSAATSTAPAVLAVLRGGATCVG 78 (422)
T ss_pred cCCCCCcceeeccccC----CCCCCCCCCCCCeEEEEcccccCCCccCCCCHHHHhcCCCCCCChHHHHHHHHCCCEEEE
Confidence 5778999999864421 112467999999999999999999999999998875334567999999999999999999
Q ss_pred ecCccccccccCCCCCCCCCCCCCCCCCCCCCCCChhHHHHHhcCCCccccccCCCCcccccccccCcccccCCCCcccc
Q 008755 110 KTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSH 189 (554)
Q Consensus 110 kt~~~e~~~~~~~~~~~~g~~~NP~~~~~~~GGSSgGsaaaVaag~~~~a~GtD~gGSiR~PAa~~Gv~GlkPT~G~v~~ 189 (554)
|||||||+++.+|+|++||+|+||||++|+||||||||||+||+|++|+|+|||||||||+||+||||||||||+||||+
T Consensus 79 KTn~~Efa~~~~g~n~~~G~t~NP~~~~r~pGGSSsGSAaAVAaG~~p~AlGtDtgGSIRiPAa~cGvvG~KPT~G~vp~ 158 (422)
T PLN02722 79 KTIMDEMAYSINGENAHYGTPTNPIAPDRVPGGSSSGSAVAVGAKLVDFSLGTDTGGSVRVPASYCGIFGFRPSHGAVST 158 (422)
T ss_pred EechhhHhhCCCCCCCCCCCCCCCCCCCCCCCcCcHHHHHHHHcCCCceEeecCCCcccccChhHcceEEEecCCCccCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCccccCCCCCcccccccCHHHHHHHHHHhcCCCcccCCCCceEEEccchhhhcCCChHHHHHHHHHHHHHHc--CCccc
Q 008755 190 MGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVL 267 (554)
Q Consensus 190 ~G~~p~~~s~d~~G~~ar~~~dl~~v~~~l~~~~~~~~~~~~~l~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv 267 (554)
.|++|+++++|++|||+|+++|+..+++++.+.+..+...+.+|.+..+.+......++++.+.++++++.+. |+.+
T Consensus 159 ~G~~pla~sld~~G~~ar~v~D~a~~~~~l~g~~~~d~~~~~ri~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~g~~v- 237 (422)
T PLN02722 159 VGVIPMAQSFDTVGWFARDPVILKRVGHVLLQQPDVNPIKPSQIIIAEDCFQLSSIPHDRLVQVLVKSVEKLFGGGDIV- 237 (422)
T ss_pred CCCCcccCCCCcccceeCCHHHHHHHHHHHcCCCCCCCcCCceEEechhhhhhcccccHHHHHHHHHHHHHHhcCCCee-
Confidence 9999999999999999999999999999998877666666778888755442112234678888888888776 5554
Q ss_pred eeccCcccccccCCChhhHh-----------hhhhhHHHHHHHHHHHHHHhhhHHHHhhhCCCCCHHHHHHHHHhhcCCH
Q 008755 268 KHENLGEYFDSKVPSLKGFH-----------KTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISE 336 (554)
Q Consensus 268 ~~~~l~~~v~~~~p~~~~~~-----------~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~p~~~~~~~~g~~~s~ 336 (554)
+...+...++...+.+..+. .....+...+..+..++....+..|+....+.++|.++.+++.|..++.
T Consensus 238 ~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~v~~~~~~g~~~s~ 317 (422)
T PLN02722 238 KHVNLGDYVEDKVPSLKHFMSKEIKEQEYNIPSLAALSSAMRLLQRYEFKINHGEWITAVKPEFGPGISERIWEAVRTTE 317 (422)
T ss_pred eecchhHHHHHhHHHHHHHhhcccccceecchhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhCCHHHHHHHHHhccCCH
Confidence 33333222222222221110 0011122344446666777778888877778899999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHhhcCCCcEEEEcCCCCCCCCCCCCCCchHHHHHHHhhhhhcccccCCceecccCCCCCCCCc
Q 008755 337 TVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPT 416 (554)
Q Consensus 337 ~~~~~a~~~r~~~~~~~~~~~~~~D~ll~Pt~~~~ap~~~~~~~~~~~~~~~~~~~t~~~nl~G~PaisvP~g~~~g~p~ 416 (554)
.+|.++++.|.++++.+.++|+++|+||+||+|.+||+++........++..++.+|.++|++|+|+||||+|..+|+|+
T Consensus 318 ~~y~~a~~~r~~~~~~~~~~~~~~D~Ll~Pt~p~~ap~~~~~~~~~~~~~~~~~~~t~~~nl~G~PaisvP~g~~~glPv 397 (422)
T PLN02722 318 EKIDACQSVKTELRAALTTLLGEFGVLVIPTVPGPPPKLQADPTTLESFRARAFSLLSIAGVSGFCQVSIPLGLHDNLPV 397 (422)
T ss_pred HHHHHHHHHHHHHHHHHHHHhcCCCEEEeCCCCCCCCCcccCcchHHHHHHHHHHhhhcccccCCCEEEEeCCCCCCCCE
Confidence 99999999999999999999999999999999999998875423333444455678999999999999999999899999
Q ss_pred eeEEEeccCCcHHHHHHHHHHHH
Q 008755 417 SVSFIARHGGDRFLLDTVQNMYA 439 (554)
Q Consensus 417 g~~~~~~~~~d~~ll~~a~~le~ 439 (554)
|+|+++++++|..++++++++..
T Consensus 398 Glqivg~~~~D~~lL~~a~~l~~ 420 (422)
T PLN02722 398 SVSLLAKHGSDGFLLNLVESLYG 420 (422)
T ss_pred EEEEECCCCChHHHHHHHHHHHh
Confidence 99999999999999999998764
|
|
| >COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09201 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02715 amido_AtzE amidohydrolase, AtzE family | Back alignment and domain information |
|---|
| >PRK05962 amidase; Validated | Back alignment and domain information |
|---|
| >PRK08310 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06102 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07487 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06169 putative amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07056 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07235 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07486 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06170 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07042 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK12470 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07488 indole acetimide hydrolase; Validated | Back alignment and domain information |
|---|
| >TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit | Back alignment and domain information |
|---|
| >PRK06061 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK07869 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06529 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK08186 allophanate hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK07139 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK08137 amidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02713 allophanate_hyd allophanate hydrolase | Back alignment and domain information |
|---|
| >PRK06828 amidase; Provisional | Back alignment and domain information |
|---|
| >PF01425 Amidase: Amidase; InterPro: IPR000120 Amidase signature (AS) enzymes are a large group of hydrolytic enzymes that contain a conserved stretch of approximately 130 amino acids known as the AS sequence | Back alignment and domain information |
|---|
| >PRK11910 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06707 amidase; Provisional | Back alignment and domain information |
|---|
| >PRK06565 amidase; Validated | Back alignment and domain information |
|---|
| >KOG1211 consensus Amidases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1212 consensus Amidases [Translation, ribosomal structure and biogenesis; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 554 | ||||
| 2dc0_A | 434 | Crystal Structure Of Amidase Length = 434 | 5e-17 | ||
| 1wao_1 | 477 | Pp5 Structure Length = 477 | 2e-14 | ||
| 2df4_A | 485 | Structure Of Trna-Dependent Amidotransferase Gatcab | 9e-14 | ||
| 1a17_A | 166 | Tetratricopeptide Repeats Of Protein Phosphatase 5 | 2e-13 | ||
| 3h0l_A | 478 | Structure Of Trna-Dependent Amidotransferase Gatcab | 4e-13 | ||
| 2bug_A | 140 | Solution Structure Of The Tpr Domain From Protein P | 5e-13 | ||
| 3al0_A | 475 | Crystal Structure Of The Glutamine Transamidosome F | 4e-12 | ||
| 3kfu_E | 471 | Crystal Structure Of The Transamidosome Length = 47 | 9e-12 | ||
| 3a1i_A | 521 | Crystal Structure Of Rhodococcus Sp. N-771 Amidase | 2e-11 | ||
| 2vyi_A | 131 | Crystal Structure Of The Tpr Domain Of Human Sgt Le | 2e-11 | ||
| 3a1k_A | 521 | Crystal Structure Of Rhodococcus Sp. N771 Amidase L | 2e-11 | ||
| 2gi3_A | 476 | Crystal Structure Of Glutamyl-Trna(Gln) Amidotransf | 4e-11 | ||
| 3uq3_A | 258 | Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = | 3e-10 | ||
| 3upv_A | 126 | Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = | 5e-10 | ||
| 4gyr_A | 621 | Granulibacter Bethesdensis Allophanate Hydrolase Ap | 5e-10 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 6e-10 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 8e-10 | ||
| 1m21_A | 503 | Crystal Structure Analysis Of The Peptide Amidase P | 9e-10 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 9e-10 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 2e-09 | ||
| 3fp2_A | 537 | Crystal Structure Of Tom71 Complexed With Hsp82 C-T | 6e-09 | ||
| 3lca_A | 533 | Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term | 6e-09 | ||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 8e-09 | ||
| 3sz7_A | 164 | Crystal Structure Of The Sgt2 Tpr Domain From Asper | 1e-08 | ||
| 1elw_A | 118 | Crystal Structure Of The Tpr1 Domain Of Hop In Comp | 4e-08 | ||
| 1obl_A | 414 | Crystal Structure Of The S133a Mutant Of Malonamida | 7e-08 | ||
| 1o9o_A | 414 | Crystal Structure Of The S131a Mutant Of Malonamida | 7e-08 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 1e-07 | ||
| 1elr_A | 131 | Crystal Structure Of The Tpr2a Domain Of Hop In Com | 4e-07 | ||
| 3esk_A | 129 | Structure Of Hop Tpr2a Domain In Complex With The N | 4e-07 | ||
| 2gw1_A | 514 | Crystal Structure Of The Yeast Tom70 Length = 514 | 5e-07 | ||
| 1obk_A | 414 | Crystal Structure Of The R158q Mutant Of Malonamida | 6e-07 | ||
| 1ock_A | 412 | The Crystal Structure Of Malonamidase E2 From Brady | 7e-07 | ||
| 1o9n_A | 414 | Crystal Structure Of The K62a Mutant Of Malonamidas | 7e-07 | ||
| 1obj_A | 414 | Crystal Structure Of The T150a Mutant Of Malonamida | 7e-07 | ||
| 1obi_A | 414 | Crystal Structure Of The G130a Mutant Of Malonamida | 8e-07 | ||
| 1o9q_A | 414 | Crystal Structure Of The S155c Mutant Of Malonamida | 9e-07 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 2e-06 | ||
| 3fwv_A | 128 | Crystal Structure Of A Redesigned Tpr Protein, T-Mo | 4e-06 | ||
| 4gcn_A | 127 | N-Terminal Domain Of Stress-Induced Protein-1 (Sti- | 5e-06 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 9e-05 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 1e-04 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 1e-04 | ||
| 3rkv_A | 162 | C-Terminal Domain Of Protein C56c10.10, A Putative | 5e-04 |
| >pdb|2DC0|A Chain A, Crystal Structure Of Amidase Length = 434 | Back alignment and structure |
|
| >pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 | Back alignment and structure |
| >pdb|2DF4|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 485 | Back alignment and structure |
| >pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 | Back alignment and structure |
| >pdb|3H0L|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 478 | Back alignment and structure |
| >pdb|3AL0|A Chain A, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State Length = 475 | Back alignment and structure |
| >pdb|3KFU|E Chain E, Crystal Structure Of The Transamidosome Length = 471 | Back alignment and structure |
| >pdb|3A1I|A Chain A, Crystal Structure Of Rhodococcus Sp. N-771 Amidase Complexed With Benzamide Length = 521 | Back alignment and structure |
| >pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 | Back alignment and structure |
| >pdb|3A1K|A Chain A, Crystal Structure Of Rhodococcus Sp. N771 Amidase Length = 521 | Back alignment and structure |
| >pdb|2GI3|A Chain A, Crystal Structure Of Glutamyl-Trna(Gln) Amidotransferase Subunit A (Tm1272) From Thermotoga Maritima At 1.80 A Resolution Length = 476 | Back alignment and structure |
| >pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 | Back alignment and structure |
| >pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 | Back alignment and structure |
| >pdb|4GYR|A Chain A, Granulibacter Bethesdensis Allophanate Hydrolase Apo Length = 621 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
| >pdb|1M21|A Chain A, Crystal Structure Analysis Of The Peptide Amidase Pam In Complex With The Competitive Inhibitor Chymostatin Length = 503 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 | Back alignment and structure |
| >pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 | Back alignment and structure |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
| >pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 | Back alignment and structure |
| >pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 | Back alignment and structure |
| >pdb|1OBL|A Chain A, Crystal Structure Of The S133a Mutant Of Malonamidase E2 Complexed With Malonate From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1O9O|A Chain A, Crystal Structure Of The S131a Mutant Of Malonamidase E2 Complexed With Malonamate From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|1ELR|A Chain A, Crystal Structure Of The Tpr2a Domain Of Hop In Complex With The Hsp90 Peptide Meevd Length = 131 | Back alignment and structure |
| >pdb|3ESK|A Chain A, Structure Of Hop Tpr2a Domain In Complex With The Non-Cognate Hsc70 Peptide Ligand Length = 129 | Back alignment and structure |
| >pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 | Back alignment and structure |
| >pdb|1OBK|A Chain A, Crystal Structure Of The R158q Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OCK|A Chain A, The Crystal Structure Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 412 | Back alignment and structure |
| >pdb|1O9N|A Chain A, Crystal Structure Of The K62a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OBJ|A Chain A, Crystal Structure Of The T150a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1OBI|A Chain A, Crystal Structure Of The G130a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1O9Q|A Chain A, Crystal Structure Of The S155c Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|3FWV|A Chain A, Crystal Structure Of A Redesigned Tpr Protein, T-Mod(Vmy), In Complex With Meevf Peptide Length = 128 | Back alignment and structure |
| >pdb|4GCN|A Chain A, N-Terminal Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 127 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 554 | |||
| 1o9p_A | 414 | Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja | 7e-50 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 1e-43 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 5e-43 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 8e-43 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 1e-42 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 1e-42 | |
| 2dc0_A | 434 | Probable amidase; structural genomics, NPPSFA, nat | 2e-42 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 4e-42 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 3e-41 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 1e-40 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 2e-39 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 3e-39 | |
| 3a1k_A | 521 | Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo | 9e-38 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 1e-37 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 5e-37 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 1e-36 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 2e-36 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 6e-04 | |
| 3a2q_A | 493 | 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet | 7e-36 | |
| 3ip4_A | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 1e-33 | |
| 3kfu_E | 471 | Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP | 3e-33 | |
| 3h0l_A | 478 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 5e-33 | |
| 2gi3_A | 476 | Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 | 6e-33 | |
| 3ppm_A | 573 | Fatty-acid amide hydrolase 1; protein-inhibitor co | 9e-32 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 8e-31 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-28 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-22 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 9e-16 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 8e-15 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 3e-13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 6e-13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 7e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-27 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-22 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 5e-18 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-14 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-05 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 3e-27 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 3e-06 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 6e-27 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-26 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 9e-20 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-18 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-15 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-15 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 8e-15 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-12 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-07 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-26 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-22 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-18 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-12 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-11 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 8e-11 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-10 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 9e-25 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-16 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-16 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 3e-14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-13 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-13 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-10 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 9e-10 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 5e-24 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 6e-06 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 2e-18 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 7e-18 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-17 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 5e-16 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-14 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 6e-12 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-08 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 8e-18 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 5e-09 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 3e-16 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 7e-16 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 1e-13 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 5e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-16 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-14 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-13 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-13 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-11 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-07 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 3e-16 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 6e-13 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 8e-06 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 2e-04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 7e-16 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-13 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-12 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 3e-07 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 6e-05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 7e-16 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 9e-16 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 4e-15 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 5e-15 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 1e-11 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 9e-11 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-15 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 1e-12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 6e-12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 6e-10 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 3e-08 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 5e-08 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 2e-07 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 4e-15 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 6e-10 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 9e-06 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 5e-15 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 2e-07 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 7e-06 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 5e-15 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 2e-09 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 8e-08 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 1e-07 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 5e-07 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 9e-15 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 9e-14 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 8e-08 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 2e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 9e-14 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 5e-13 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-11 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-07 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 2e-14 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-12 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-11 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-11 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 3e-10 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-08 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 3e-14 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 5e-14 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 3e-13 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 9e-09 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 4e-08 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-14 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 1e-11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-11 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-09 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 4e-08 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 8e-14 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 8e-14 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 3e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-13 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-11 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-10 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 2e-10 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 4e-10 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-10 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 2e-13 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 3e-05 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 2e-13 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 4e-12 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 1e-07 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 4e-12 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-11 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-11 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-10 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-10 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-10 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 8e-13 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 7e-11 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 1e-10 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 8e-06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 9e-06 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 7e-12 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 2e-05 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-11 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 1e-08 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 2e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-11 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-10 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 4e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-09 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-08 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-04 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 6e-11 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 4e-10 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-08 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 2e-10 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 2e-10 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 4e-07 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 2e-10 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-09 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 6e-08 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-04 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 1e-09 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 8e-09 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 2e-06 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 2e-09 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 1e-04 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 4e-09 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 8e-05 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 4e-09 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 6e-08 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 7e-09 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 2e-06 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 1e-05 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 1e-08 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 2e-07 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 2e-08 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 3e-06 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 4e-08 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 1e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 2e-05 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 4e-08 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 8e-04 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 9e-08 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 3e-06 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 9e-06 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 3e-04 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 2e-05 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 4e-05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 4e-05 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 4e-04 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 9e-05 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 2e-04 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 5e-04 |
| >1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Length = 414 | Back alignment and structure |
|---|
Score = 176 bits (448), Expect = 7e-50
Identities = 91/386 (23%), Positives = 148/386 (38%), Gaps = 37/386 (9%)
Query: 53 KAPHPLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTV 112
+A PL G++ + D+ D T G + + VV L GAT IGKT
Sbjct: 49 QASGPLRGIAVGIKDIIDTANMPTEMGSEIYRGWQPR--SDAPVVMMLKRAGATIIGKTT 106
Query: 113 VDEFAYSINGTNKHYDTPT-NPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVP 171
FA T T NP PGG+SSG+A AV A ++ +LG T G V P
Sbjct: 107 TTAFASR------DP-TATLNPHNTGHSPGGASSGSAAAVGAGMIPLALGTQTGGSVIRP 159
Query: 172 SAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVL----LQLPFAAQ 227
+A+CG +PS+ + +G+ S +LDTVG F + L +
Sbjct: 160 AAYCGTAAIKPSFRMLPTVGVKCYSWALDTVGLFGARAEDLARGLLAMTGRSEFSGIVPA 219
Query: 228 RSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLFGRQVLKHENLGEYFDSKVPSLKGFH 287
++PR ++ + ++ A++ +Q IK+ E+ G V + L E
Sbjct: 220 KAPRIGVVRQEFAGAVEPAAEQGLQAAIKAAERA-GASVQAID-LPEAVHEAWR------ 271
Query: 288 KTNGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRN 347
+ +IQ +E + P + A + + ++ + + I
Sbjct: 272 --------IHPIIQDFEAHRALAWEFSEHHDEIAPMLRASLDATVGLTPKEYDEARRIGR 323
Query: 348 EMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVP 407
R + + + +L+T + P + NR ++L+ G V VP
Sbjct: 324 RGRRELGEVFEGVDVLLTYSAPGTAPAKAL-ASTGDPRYNRLWTLM------GNPCVNVP 376
Query: 408 LGYYDKCPTSVSFIARHGGDRFLLDT 433
+ P V IAR G D L T
Sbjct: 377 VLKVGGLPIGVQVIARFGNDAHALAT 402
|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 | Back alignment and structure |
|---|
| >3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493 | Back alignment and structure |
|---|
| >3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Length = 485 | Back alignment and structure |
|---|
| >3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 471 | Back alignment and structure |
|---|
| >3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Length = 478 | Back alignment and structure |
|---|
| >2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* Length = 476 | Back alignment and structure |
|---|
| >3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* Length = 573 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 554 | |||
| 2dc0_A | 434 | Probable amidase; structural genomics, NPPSFA, nat | 100.0 | |
| 3ip4_A | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 100.0 | |
| 3h0l_A | 478 | Glutamyl-tRNA(Gln) amidotransferase subunit A; mul | 100.0 | |
| 3kfu_E | 471 | Glutamyl-tRNA(Gln) amidotransferase subunit A; ASP | 100.0 | |
| 1o9p_A | 414 | Malonamidase E2; malonate; 1.8A {Bradyrhizobium ja | 100.0 | |
| 3a2q_A | 493 | 6-aminohexanoate-cyclic-dimer hydrolase; alpha/bet | 100.0 | |
| 2gi3_A | 476 | Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1 | 100.0 | |
| 1m22_A | 503 | Peptide amidase, PAM; eleven-stranded beta sheet, | 100.0 | |
| 3a1k_A | 521 | Amidase; AS family enzyme, hydrolase; 2.17A {Rhodo | 100.0 | |
| 3ppm_A | 573 | Fatty-acid amide hydrolase 1; protein-inhibitor co | 100.0 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.69 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.65 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.58 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.57 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.55 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.54 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.53 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.52 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.5 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.47 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.43 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.43 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.42 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.41 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.39 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.38 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.37 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.35 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.33 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.33 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.33 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.33 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.32 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.31 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.31 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.3 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.3 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.3 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.3 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.28 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.28 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.28 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.26 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.26 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.25 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.24 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.24 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.24 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.24 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.23 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.22 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.21 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.21 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.21 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.2 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.2 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.19 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.18 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.17 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.17 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.17 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.16 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.16 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.16 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.16 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.16 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.16 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.15 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.15 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.14 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.14 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.13 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.13 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.12 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.09 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.09 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.09 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.09 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.09 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.09 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.08 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.06 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.06 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.05 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.05 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.04 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.04 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.03 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.03 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.03 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.02 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.01 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.01 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.01 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.0 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.0 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.0 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.0 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.0 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.98 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 98.98 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.97 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.97 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.96 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.96 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.96 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.96 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.95 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 98.95 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.95 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 98.94 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 98.94 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.93 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.93 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.93 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.91 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.91 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 98.9 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 98.9 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.9 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.9 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.89 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.89 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.88 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 98.88 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.87 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.86 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.83 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.82 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.81 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.81 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 98.8 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.8 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.79 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.79 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.78 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.77 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.77 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.75 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.75 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.74 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.73 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.72 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.7 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.7 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.7 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.69 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.68 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.67 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.67 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.66 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.64 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.64 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.63 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.63 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.63 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.63 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.59 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.59 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.59 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.59 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.57 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.57 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.56 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.56 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.54 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.54 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.53 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.52 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.52 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.5 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.5 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.49 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.49 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.48 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.47 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.46 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.45 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.45 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.44 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.43 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.43 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.42 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.4 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.4 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.35 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.28 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.27 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.27 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.26 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.25 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.25 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.25 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.21 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.2 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.19 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.17 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.14 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.1 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.07 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.05 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.04 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.04 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.99 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 97.95 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.94 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 97.88 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.88 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.86 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.86 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.85 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 97.84 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.81 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 97.8 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.79 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.65 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.54 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.51 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.48 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.46 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.39 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 97.38 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.24 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.23 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.19 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.13 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.1 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 96.72 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 96.66 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 96.27 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 95.54 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 95.01 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 94.97 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 94.83 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 94.79 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 94.63 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 94.62 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 94.43 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 94.31 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 93.39 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 93.22 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 92.06 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 92.06 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 91.94 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 90.92 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 86.81 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 86.8 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 86.74 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 86.19 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 85.9 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 83.47 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 83.38 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 82.97 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 82.47 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 81.68 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 80.72 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 80.42 |
| >2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.1e-90 Score=705.74 Aligned_cols=404 Identities=26% Similarity=0.338 Sum_probs=340.4
Q ss_pred hhhhhhhhHHHHH-----H----Hhh--hccCCcCceeeccccCCCCCCC-------CCCCCCCCCCceeeeccccccCC
Q 008755 12 LGLGLAGILLMTK-----K----LKK--NIKQDFGAFIEKLQLLPPPQPL-------PPKAPHPLTGLSFAVSDLFDIEG 73 (554)
Q Consensus 12 ~~~~~~~~~~~~~-----~----~~~--~~~~~~~a~~~~~~~~~~~~~~-------~~~~~~pL~Gvp~~vKD~~~~~g 73 (554)
++.+|+++++.+| . ++| +.|+ +|||++..+++++++|+ +++..||||||||+|||+|+++|
T Consensus 2 ~~~~l~~~~~~g~~s~~el~~a~l~ri~~~~~-lna~~~~~~~~Al~~A~~~d~~~~~g~~~gpL~GvPi~vKD~~~v~G 80 (434)
T 2dc0_A 2 DLLEAKRLLETGRTTPLALLEEALERAKAFQD-RNALAYLDEEAARKEALALTEELRRGQVRGPLHGLPLTVKDLFPVKG 80 (434)
T ss_dssp CHHHHHHHHHTTSCCHHHHHHHHHHHHHHTGG-GCCEEEECHHHHHHHHHHHHHHHHTTCCCSTTTTCEEEEETTSCBTT
T ss_pred CHHHHHHHHHcCCCCHHHHHHHHHHHHHHhCC-CcEEEEcCHHHHHHHHHHHHHHHhcCCCCCCcCCeeEEEEeccccCC
Confidence 5667777765544 2 343 6789 99999987766655442 35678999999999999999999
Q ss_pred cccCCCChhhhhcCCCCCCCHHHHHHHHhCCCeeeeecCccccccccCCCCCCCCCCCCCCCCCCCCCCCChhHHHHHhc
Q 008755 74 YVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAA 153 (554)
Q Consensus 74 ~~tt~Gs~~~~~~~~~~~~da~~v~~L~~aGai~~gkt~~~e~~~~~~~~~~~~g~~~NP~~~~~~~GGSSgGsaaaVaa 153 (554)
++||+||+.| . .++.+|+++|+|||++|||++||||||||+++.+|+|++||+|+||||++|+||||||||||+||+
T Consensus 81 ~~tt~Gs~~~-~--~~a~~dA~vV~rL~~aGAii~GKTn~~Efa~~~~~~n~~~G~t~NP~~~~~~pGGSSgGsAaaVAa 157 (434)
T 2dc0_A 81 MPTRAGTKAP-L--PPLPEEARAVRRLREAGALLFAKTNMHEIALGITGENPWTGPVRNAVDPSRQAGGSSGGSAVAVAL 157 (434)
T ss_dssp BCCCTTCSSC-C--CCCCSSCHHHHHHHHTTCEEEEEECCSGGGCCSSCCCTTTCCCBCSSCTTBBCCSSSHHHHHHHHH
T ss_pred cccCCCCccc-C--CCCCCCHHHHHHHHHCCCEEEEEeChhHHhcCCCCCCCCCCCCCCCCCCCCCCcccHHHHHHHHHc
Confidence 9999999998 3 233899999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCccccccCCCCcccccccccCcccccCCCCccccCCccccCCCCCcccccccCHHHHHHHHHHhcCCCcccC--CCCc
Q 008755 154 DLVDFSLGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAAQ--RSPR 231 (554)
Q Consensus 154 g~~~~a~GtD~gGSiR~PAa~~Gv~GlkPT~G~v~~~G~~p~~~s~d~~G~~ar~~~dl~~v~~~l~~~~~~~~--~~~~ 231 (554)
|++|+|+|||||||||+||+||||||||||+||||+.|++|+++++|++|||+|+++|+..+++++.+. ..++ .++.
T Consensus 158 g~~~~alGtDtgGSIRiPAa~cGv~GlKPT~G~vs~~g~~~~~~s~d~~Gp~arsv~D~a~~l~~l~g~-~~d~~~~~~l 236 (434)
T 2dc0_A 158 GIGLASLGTDTGGSIRIPAGFNGVVGFKPSYGRVSLEGALPLSRSTDHAGPLTRSVRDAHFLTEILAGE-SIPLEGVQNP 236 (434)
T ss_dssp TSSSCEEEECSSSTTHHHHHHHTCEEEECSTTSSCCTTSCCSCTTTCCEEEEESSHHHHHHHHHHHHTS-CCCCCCCCSC
T ss_pred CCCceeeecCCChhhhhhHHhCCCEEEECCCCCCCCCCCCCCCCccCeeCcccCCHHHHHHHHHHHhCC-CCCcccccCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999876 3332 3466
Q ss_pred eEEEccchhhhcCCChHHHHHHHHHHHHHHc--CCccceeccCcccccccCCChhhHhhhhhhHHHHHHHHHHHHHHhhh
Q 008755 232 QIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQRYEFKNNH 309 (554)
Q Consensus 232 ~l~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv~~~~l~~~v~~~~p~~~~~~~~~~~~~~~~~~~~~~e~~~~~ 309 (554)
||++..+.+. ...++++.++++++++.|. |++|++ .++ | +.+. ...+..+...|.+..+
T Consensus 237 rig~~~~~~~--~~~~~~v~~a~~~a~~~L~~~G~~v~~-~~~--------p-~~~~-------~~~~~~~~~~e~~~~~ 297 (434)
T 2dc0_A 237 VFGVPLDFLE--GRLGVEVRKAFTRLLEDLPALRAEVRE-VSL--------P-LEGV-------YEVYTRLVRYEAARIH 297 (434)
T ss_dssp EEEECHHHHT--TCSCHHHHHHHHHHHHHTTTTTCEEEE-CCC--------C-CTTH-------HHHHHHHHHHHHHHHS
T ss_pred EEEEECcccc--CCCCHHHHHHHHHHHHHHHHCCCEEEE-eCC--------C-cHHH-------HHHHHHHHHHHHHHHH
Confidence 7777665432 3358899999999999986 776643 222 2 2211 1223334455666667
Q ss_pred HHHHhhhCCCCCHHHHHHHHHhhcCCHHHHHHHHHHHHHHHHHHHhhcCCCcEEEEcCCCCCCCCCCCCCC-----chHH
Q 008755 310 NEWIESVKPALDPDISAEIGEMLEISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEM-----LSED 384 (554)
Q Consensus 310 ~~~~~~~~~~~~p~~~~~~~~g~~~s~~~~~~a~~~r~~~~~~~~~~~~~~D~ll~Pt~~~~ap~~~~~~~-----~~~~ 384 (554)
.+++....+.++|.++.+++.+..++..+|.++++.|..+++.+.++|+++|+||+||+|.+||+++.... ....
T Consensus 298 ~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~a~~~r~~~~~~~~~~~~~~D~ll~Pt~~~~a~~~~~~~~~~~~~~~~~ 377 (434)
T 2dc0_A 298 EKALKEHPEGFSPQVREALLAGLALTEKDYRDAVAEREALRLELVKALRGVDALLLPVQPLPAPPLGTEEVELESGRKGH 377 (434)
T ss_dssp HHHHHHCGGGSCHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHTTSSEEEEESCSSSCCBTTCCEEEETTEEEEH
T ss_pred HHHHHhchhhcCHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhcCCEEEECCCCCCCccCcccccccccchhhh
Confidence 77776667789999999999999999999999999999999999999999999999999999999986421 1111
Q ss_pred HHHHHhhhhhcccccCCceecccCCCCCCCCceeEEEeccCCcHHHHHHHHHHHHH
Q 008755 385 YQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMYAS 440 (554)
Q Consensus 385 ~~~~~~~~t~~~nl~G~PaisvP~g~~~g~p~g~~~~~~~~~d~~ll~~a~~le~~ 440 (554)
+ ..+..||.++|++|+|+||||+|+.+|+|+|+|+++++++|..++++++.+|+.
T Consensus 378 ~-~~~~~~t~~~nl~G~PaisvP~g~~~GlPvGvqlvg~~~~d~~lL~~A~~lE~~ 432 (434)
T 2dc0_A 378 R-EAFITLTLPFSLLGVPTLALPFAKVEGMPVGLQVVGAYGEDGKVLALGGWLEAR 432 (434)
T ss_dssp H-HHHHTTTHHHHHTTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHHTT
T ss_pred h-hhhhhhhhhhhhhCCCeEEEecCCCCCCCeEEEEECCCCchHHHHHHHHHHHHh
Confidence 2 234568999999999999999998889999999999999999999999999864
|
| >3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide-bindi protein biosynthesis; 1.90A {Staphylococcus aureus subsp} SCOP: c.117.1.1 PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A | Back alignment and structure |
|---|
| >3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* | Back alignment and structure |
|---|
| >3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A | Back alignment and structure |
|---|
| >3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation; 1.80A {Arthrobacter SP} PDB: 3a2p_A | Back alignment and structure |
|---|
| >2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structura genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* | Back alignment and structure |
|---|
| >1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* | Back alignment and structure |
|---|
| >3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A | Back alignment and structure |
|---|
| >3ppm_A Fatty-acid amide hydrolase 1; protein-inhibitor complex, FAAH, oxazole, oxadiazole, endoca degradation, membrane protein; HET: JG1 1DO; 1.78A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 3oj8_A* 2wj1_A* 3pr0_A* 2wap_A* 1mt5_A* 2vya_A* 3qk5_A* 3qj8_A* 3qj9_A* 3qkv_A* | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 554 | ||||
| d2gi3a1 | 475 | c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransf | 7e-50 | |
| d2f2aa1 | 485 | c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransf | 2e-46 | |
| d1m22a_ | 490 | c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomon | 6e-28 | |
| d1ocka_ | 412 | c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium jap | 4e-23 | |
| d1mt5a_ | 537 | c.117.1.1 (A:) Fatty acid amide hydrolase (oleamid | 2e-21 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 3e-17 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 2e-05 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 4e-14 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 6e-14 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-12 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-10 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 4e-10 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 2e-09 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 8e-07 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 6e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 7e-04 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 0.001 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 4e-10 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 3e-07 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 8e-10 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 2e-09 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 3e-09 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 0.001 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 3e-09 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 1e-04 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 0.004 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 6e-07 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 3e-04 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 1e-06 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 4e-05 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 2e-06 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 2e-06 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 2e-06 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 3e-06 | |
| d1tjca_ | 95 | a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni | 1e-05 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 1e-05 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 6e-05 | |
| d1xnfa_ | 259 | a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli | 2e-04 | |
| d2hr2a1 | 156 | a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C | 4e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 0.002 | |
| d1qqea_ | 290 | a.118.8.1 (A:) Vesicular transport protein sec17 { | 0.004 |
| >d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Amidase signature (AS) enzymes superfamily: Amidase signature (AS) enzymes family: Amidase signature (AS) enzymes domain: Glutamyl-tRNA(Gln) amidotransferase subunit A species: Thermotoga maritima [TaxId: 2336]
Score = 176 bits (448), Expect = 7e-50
Identities = 86/399 (21%), Positives = 161/399 (40%), Gaps = 27/399 (6%)
Query: 57 PLTGLSFAVSDLFDIEGYVTGFGHPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEF 116
G+ A+ D G T + + +TVV + E G +GK +DEF
Sbjct: 57 KFWGIPVAIKDNILTLGMRTTCASRILE--NYESVFDATVVKKMKEAGFVVVGKANLDEF 114
Query: 117 AYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFSLGIDTVGGVRVPSAFCG 176
A + + NP ++PGGSS G+A AV+A +V +LG DT G VR P++ CG
Sbjct: 115 AMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAALGSDTGGSVRQPASLCG 174
Query: 177 ILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPK-ILRHVGHVLLQLPFAAQRSPRQIII 235
++G++P+YG VS G++ ++SLD +G + + + + + A R++
Sbjct: 175 VVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDF 234
Query: 236 ADDCFELLKIPADRVVQVVI-----KSTEKLFGRQVLKHENLG-EYFDSKVPSLKGFHKT 289
+ E + V + + + + F + E LG + K+P +K T
Sbjct: 235 LSEIEEGVSGMKFAVPEEIYEHDIEEGVSERFEEALKLLERLGAKVERVKIPHIKYSVAT 294
Query: 290 -----------NGELKNVMRLIQRYEFKNNHNEWIESVKPALDPDISAEIGEML-----E 333
N + ++ R + K ++++ ++ I
Sbjct: 295 YYVIAPAEASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAA 354
Query: 334 ISETVIENCKSIRNEMRSAISSLLKDDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLL 393
E +R ++ ++ +L ++TPT+ K+G + Y F+
Sbjct: 355 YYEAYFNKAMKVRRKISDELNEVLSQYDAILTPTSPVTAFKIGEIKDPLTYYLMDIFT-- 412
Query: 394 SIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLD 432
A+++G ++VP G+ + P V I R D +
Sbjct: 413 IPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFR 451
|
| >d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485 | Back information, alignment and structure |
|---|
| >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490 | Back information, alignment and structure |
|---|
| >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412 | Back information, alignment and structure |
|---|
| >d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 554 | |||
| d2gi3a1 | 475 | Glutamyl-tRNA(Gln) amidotransferase subunit A {The | 100.0 | |
| d2f2aa1 | 485 | Glutamyl-tRNA(Gln) amidotransferase subunit A {Sta | 100.0 | |
| d1mt5a_ | 537 | Fatty acid amide hydrolase (oleamide hydrolase) {R | 100.0 | |
| d1ocka_ | 412 | Malonamidase E2 {Bradyrhizobium japonicum [TaxId: | 100.0 | |
| d1m22a_ | 490 | Peptide amidase Pam {Stenotrophomonas maltophilia | 100.0 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.57 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.56 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.5 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.44 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.43 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.42 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.4 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.39 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.37 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.33 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.31 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.3 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.28 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.21 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.18 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.18 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.16 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.16 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.14 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.14 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.13 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.12 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.11 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.11 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.1 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.09 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.07 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.02 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 98.99 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.87 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.86 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.62 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.59 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.49 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.49 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.42 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.41 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.41 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.3 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.24 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.22 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.22 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.21 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.12 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.04 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 97.76 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.64 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.39 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.28 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 96.8 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 96.71 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 96.63 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 96.19 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 81.08 |
| >d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Amidase signature (AS) enzymes superfamily: Amidase signature (AS) enzymes family: Amidase signature (AS) enzymes domain: Glutamyl-tRNA(Gln) amidotransferase subunit A species: Thermotoga maritima [TaxId: 2336]
Probab=100.00 E-value=3.7e-84 Score=679.42 Aligned_cols=403 Identities=22% Similarity=0.318 Sum_probs=320.8
Q ss_pred HhhhhhhhhHHHHHH---------Hhh--hccCCcCceeeccccCCCCCCCCCCCCCCCCCceeeeccccccCCcccCCC
Q 008755 11 LLGLGLAGILLMTKK---------LKK--NIKQDFGAFIEKLQLLPPPQPLPPKAPHPLTGLSFAVSDLFDIEGYVTGFG 79 (554)
Q Consensus 11 ~~~~~~~~~~~~~~~---------~~~--~~~~~~~a~~~~~~~~~~~~~~~~~~~~pL~Gvp~~vKD~~~~~g~~tt~G 79 (554)
|+.+.|++++..+|. ++| ++||.||||++..++.+++ .+||||||||+|||+|+++|++||+|
T Consensus 6 ~~~~~~~~~~~~~~~~~~~l~~~~l~ri~~~~~~lna~~~~~~~~a~~------~~gpL~GvPi~vKD~~~~~g~~tt~G 79 (475)
T d2gi3a1 6 FRKLTIEECLKLSEEEREKLPQLSLETIKRLDPHVKAFISVRENVSVE------KKGKFWGIPVAIKDNILTLGMRTTCA 79 (475)
T ss_dssp GGGCCHHHHTTSCHHHHTTHHHHHHHHHHHHHHHHCCEEEECCCCCCC------CCSTTTTCEEEEETTBCCSSSCCCTT
T ss_pred hHHhHHHHHHHcCCCCHHHHHHHHHHHHHHHCCcCCEEEEcCHHHhhh------ccCCCCCCEEEEEcccCCCCCccCcc
Confidence 345556666444442 343 8899999999988776543 46999999999999999999999999
Q ss_pred ChhhhhcCCCCCCCHHHHHHHHhCCCeeeeecCccccccccCCCCCCCCCCCCCCCCCCCCCCCChhHHHHHhcCCCccc
Q 008755 80 HPEWARTHSAASRTSTVVSTLVEGGATCIGKTVVDEFAYSINGTNKHYDTPTNPAAPSQMPGGSSSGAAVAVAADLVDFS 159 (554)
Q Consensus 80 s~~~~~~~~~~~~da~~v~~L~~aGai~~gkt~~~e~~~~~~~~~~~~g~~~NP~~~~~~~GGSSgGsaaaVaag~~~~a 159 (554)
|+.+++ +++.+||++|+|||++|||++||||||||+++..+.|.+||+|+||||++++||||||||||+||+|++++|
T Consensus 80 s~~~~~--~~~~~da~~v~~L~~aGaii~Gktn~~e~~~~~~~~~~~~G~t~nP~~~~~~~GGSSgGsaaavAag~~~~a 157 (475)
T d2gi3a1 80 SRILEN--YESVFDATVVKKMKEAGFVVVGKANLDEFAMGSSTERSAFFPTRNPWDLERVPGGSSGGSAAAVSAGMVVAA 157 (475)
T ss_dssp CGGGTT--CCCCSCCHHHHHHHHHTCEEEEEECCSGGGCCSSSTTCSSCCCCBTTBTTBCCCSSSHHHHHHHHTTSSSEE
T ss_pred ChhhcC--CCCCCCcceeeehhhcCCccccccchhhcccccccccchhcccccccccccccCcccccchhhhhhcCcceE
Confidence 999986 489999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccCCCCcccccccccCcccccCCCCccccCCccccCCCCCcccccccCHHHHHHHHHHhcCCCccc-------------
Q 008755 160 LGIDTVGGVRVPSAFCGILGFRPSYGAVSHMGIIPISTSLDTVGWFARDPKILRHVGHVLLQLPFAA------------- 226 (554)
Q Consensus 160 ~GtD~gGSiR~PAa~~Gv~GlkPT~G~v~~~G~~p~~~s~d~~G~~ar~~~dl~~v~~~l~~~~~~~------------- 226 (554)
+|||||||||+||+||||||||||+||||+.|++|+++++|++|||||+++|+..+++++.+.+..+
T Consensus 158 ~GtD~gGSiR~PA~~~Gv~G~kPt~G~i~~~g~~~~~~~~d~~GpmaRsv~D~alll~v~~g~d~~d~~s~~~~~~~~~~ 237 (475)
T d2gi3a1 158 LGSDTGGSVRQPASLCGVVGYKPTYGLVSRYGLVAFASSLDQIGPITKTVRDAAILMEIISGRDENDATTVNRKVDFLSE 237 (475)
T ss_dssp EEEESSSTTHHHHHHHTSEEEECCTTSBCCTTBCCSCTTTCEEEEEESSHHHHHHHHHHHBSCBTTBTTCCSCCCCSSTT
T ss_pred eecCCCccchhhhHHhCceeecCCCCCCCCCCCCCCCCCCCccCCccCCHHHHHHHhhhhhccccccccccccccccchh
Confidence 9999999999999999999999999999999999999999999999999999999999987654322
Q ss_pred ---CCCCceEEEccchhhhcCCChHHHHHHHHHHHHHHc--CCccceeccCcccccccCCChhhHhhhhhhHHHHHHHHH
Q 008755 227 ---QRSPRQIIIADDCFELLKIPADRVVQVVIKSTEKLF--GRQVLKHENLGEYFDSKVPSLKGFHKTNGELKNVMRLIQ 301 (554)
Q Consensus 227 ---~~~~~~l~i~~~~~~~~~~~~~~~~~~~~~a~~~l~--G~~vv~~~~l~~~v~~~~p~~~~~~~~~~~~~~~~~~~~ 301 (554)
..++.++++..+.+. ...++++.++++++++.|. |++|++ +++ |.+.+... .+..+.
T Consensus 238 ~~~~~~~~ri~~~~~~~~--~~~~~~v~~a~~~a~~~L~~~G~~V~e-v~~--------p~~~~~~~-------~~~~i~ 299 (475)
T d2gi3a1 238 IEEGVSGMKFAVPEEIYE--HDIEEGVSERFEEALKLLERLGAKVER-VKI--------PHIKYSVA-------TYYVIA 299 (475)
T ss_dssp TTSCCTTCEEEEEGGGGG--SCCCHHHHHHHHHHHHHHHHTTCEEEE-ECC--------TTGGGHHH-------HHHHHH
T ss_pred ccccccccceeeeecccc--CCCCHHHHHHHHHHHHHHHHCCCEEEE-eCC--------CchHHHHH-------HHHHHH
Confidence 234567777655432 3357889999999999886 777743 222 33222111 111111
Q ss_pred HHHHHhhh------------------HHHHhhhCCCCCHHHHHHHHHhhcCC-----HHHHHHHHHHHHHHHHHHHhhcC
Q 008755 302 RYEFKNNH------------------NEWIESVKPALDPDISAEIGEMLEIS-----ETVIENCKSIRNEMRSAISSLLK 358 (554)
Q Consensus 302 ~~e~~~~~------------------~~~~~~~~~~~~p~~~~~~~~g~~~s-----~~~~~~a~~~r~~~~~~~~~~~~ 358 (554)
..++...+ ..+...+...+.+.++.++..+.... ..++.++.+.|..++..+.++|+
T Consensus 300 ~~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 379 (475)
T d2gi3a1 300 PAEASSNLARFDGVKYGLRIKEKGLREMYMKTRNVGFGEEVRRRIMIGTFTLSAAYYEAYFNKAMKVRRKISDELNEVLS 379 (475)
T ss_dssp HHHHHTC------------------------CCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHhhcchhhhhcccccHHHHHHhhhhcccCHHHHHHHHhcchhhchHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 11211111 11112223346677777777665433 33445677888899999999999
Q ss_pred CCcEEEEcCCCCCCCCCCCCCCchHHHHHHHhhhhhcccccCCceecccCCCCCCCCceeEEEeccCCcHHHHHHHHHHH
Q 008755 359 DDGILVTPTTAYPPPKLGGKEMLSEDYQNRAFSLLSIASVSGCCQVTVPLGYYDKCPTSVSFIARHGGDRFLLDTVQNMY 438 (554)
Q Consensus 359 ~~D~ll~Pt~~~~ap~~~~~~~~~~~~~~~~~~~t~~~nl~G~PaisvP~g~~~g~p~g~~~~~~~~~d~~ll~~a~~le 438 (554)
++|+||+||++.++|+++....+...+ ....||.++|++|+|+||||+|+.+|||+|+|+++++++|..|+++++++|
T Consensus 380 ~~D~ll~Pt~~~~a~~~~~~~~~~~~~--~~~~~t~~~Nl~G~PaisvP~G~s~GlPvGvQlig~~~~D~~LL~~A~~~E 457 (475)
T d2gi3a1 380 QYDAILTPTSPVTAFKIGEIKDPLTYY--LMDIFTIPANLAGLPAISVPFGFSNNLPVGVQVIGRRFADGKVFRIARAIE 457 (475)
T ss_dssp HSSEEEEESCSSCCCBTTTCCCHHHHH--TTTTTTHHHHHHTCCEEEEEEEEETTEEEEEEEECCTTCHHHHHHHHHHHH
T ss_pred CCCEEEeCCCCCCCCCcccccchHHHh--hhhHHHHHHHHHCCCeEEEeCCCCCCCCEeEEEECCCCCHHHHHHHHHHHH
Confidence 999999999999999998754332221 233489999999999999999999999999999999999999999999999
Q ss_pred HHH
Q 008755 439 ASL 441 (554)
Q Consensus 439 ~~l 441 (554)
+..
T Consensus 458 ~~~ 460 (475)
T d2gi3a1 458 KNS 460 (475)
T ss_dssp HHC
T ss_pred HcC
Confidence 764
|
| >d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|