Citrus Sinensis ID: 008761
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 554 | 2.2.26 [Sep-21-2011] | |||||||
| Q9LKL2 | 618 | Two-component response re | yes | no | 0.940 | 0.843 | 0.513 | 1e-157 | |
| Q689G9 | 518 | Two-component response re | yes | no | 0.826 | 0.884 | 0.460 | 1e-110 | |
| Q6LA42 | 558 | Two-component response re | no | no | 0.240 | 0.238 | 0.458 | 2e-28 | |
| Q8L500 | 468 | Two-component response re | no | no | 0.234 | 0.277 | 0.415 | 5e-28 | |
| Q9LVG4 | 495 | Two-component response re | no | no | 0.220 | 0.246 | 0.483 | 8e-28 | |
| Q689G6 | 623 | Two-component response re | no | no | 0.241 | 0.215 | 0.425 | 3e-27 | |
| Q10N34 | 767 | Two-component response re | no | no | 0.216 | 0.156 | 0.437 | 9e-26 | |
| A2XFB7 | 767 | Two-component response re | N/A | no | 0.216 | 0.156 | 0.437 | 1e-25 | |
| Q0D3B6 | 742 | Two-component response re | no | no | 0.231 | 0.172 | 0.421 | 2e-25 | |
| A2YQ93 | 742 | Two-component response re | N/A | no | 0.231 | 0.172 | 0.421 | 2e-25 |
| >sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR1 OS=Arabidopsis thaliana GN=APRR1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 555 bits (1430), Expect = e-157, Method: Compositional matrix adjust.
Identities = 331/644 (51%), Positives = 395/644 (61%), Gaps = 123/644 (19%)
Query: 6 MNLNKECSGAGIGNSKSSGDGFIDRSKVRILLCDNDSNSSDAVFSLLVKCSYQVTSVRSP 65
M+LN EC G GDGFIDRS+VRILLCDNDS S VF+LL +CSYQVT+V+S
Sbjct: 1 MDLNGECKG---------GDGFIDRSRVRILLCDNDSTSLGEVFTLLSECSYQVTAVKSA 51
Query: 66 RQVIDALNAEGSDIDLILAEVDLPMTKGLKMLKYITRDKELQRIPVIMMSAQDEVSVVVK 125
RQVIDALNAEG DID+ILAE+DLPM KG+KML+YITRDK+L+RIPVIMMS QDEV VVVK
Sbjct: 52 RQVIDALNAEGPDIDIILAEIDLPMAKGMKMLRYITRDKDLRRIPVIMMSRQDEVPVVVK 111
Query: 126 CLRLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNILSYDFDLVASDPSDANTNST 185
CL+LGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKN+LSYDFDLV SD SD NTNST
Sbjct: 112 CLKLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNMLSYDFDLVGSDQSDPNTNST 171
Query: 186 TLFSDDTDDKSRRSTNPEIGMSTHQETE----SVPV--------ATATVVASTSGTAAVE 233
LFSDDTDD+S RSTNP+ G +HQE E + PV A T +S + TA
Sbjct: 172 NLFSDDTDDRSLRSTNPQRGNLSHQENEWSVATAPVHARDGGLGADGTATSSLAVTAIEP 231
Query: 234 PIDASECGPDVPGISDRRTA----GPKKIELRIGESSAFFTYVKSNMPRDSS-------- 281
P+D P + A PKK L+IGESSAFFTYVKS + R +
Sbjct: 232 PLDHLAGSHHEPMKRNSNPAQFSSAPKKSRLKIGESSAFFTYVKSTVLRTNGQDPPLVDG 291
Query: 282 --------------------------------------------PRIVNVDDSAAQNVRM 297
P +VN + S +
Sbjct: 292 NGSLHLHRGLAEKFQVVASEGINNTKQARRATPKSTVLRTNGQDPPLVNGNGSHHLHRGA 351
Query: 298 EEKCQPCCQQVVSDTRIHENGEAWENY-SQGEDFRSSSSVPDSLSMERSSTPPTDF-PQN 355
EK Q + +++T+ E Y SQGE ++ +S P SL ERS T PT
Sbjct: 352 AEKFQVVASEGINNTKQAHRSRGTEQYHSQGETLQNGASYPHSL--ERSRTLPTSMESHG 409
Query: 356 RNFKDEKFFQPQMPPTRNE-----------PPQATYQYYMSGAMNQVMLPSSSAQMYQKN 404
RN+++ PQ+ R++ P A Y YYM G MNQVM+ S+
Sbjct: 410 RNYQEGNMNIPQVAMNRSKDSSQVDGSGFSAPNA-YPYYMHGVMNQVMMQSA-------- 460
Query: 405 LHELQNHSMLPQYNH-LPQCVP-HVNGMASFPYY--PIN-------MCLQPGQVSA--NS 451
+M+PQY H +P C P H NGM +PYY P+N M LQ GQ+S +S
Sbjct: 461 -------AMMPQYGHQIPHCQPNHPNGMTGYPYYHHPMNTSLQHSQMSLQNGQMSMVHHS 513
Query: 452 WPSYGNSPSTEVKMNKVDRREAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFV 511
W GN PS EV++NK+DRRE AL+KFR+KR +RCFDKKIRYVNRKRLAERRPRV+GQFV
Sbjct: 514 WSPAGNPPSNEVRVNKLDRREEALLKFRRKRNQRCFDKKIRYVNRKRLAERRPRVKGQFV 573
Query: 512 RKVNGVNVDLNGQPSSVDYDE--DEDEEEEMASRDSSPDNDTSG 553
RK+NGVNVDLNGQP S DYD+ +E+EEEE +RDSSP +D G
Sbjct: 574 RKMNGVNVDLNGQPDSADYDDEEEEEEEEEEENRDSSPQDDALG 617
|
Controls photoperiodic flowering response. Component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock. Positive regulator of CCA1 and LHY expression. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q689G9|PRR1_ORYSJ Two-component response regulator-like PRR1 OS=Oryza sativa subsp. japonica GN=PRR1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR5 OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR9 OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR95 OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 554 | ||||||
| 359491315 | 556 | PREDICTED: two-component response regula | 0.927 | 0.924 | 0.716 | 0.0 | |
| 51980216 | 545 | timing of CAB expression 1 protein [Cast | 0.920 | 0.935 | 0.683 | 0.0 | |
| 255547335 | 550 | sensory transduction histidine kinase, p | 0.958 | 0.965 | 0.680 | 0.0 | |
| 356508533 | 560 | PREDICTED: two-component response regula | 0.965 | 0.955 | 0.643 | 0.0 | |
| 224124202 | 541 | pseudo response regulator [Populus trich | 0.909 | 0.931 | 0.687 | 0.0 | |
| 297733942 | 533 | unnamed protein product [Vitis vinifera] | 0.879 | 0.913 | 0.689 | 0.0 | |
| 351722597 | 558 | timing of CAB expression 1 [Glycine max] | 0.960 | 0.953 | 0.641 | 0.0 | |
| 356513521 | 559 | PREDICTED: two-component response regula | 0.972 | 0.964 | 0.660 | 0.0 | |
| 356565113 | 565 | PREDICTED: two-component response regula | 0.971 | 0.952 | 0.647 | 0.0 | |
| 449486993 | 557 | PREDICTED: LOW QUALITY PROTEIN: two-comp | 0.954 | 0.949 | 0.644 | 0.0 |
| >gi|359491315|ref|XP_002281757.2| PREDICTED: two-component response regulator-like APRR1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 734 bits (1896), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 389/543 (71%), Positives = 448/543 (82%), Gaps = 29/543 (5%)
Query: 27 FIDRSKVRILLCDNDSNSSDAVFSLLVKCSYQVTSVRSPRQVIDALNAEGSDIDLILAEV 86
FIDRS VRILLCDND+ SSD +F+LL CSYQVTSVRS RQVIDALNAEG DID+ILAEV
Sbjct: 21 FIDRSNVRILLCDNDTKSSDEIFTLLCGCSYQVTSVRSARQVIDALNAEGHDIDIILAEV 80
Query: 87 DLPMTKGLKMLKYITRDKELQRIPVIMMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLN 146
DLPMTKG+KMLKYI RDKEL+RIP+IMMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLN
Sbjct: 81 DLPMTKGMKMLKYIMRDKELRRIPIIMMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLN 140
Query: 147 LWTHMWRRRRMLGLAEKNILSYDFDLVASDPSDANTNSTTLFSDDTDDKSRRSTNPEIGM 206
LWTHMWRRRRMLGLAEKNIL+YDFD+ ASDPSDANTNS T+FSDDTDDKSR S NPE+ +
Sbjct: 141 LWTHMWRRRRMLGLAEKNILNYDFDVAASDPSDANTNS-TMFSDDTDDKSRMSANPEMVV 199
Query: 207 STHQETESVPVATATVVASTSGTAAVEP--IDASECGPDVPGISDRRT----AGPKKIEL 260
S HQE E V ++ AT+ S A EP ++ EC PDVPGISDRRT +GPKK EL
Sbjct: 200 SVHQEDE-VSLSNATI---DSTDVAAEPPVVNQLECRPDVPGISDRRTGQLLSGPKKSEL 255
Query: 261 RIGESSAFFTYVKSNMPRDSSPRIVNVDDSAAQNVRMEEKCQPCCQQVVSDTRIHENGEA 320
++GESSAFFTYVKS+M + +S I N+++SA Q+ RMEE+ Q ++ V+DT+ HENGEA
Sbjct: 256 KVGESSAFFTYVKSSMIKTNSQGIPNINESAPQHSRMEERVQAWSEKGVNDTQEHENGEA 315
Query: 321 WENYSQGEDFRSSSSVPDSLSMERSSTPPT--DFPQNRNFKDEKFFQPQMPPTRNE---- 374
WENYSQG+DF SS+S+PDSLS+E S TPP +F Q RN K E+F Q + P RNE
Sbjct: 316 WENYSQGDDFPSSNSIPDSLSVEMSCTPPAPIEFVQGRNSKGEEFSQVPIHP-RNEHQVD 374
Query: 375 ----PPQATYQYYMSGAMNQVMLPSSSAQMYQKNLHELQNH----SMLPQYNHLPQCVPH 426
P Y Y MSG MNQVM+P SSAQ+Y K+LH++QN+ +MLPQYNHLPQC PH
Sbjct: 375 ISGFPGHTAYPYCMSGVMNQVMMP-SSAQLYPKSLHDMQNNATTSAMLPQYNHLPQCPPH 433
Query: 427 VNGMASFPYYPINMCLQPGQVS-ANSWPSYGNSPSTEVKMNKVDRREAALIKFRQKRKER 485
V G+ASFPYYP+++CLQPGQ+S + WPSYGNS STEVK+ KVDRREAALIKFRQKRKER
Sbjct: 434 VPGVASFPYYPVSICLQPGQMSTTHPWPSYGNSSSTEVKLGKVDRREAALIKFRQKRKER 493
Query: 486 CFDKKIRYVNRKRLAERRPRVRGQFVRKVNGVNVDLNGQPSSVDYDEDEDEEEEM-ASRD 544
CFDKKIRYVNRKRLAERRPRVRGQFVRK+NGVNVDLNG+P+SVD+DEDE+E EE ASRD
Sbjct: 494 CFDKKIRYVNRKRLAERRPRVRGQFVRKMNGVNVDLNGRPASVDFDEDEEEYEEENASRD 553
Query: 545 SSP 547
S+P
Sbjct: 554 STP 556
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|51980216|gb|AAU20772.1| timing of CAB expression 1 protein [Castanea sativa] | Back alignment and taxonomy information |
|---|
| >gi|255547335|ref|XP_002514725.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223546329|gb|EEF47831.1| sensory transduction histidine kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356508533|ref|XP_003523010.1| PREDICTED: two-component response regulator-like APRR1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224124202|ref|XP_002330130.1| pseudo response regulator [Populus trichocarpa] gi|222871264|gb|EEF08395.1| pseudo response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297733942|emb|CBI15189.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351722597|ref|NP_001235202.1| timing of CAB expression 1 [Glycine max] gi|158999372|gb|ABW87010.1| timing of CAB expression 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356513521|ref|XP_003525462.1| PREDICTED: two-component response regulator-like APRR1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356565113|ref|XP_003550789.1| PREDICTED: two-component response regulator-like APRR1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449486993|ref|XP_004157464.1| PREDICTED: LOW QUALITY PROTEIN: two-component response regulator-like APRR1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 554 | ||||||
| TAIR|locus:2163198 | 618 | TOC1 "TIMING OF CAB EXPRESSION | 0.476 | 0.427 | 0.591 | 7.9e-129 | |
| TAIR|locus:2044376 | 468 | PRR9 "pseudo-response regulato | 0.231 | 0.273 | 0.421 | 2.2e-40 | |
| TAIR|locus:2151206 | 727 | PRR7 "pseudo-response regulato | 0.231 | 0.176 | 0.421 | 3.2e-36 | |
| TAIR|locus:2130095 | 664 | RR2 "response regulator 2" [Ar | 0.247 | 0.206 | 0.347 | 2.2e-15 | |
| TAIR|locus:2116587 | 552 | RR10 "response regulator 10" [ | 0.220 | 0.221 | 0.336 | 9.1e-15 | |
| TAIR|locus:2062749 | 183 | AT2G46670 "AT2G46670" [Arabido | 0.122 | 0.371 | 0.563 | 1.8e-14 | |
| TAIR|locus:2093668 | 690 | RR1 "response regulator 1" [Ar | 0.252 | 0.202 | 0.335 | 5.8e-14 | |
| TAIR|locus:2040194 | 596 | RR12 "response regulator 12" [ | 0.216 | 0.201 | 0.357 | 5.8e-14 | |
| TAIR|locus:2008585 | 521 | ARR11 "response regulator 11" | 0.216 | 0.230 | 0.349 | 1.2e-13 | |
| UNIPROTKB|Q7Y0W3 | 341 | Q7Y0W3 "Two-component response | 0.216 | 0.351 | 0.308 | 4.9e-13 |
| TAIR|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 782 (280.3 bits), Expect = 7.9e-129, Sum P(2) = 7.9e-129
Identities = 171/289 (59%), Positives = 194/289 (67%)
Query: 6 MNLNKECSGAGIGNSKSSGDGFIDRSKVRILLCDNDSNSSDAVFSLLVKCSYQVTSVRSP 65
M+LN EC G GDGFIDRS+VRILLCDNDS S VF+LL +CSYQVT+V+S
Sbjct: 1 MDLNGECKG---------GDGFIDRSRVRILLCDNDSTSLGEVFTLLSECSYQVTAVKSA 51
Query: 66 RQVIDALNAEGSDIDLILAEVDLPMTKGLKMLKYITRDKELQRIPVIMMSAQDEVSVVVK 125
RQVIDALNAEG DID+ILAE+DLPM KG+KML+YITRDK+L+RIPVIMMS QDEV VVVK
Sbjct: 52 RQVIDALNAEGPDIDIILAEIDLPMAKGMKMLRYITRDKDLRRIPVIMMSRQDEVPVVVK 111
Query: 126 CLRLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNILSYDFDLVASDPSDANTNST 185
CL+LGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKN+LSYDFDLV SD SD NTNST
Sbjct: 112 CLKLGAADYLVKPLRTNELLNLWTHMWRRRRMLGLAEKNMLSYDFDLVGSDQSDPNTNST 171
Query: 186 TLFXXXXXXXXXXXXNPEIGMSTHQXXXXXXXXX------------XXXXXXXXXXXXXX 233
LF NP+ G +HQ
Sbjct: 172 NLFSDDTDDRSLRSTNPQRGNLSHQENEWSVATAPVHARDGGLGADGTATSSLAVTAIEP 231
Query: 234 PID---ASECGPDVPGISDRR-TAGPKKIELRIGESSAFFTYVKSNMPR 278
P+D S P + + ++ PKK L+IGESSAFFTYVKS + R
Sbjct: 232 PLDHLAGSHHEPMKRNSNPAQFSSAPKKSRLKIGESSAFFTYVKSTVLR 280
|
|
| TAIR|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062749 AT2G46670 "AT2G46670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Y0W3 Q7Y0W3 "Two-component response regulator EHD1" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9LKL2 | APRR1_ARATH | No assigned EC number | 0.5139 | 0.9404 | 0.8430 | yes | no |
| Q689G9 | PRR1_ORYSJ | No assigned EC number | 0.4600 | 0.8267 | 0.8841 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 554 | |||
| pfam06203 | 45 | pfam06203, CCT, CCT motif | 2e-19 | |
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 4e-19 | |
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 1e-16 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 3e-16 | |
| COG0745 | 229 | COG0745, OmpR, Response regulators consisting of a | 3e-16 | |
| COG3706 | 435 | COG3706, PleD, Response regulator containing a Che | 1e-13 | |
| COG2204 | 464 | COG2204, AtoC, Response regulator containing CheY- | 1e-12 | |
| TIGR02154 | 226 | TIGR02154, PhoB, phosphate regulon transcriptional | 1e-12 | |
| TIGR01387 | 218 | TIGR01387, cztR_silR_copR, heavy metal response re | 3e-10 | |
| PRK10365 | 441 | PRK10365, PRK10365, transcriptional regulatory pro | 7e-09 | |
| COG2197 | 211 | COG2197, CitB, Response regulator containing a Che | 7e-09 | |
| PRK10610 | 129 | PRK10610, PRK10610, chemotaxis regulatory protein | 1e-08 | |
| COG4565 | 224 | COG4565, CitB, Response regulator of citrate/malat | 2e-08 | |
| PRK10161 | 229 | PRK10161, PRK10161, transcriptional regulator PhoB | 3e-08 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 3e-08 | |
| PLN03029 | 222 | PLN03029, PLN03029, type-a response regulator prot | 4e-08 | |
| PRK10693 | 303 | PRK10693, PRK10693, response regulator of RpoS; Pr | 1e-07 | |
| PRK11361 | 457 | PRK11361, PRK11361, acetoacetate metabolism regula | 1e-07 | |
| PRK11517 | 223 | PRK11517, PRK11517, transcriptional regulatory pro | 2e-07 | |
| PRK10955 | 232 | PRK10955, PRK10955, DNA-binding transcriptional re | 2e-07 | |
| PRK10336 | 219 | PRK10336, PRK10336, DNA-binding transcriptional re | 3e-07 | |
| CHL00148 | 240 | CHL00148, orf27, Ycf27; Reviewed | 8e-07 | |
| PRK10923 | 469 | PRK10923, glnG, nitrogen regulation protein NR(I); | 2e-06 | |
| PRK09468 | 239 | PRK09468, ompR, osmolarity response regulator; Pro | 3e-06 | |
| COG3437 | 360 | COG3437, COG3437, Response regulator containing a | 4e-06 | |
| TIGR01818 | 463 | TIGR01818, ntrC, nitrogen regulation protein NR(I) | 4e-06 | |
| COG4566 | 202 | COG4566, TtrR, Response regulator [Signal transduc | 5e-06 | |
| COG3947 | 361 | COG3947, COG3947, Response regulator containing Ch | 1e-05 | |
| PRK10529 | 225 | PRK10529, PRK10529, DNA-binding transcriptional ac | 1e-05 | |
| PRK09836 | 227 | PRK09836, PRK09836, DNA-binding transcriptional ac | 2e-05 | |
| PRK10643 | 222 | PRK10643, PRK10643, DNA-binding transcriptional re | 2e-05 | |
| PRK10766 | 221 | PRK10766, PRK10766, DNA-binding transcriptional re | 3e-05 | |
| PRK15479 | 221 | PRK15479, PRK15479, transcriptional regulatory pro | 3e-05 | |
| PRK13856 | 241 | PRK13856, PRK13856, two-component response regulat | 4e-05 | |
| PRK10430 | 239 | PRK10430, PRK10430, DNA-binding transcriptional ac | 7e-05 | |
| PRK10651 | 216 | PRK10651, PRK10651, transcriptional regulator NarL | 1e-04 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 2e-04 | |
| PRK10046 | 225 | PRK10046, dpiA, two-component response regulator D | 2e-04 | |
| COG4753 | 475 | COG4753, COG4753, Response regulator containing Ch | 5e-04 | |
| smart00448 | 55 | smart00448, REC, cheY-homologous receiver domain | 0.001 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 0.001 | |
| TIGR02875 | 262 | TIGR02875, spore_0_A, sporulation transcription fa | 0.002 | |
| PRK10710 | 240 | PRK10710, PRK10710, DNA-binding transcriptional re | 0.003 | |
| PRK11083 | 228 | PRK11083, PRK11083, DNA-binding response regulator | 0.003 | |
| PRK09390 | 202 | PRK09390, fixJ, response regulator FixJ; Provision | 0.003 | |
| PRK00742 | 354 | PRK00742, PRK00742, chemotaxis-specific methyleste | 0.004 |
| >gnl|CDD|203407 pfam06203, CCT, CCT motif | Back alignment and domain information |
|---|
Score = 81.1 bits (201), Expect = 2e-19
Identities = 27/43 (62%), Positives = 38/43 (88%)
Query: 471 REAALIKFRQKRKERCFDKKIRYVNRKRLAERRPRVRGQFVRK 513
REAAL+++++KRK R FDKKIRY +RK +AE RPRV+G+FV++
Sbjct: 1 REAALLRYKEKRKTRKFDKKIRYASRKAVAESRPRVKGRFVKQ 43
|
This short motif is found in a number of plant proteins. It is rich in basic amino acids and has been called a CCT motif after Co, Col and Toc1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif. Toc1 mutants have been identified in this region. Length = 45 |
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator | Back alignment and domain information |
|---|
| >gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172377 PRK13856, PRK13856, two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182454 PRK10430, PRK10430, DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182208 PRK10046, dpiA, two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 554 | |||
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 99.92 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.87 | |
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 99.86 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 99.81 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 99.79 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 99.79 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 99.78 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 99.78 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 99.76 | |
| PF06203 | 45 | CCT: CCT motif; InterPro: IPR010402 The CCT (CONST | 99.74 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 99.72 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 99.71 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 99.71 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 99.69 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 99.68 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 99.67 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 99.67 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 99.66 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 99.66 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 99.65 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 99.65 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 99.65 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 99.65 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 99.64 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 99.64 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 99.64 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 99.63 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 99.63 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 99.63 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 99.62 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 99.62 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 99.62 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 99.62 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.61 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 99.61 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 99.6 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 99.6 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 99.6 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 99.59 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 99.58 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 99.57 | |
| PRK09483 | 217 | response regulator; Provisional | 99.57 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 99.57 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 99.57 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.57 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 99.56 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 99.56 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 99.55 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.55 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.55 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.55 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 99.54 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 99.54 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 99.54 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 99.53 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 99.53 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 99.52 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 99.52 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 99.52 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 99.51 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 99.51 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.51 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 99.5 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 99.49 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 99.47 | |
| PRK13435 | 145 | response regulator; Provisional | 99.47 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 99.44 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 99.42 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 99.42 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.41 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 99.41 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 99.34 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 99.32 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 99.29 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 99.28 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 99.26 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 99.22 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.17 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 99.15 | |
| COG3279 | 244 | LytT Response regulator of the LytR/AlgR family [T | 99.04 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 99.01 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 98.3 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 98.19 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 97.59 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 97.42 | |
| PRK02261 | 137 | methylaspartate mutase subunit S; Provisional | 97.1 | |
| PF01339 | 182 | CheB_methylest: CheB methylesterase; InterPro: IPR | 96.81 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 96.76 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 96.68 | |
| PF03709 | 115 | OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal | 95.72 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 95.61 | |
| TIGR01501 | 134 | MthylAspMutase methylaspartate mutase, S subunit. | 95.26 | |
| KOG1601 | 340 | consensus GATA-4/5/6 transcription factors [Transc | 95.05 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 94.5 | |
| PF09425 | 27 | CCT_2: Divergent CCT motif; InterPro: IPR018467 Th | 94.46 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 94.0 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 93.68 | |
| COG2185 | 143 | Sbm Methylmalonyl-CoA mutase, C-terminal domain/su | 93.65 | |
| PRK15399 | 713 | lysine decarboxylase LdcC; Provisional | 93.48 | |
| cd02072 | 128 | Glm_B12_BD B12 binding domain of glutamate mutase | 93.23 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 93.14 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 92.92 | |
| PRK15400 | 714 | lysine decarboxylase CadA; Provisional | 92.53 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 90.57 | |
| cd02069 | 213 | methionine_synthase_B12_BD B12 binding domain of m | 90.43 | |
| COG4999 | 140 | Uncharacterized domain of BarA-like signal transdu | 90.09 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 89.63 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 88.82 | |
| PRK09426 | 714 | methylmalonyl-CoA mutase; Reviewed | 87.7 | |
| TIGR02370 | 197 | pyl_corrinoid methyltransferase cognate corrinoid | 87.23 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 87.2 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 86.0 | |
| PF10087 | 97 | DUF2325: Uncharacterized protein conserved in bact | 84.18 | |
| cd02068 | 127 | radical_SAM_B12_BD B12 binding domain_like associa | 83.62 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 83.2 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 83.03 | |
| PRK03958 | 176 | tRNA 2'-O-methylase; Reviewed | 81.81 | |
| COG0512 | 191 | PabA Anthranilate/para-aminobenzoate synthases com | 81.33 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 81.13 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 80.4 |
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.92 E-value=9.5e-25 Score=227.76 Aligned_cols=183 Identities=23% Similarity=0.345 Sum_probs=135.5
Q ss_pred CcEEEEEeCCHHHHHHHHHHHhhCC-CE-EEEECCHHHHHHHHHhcCCCceEEEEecCCCCCcHHHHHHHHHhccCCCCc
Q 008761 32 KVRILLCDNDSNSSDAVFSLLVKCS-YQ-VTSVRSPRQVIDALNAEGSDIDLILAEVDLPMTKGLKMLKYITRDKELQRI 109 (554)
Q Consensus 32 kirVLIVDDd~~~r~~L~~lL~~~g-~e-V~~A~dg~EALe~L~~~~~~PDLILLDi~MP~mDGlElLr~Ir~~~~~~~i 109 (554)
++|||||||++.+|..|+++|...+ ++ |.++.|+.+|++++... .||||+||++||.|||+++++.|++. .++
T Consensus 1 ~irVlvVddsal~R~~i~~~l~~~~~i~vv~~a~ng~~a~~~~~~~--~PDVi~ld~emp~mdgl~~l~~im~~---~p~ 75 (350)
T COG2201 1 KIRVLVVDDSALMRKVISDILNSDPDIEVVGTARNGREAIDKVKKL--KPDVITLDVEMPVMDGLEALRKIMRL---RPL 75 (350)
T ss_pred CcEEEEEcCcHHHHHHHHHHHhcCCCeEEEEecCCHHHHHHHHHhc--CCCEEEEecccccccHHHHHHHHhcC---CCC
Confidence 5799999999999999999999998 55 55999999999999987 89999999999999999999999975 789
Q ss_pred eEEEEecC--CCHHHHHHHHHcCCCEEEeCCCCH--HHHHHHHHHHHHHHHHhhhhhhhccccccccccCCCCCCCCCcc
Q 008761 110 PVIMMSAQ--DEVSVVVKCLRLGAADYLVKPLRT--NELLNLWTHMWRRRRMLGLAEKNILSYDFDLVASDPSDANTNST 185 (554)
Q Consensus 110 PIIVLSs~--~d~e~~~eAL~aGA~DyL~KP~~~--eeL~~~L~~llr~~rl~~~~~~~~~~~~~~~v~ssps~a~s~~~ 185 (554)
||||+|+. ...+...+||++||.||+.||... ..+....+.+..+.+.........+..
T Consensus 76 pVimvsslt~~g~~~t~~al~~gAvD~i~kp~~~i~~~~~~~~~~l~~kv~~~~~~~~~~l~~----------------- 138 (350)
T COG2201 76 PVIMVSSLTEEGAEATLEALELGAVDFIAKPSGGISLGLDEVAELLIEKVRAAARQNRKSLRT----------------- 138 (350)
T ss_pred cEEEEeccccccHHHHHHHHhcCcceeecCCCcccccchHHHHHHHHHHHHHHhhcccccccc-----------------
Confidence 99999974 347789999999999999999853 333333333333333222111010000
Q ss_pred eeeccCCccccccCCCCCCCCCCCcccCCCCccEEEEEccCcchhcccccccccCCCCCc-ccccc
Q 008761 186 TLFSDDTDDKSRRSTNPEIGMSTHQETESVPVATATVVASTSGTAAVEPIDASECGPDVP-GISDR 250 (554)
Q Consensus 186 vLi~get~~~~~~~~~~~~~~~t~~e~~s~~~~iVaIGASTGGp~AL~~I~L~~lPaD~P-pil~~ 250 (554)
... ...+ ...+........++|+||+|||||+||+.| |..||+||| |++.-
T Consensus 139 ----~~~-------~~~~--~~~~~~~~~~~~~iV~IGaStGGp~AL~~i-l~~lP~~~p~pvvIv 190 (350)
T COG2201 139 ----PEP-------PRAP--AFRPVKPGPAARKIVAIGASTGGPAALRAV-LPALPADFPAPVVIV 190 (350)
T ss_pred ----cCC-------CCcc--ccCCCCCCCCCccEEEEEeCCCCHHHHHHH-HHhCCCCCCCCEEEE
Confidence 000 0000 000111133557899999999999999999 999999999 76554
|
|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PF06203 CCT: CCT motif; InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >PRK02261 methylaspartate mutase subunit S; Provisional | Back alignment and domain information |
|---|
| >PF01339 CheB_methylest: CheB methylesterase; InterPro: IPR000673 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >TIGR01501 MthylAspMutase methylaspartate mutase, S subunit | Back alignment and domain information |
|---|
| >KOG1601 consensus GATA-4/5/6 transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PF09425 CCT_2: Divergent CCT motif; InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1 | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK15399 lysine decarboxylase LdcC; Provisional | Back alignment and domain information |
|---|
| >cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK15400 lysine decarboxylase CadA; Provisional | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase | Back alignment and domain information |
|---|
| >COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09426 methylmalonyl-CoA mutase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK03958 tRNA 2'-O-methylase; Reviewed | Back alignment and domain information |
|---|
| >COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 554 | ||||
| 1nxo_A | 120 | Micarec Ph7.0 Length = 120 | 3e-08 | ||
| 1nxt_A | 120 | Micarec Ph 4.0 Length = 120 | 4e-08 | ||
| 2jb9_A | 127 | Phob Response Regulator Receiver Domain Constitutiv | 2e-07 | ||
| 1zes_A | 125 | Bef3- Activated Phob Receiver Domain Length = 125 | 4e-07 | ||
| 1b00_A | 127 | Phob Receiver Domain From Escherichia Coli Length = | 4e-07 | ||
| 3q9s_A | 249 | Crystal Structure Of Rra(1-215) From Deinococcus Ra | 5e-07 | ||
| 3m6m_D | 143 | Crystal Structure Of Rpff Complexed With Rec Domain | 5e-07 | ||
| 3rvj_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 6e-07 | ||
| 3f7a_A | 394 | Structure Of Orthorhombic Crystal Form Of Pseudomon | 9e-07 | ||
| 3to5_A | 134 | High Resolution Structure Of Chey3 From Vibrio Chol | 1e-06 | ||
| 3eq2_A | 394 | Structure Of Hexagonal Crystal Form Of Pseudomonas | 1e-06 | ||
| 3gt7_A | 154 | Crystal Structure Of Signal Receiver Domain Of Sign | 1e-06 | ||
| 2fka_A | 129 | Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che | 2e-06 | ||
| 3rvp_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 2e-06 | ||
| 2che_A | 128 | Structure Of The Mg2+-Bound Form Of Chey And Mechan | 2e-06 | ||
| 3rvl_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 2e-06 | ||
| 3fft_A | 128 | Crystal Structure Of Chey Double Mutant F14e, E89r | 2e-06 | ||
| 1ab6_A | 125 | Structure Of Chey Mutant F14n, V86t Length = 125 | 2e-06 | ||
| 2chy_A | 128 | Three-Dimensional Structure Of Chey, The Response R | 3e-06 | ||
| 3rvn_A | 132 | Structure Of The Chey-Bef3 Complex With Substitutio | 4e-06 | ||
| 1d4z_A | 128 | Crystal Structure Of Chey-95iv, A Hyperactive Chey | 4e-06 | ||
| 1ymu_A | 130 | Signal Transduction Protein Chey Mutant With Met 17 | 4e-06 | ||
| 1krw_A | 124 | Solution Structure And Backbone Dynamics Of Beryllo | 4e-06 | ||
| 1dc7_A | 124 | Structure Of A Transiently Phosphorylated "switch" | 4e-06 | ||
| 1j56_A | 124 | Minimized Average Structure Of Beryllofluoride-Acti | 5e-06 | ||
| 3ffx_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59r, | 5e-06 | ||
| 1ab5_A | 125 | Structure Of Chey Mutant F14n, V21t Length = 125 | 5e-06 | ||
| 1cey_A | 128 | Assignments, Secondary Structure, Global Fold, And | 6e-06 | ||
| 1eay_A | 128 | Chey-Binding (P2) Domain Of Chea In Complex With Ch | 6e-06 | ||
| 1djm_A | 129 | Solution Structure Of Bef3-Activated Chey From Esch | 6e-06 | ||
| 2jba_B | 127 | Phob Response Regulator Receiver Domain Constitutiv | 6e-06 | ||
| 3fgz_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 6e-06 | ||
| 2zwm_A | 130 | Crystal Structure Of Yycf Receiver Domain From Baci | 6e-06 | ||
| 1cye_A | 129 | Three Dimensional Structure Of Chemotactic Che Y Pr | 7e-06 | ||
| 1hey_A | 128 | Investigating The Structural Determinants Of The P2 | 7e-06 | ||
| 3h1g_A | 129 | Crystal Structure Of Chey Mutant T84a Of Helicobact | 7e-06 | ||
| 2jba_A | 127 | Phob Response Regulator Receiver Domain Constitutiv | 7e-06 | ||
| 1ymv_A | 129 | Signal Transduction Protein Chey Mutant With Phe 14 | 7e-06 | ||
| 3f6p_A | 120 | Crystal Structure Of Unphosphorelated Receiver Doma | 7e-06 | ||
| 3oo0_A | 129 | Structure Of Apo Chey A113p Length = 129 | 8e-06 | ||
| 3myy_A | 128 | Structure Of E. Coli Chey Mutant A113p Bound To Ber | 8e-06 | ||
| 1dc8_A | 124 | Structure Of A Transiently Phosphorylated "switch" | 8e-06 | ||
| 1ehc_A | 128 | Structure Of Signal Transduction Protein Chey Lengt | 9e-06 | ||
| 3ffw_A | 128 | Crystal Structure Of Chey Triple Mutant F14q, N59k, | 1e-05 | ||
| 1zdm_A | 129 | Crystal Structure Of Activated Chey Bound To Xe Len | 1e-05 | ||
| 1c4w_A | 128 | 1.9 A Structure Of A-Thiophosphonate Modified Chey | 1e-05 | ||
| 1e6m_A | 128 | Two-Component Signal Transduction System D57a Mutan | 1e-05 | ||
| 3eod_A | 130 | Crystal Structure Of N-Terminal Domain Of E. Coli R | 1e-05 | ||
| 1e6l_A | 127 | Two-Component Signal Transduction System D13a Mutan | 1e-05 | ||
| 1mih_A | 129 | A Role For Chey Glu 89 In Chez-Mediated Dephosphory | 1e-05 | ||
| 3olx_A | 129 | Structural And Functional Effects Of Substitution A | 1e-05 | ||
| 1udr_A | 129 | Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep | 2e-05 | ||
| 3f7n_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 2e-05 | ||
| 1vlz_A | 128 | Uncoupled Phosphorylation And Activation In Bacteri | 2e-05 | ||
| 3olw_A | 129 | Structural And Functional Effects Of Substitution A | 2e-05 | ||
| 3olv_A | 129 | Structural And Functional Effects Of Substitution A | 2e-05 | ||
| 5chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 2e-05 | ||
| 3gwg_A | 129 | Crystal Structure Of Chey Of Helicobacter Pylori Le | 2e-05 | ||
| 3oly_A | 129 | Structural And Functional Effects Of Substitution A | 2e-05 | ||
| 3nnn_A | 122 | Bef3 Activated Drrd Receiver Domain Length = 122 | 3e-05 | ||
| 2id7_A | 128 | 1.75 A Structure Of T87i Phosphono-Chey Length = 12 | 3e-05 | ||
| 1jbe_A | 128 | 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co | 3e-05 | ||
| 1l5y_A | 155 | Crystal Structure Of Mg2+ / Bef3-bound Receiver Dom | 4e-05 | ||
| 1e6k_A | 130 | Two-Component Signal Transduction System D12a Mutan | 4e-05 | ||
| 3h1f_A | 129 | Crystal Structure Of Chey Mutant D53a Of Helicobact | 4e-05 | ||
| 2oqr_A | 230 | The Structure Of The Response Regulator Regx3 From | 6e-05 | ||
| 6chy_A | 128 | Structure Of Chemotaxis Protein Chey Length = 128 | 6e-05 | ||
| 1qkk_A | 155 | Crystal Structure Of The Receiver Domain And Linker | 7e-05 | ||
| 3t6k_A | 136 | Crystal Structure Of A Hypothetical Response Regula | 7e-05 | ||
| 3nhz_A | 125 | Structure Of N-Terminal Domain Of Mtra Length = 125 | 8e-05 | ||
| 1k66_A | 149 | Crystal Structure Of The Cyanobacterial Phytochrome | 1e-04 | ||
| 3heb_A | 152 | Crystal Structure Of Response Regulator Receiver Do | 1e-04 | ||
| 2id9_A | 128 | 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length | 1e-04 | ||
| 1mvo_A | 136 | Crystal Structure Of The Phop Receiver Domain From | 2e-04 | ||
| 3dge_C | 122 | Structure Of A Histidine Kinase-response Regulator | 4e-04 | ||
| 1f51_E | 119 | A Transient Interaction Between Two Phosphorelay Pr | 6e-04 | ||
| 1zh2_A | 121 | Crystal Structure Of The Calcium-Bound Receiver Dom | 7e-04 | ||
| 3gl9_A | 122 | The Structure Of A Histidine Kinase-Response Regula | 7e-04 | ||
| 1srr_A | 124 | Crystal Structure Of A Phosphatase Resistant Mutant | 8e-04 | ||
| 1u8t_A | 128 | Crystal Structure Of Chey D13k Y106w Alone And In C | 9e-04 |
| >pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 | Back alignment and structure |
|
| >pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 | Back alignment and structure |
| >pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 | Back alignment and structure |
| >pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 | Back alignment and structure |
| >pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 | Back alignment and structure |
| >pdb|3Q9S|A Chain A, Crystal Structure Of Rra(1-215) From Deinococcus Radiodurans Length = 249 | Back alignment and structure |
| >pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 | Back alignment and structure |
| >pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 | Back alignment and structure |
| >pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 | Back alignment and structure |
| >pdb|3EQ2|A Chain A, Structure Of Hexagonal Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|3GT7|A Chain A, Crystal Structure Of Signal Receiver Domain Of Signal Transduction Histidine Kinase From Syntrophus Aciditrophicus Length = 154 | Back alignment and structure |
| >pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 | Back alignment and structure |
| >pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 | Back alignment and structure |
| >pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 | Back alignment and structure |
| >pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 | Back alignment and structure |
| >pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 | Back alignment and structure |
| >pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 | Back alignment and structure |
| >pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 | Back alignment and structure |
| >pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 | Back alignment and structure |
| >pdb|1KRW|A Chain A, Solution Structure And Backbone Dynamics Of Beryllofluoride- Activated Ntrc Receiver Domain Length = 124 | Back alignment and structure |
| >pdb|1DC7|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 | Back alignment and structure |
| >pdb|1J56|A Chain A, Minimized Average Structure Of Beryllofluoride-Activated Ntrc Receiver Domain: Model Structure Incorporating Active Site Contacts Length = 124 | Back alignment and structure |
| >pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 | Back alignment and structure |
| >pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 | Back alignment and structure |
| >pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 | Back alignment and structure |
| >pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 | Back alignment and structure |
| >pdb|2JBA|B Chain B, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 | Back alignment and structure |
| >pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 | Back alignment and structure |
| >pdb|1HEY|A Chain A, Investigating The Structural Determinants Of The P21-Like Triphosphate And Mg2+ Binding Site Length = 128 | Back alignment and structure |
| >pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|2JBA|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 | Back alignment and structure |
| >pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 | Back alignment and structure |
| >pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 | Back alignment and structure |
| >pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 | Back alignment and structure |
| >pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 | Back alignment and structure |
| >pdb|1DC8|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 | Back alignment and structure |
| >pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 | Back alignment and structure |
| >pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 | Back alignment and structure |
| >pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 | Back alignment and structure |
| >pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 | Back alignment and structure |
| >pdb|3EOD|A Chain A, Crystal Structure Of N-Terminal Domain Of E. Coli Rssb Length = 130 | Back alignment and structure |
| >pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 | Back alignment and structure |
| >pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 | Back alignment and structure |
| >pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 | Back alignment and structure |
| >pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 | Back alignment and structure |
| >pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 | Back alignment and structure |
| >pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 | Back alignment and structure |
| >pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 | Back alignment and structure |
| >pdb|2ID7|A Chain A, 1.75 A Structure Of T87i Phosphono-Chey Length = 128 | Back alignment and structure |
| >pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 | Back alignment and structure |
| >pdb|1L5Y|A Chain A, Crystal Structure Of Mg2+ / Bef3-bound Receiver Domain Of Sinorhizobium Meliloti Dctd Length = 155 | Back alignment and structure |
| >pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 | Back alignment and structure |
| >pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 | Back alignment and structure |
| >pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 | Back alignment and structure |
| >pdb|1QKK|A Chain A, Crystal Structure Of The Receiver Domain And Linker Region Of Dctd From Sinorhizobium Meliloti Length = 155 | Back alignment and structure |
| >pdb|3T6K|A Chain A, Crystal Structure Of A Hypothetical Response Regulator (Caur_3799) From Chloroflexus Aurantiacus J-10-Fl At 1.86 A Resolution Length = 136 | Back alignment and structure |
| >pdb|3NHZ|A Chain A, Structure Of N-Terminal Domain Of Mtra Length = 125 | Back alignment and structure |
| >pdb|1K66|A Chain A, Crystal Structure Of The Cyanobacterial Phytochrome Response Regulator, Rcpb Length = 149 | Back alignment and structure |
| >pdb|3HEB|A Chain A, Crystal Structure Of Response Regulator Receiver Domain From Rhodospirillum Rubrum Length = 152 | Back alignment and structure |
| >pdb|2ID9|A Chain A, 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length = 128 | Back alignment and structure |
| >pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 | Back alignment and structure |
| >pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|1F51|E Chain E, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction Length = 119 | Back alignment and structure |
| >pdb|1ZH2|A Chain A, Crystal Structure Of The Calcium-Bound Receiver Domain Of Kdp Potassium Transport System Response Regulator Kdpe Length = 121 | Back alignment and structure |
| >pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|1SRR|A Chain A, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis Length = 124 | Back alignment and structure |
| >pdb|1U8T|A Chain A, Crystal Structure Of Chey D13k Y106w Alone And In Complex With A Flim Peptide Length = 128 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
Score = 90.4 bits (225), Expect = 1e-20
Identities = 27/129 (20%), Positives = 55/129 (42%), Gaps = 1/129 (0%)
Query: 30 RSKVRILLCDNDSNSSDAVFSLLVKCSYQVTSVRSPRQVIDALNAEGSDIDLILAEVDLP 89
++ +L+ D+ S + L K QV R+ + L + I L+L + +P
Sbjct: 122 NQQIEVLVVDDSRTSRHRTMAQLRKQLLQVHEASHAREALATL-EQHPAIRLVLVDYYMP 180
Query: 90 MTKGLKMLKYITRDKELQRIPVIMMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLNLWT 149
G+ +++ + Q++ +I +S D+ + + L+ GA D+L +P EL +
Sbjct: 181 EIDGISLVRMLRERYSKQQLAIIGISVSDKRGLSARYLKQGANDFLNQPFEPEELQCRVS 240
Query: 150 HMWRRRRML 158
H
Sbjct: 241 HNLEALEQF 249
|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 554 | |||
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 99.93 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 99.88 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 99.88 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 99.87 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 99.86 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 99.86 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 99.86 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 99.85 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 99.85 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 99.85 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 99.85 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 99.85 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 99.85 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 99.85 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 99.84 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 99.84 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 99.84 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 99.84 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 99.84 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 99.84 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 99.84 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 99.84 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 99.83 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 99.83 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 99.83 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 99.83 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 99.83 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 99.83 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 99.83 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 99.83 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 99.83 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 99.83 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 99.83 | |
| 3r0j_A | 250 | Possible two component system response transcript | 99.83 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 99.83 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 99.83 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 99.83 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 99.83 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 99.82 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 99.82 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 99.82 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.82 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 99.82 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 99.82 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 99.82 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 99.82 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 99.82 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 99.82 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 99.82 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 99.81 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 99.81 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 99.81 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 99.81 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 99.81 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 99.81 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 99.81 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 99.81 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 99.81 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 99.81 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.81 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 99.81 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 99.81 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.8 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 99.8 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 99.8 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 99.8 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 99.8 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 99.8 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 99.8 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.8 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 99.8 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 99.79 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 99.79 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 99.79 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 99.79 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 99.79 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 99.79 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 99.79 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 99.79 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 99.79 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 99.79 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.79 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 99.78 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 99.78 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.78 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 99.78 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 99.77 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 99.77 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 99.77 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 99.77 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 99.76 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 99.76 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 99.76 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 99.75 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 99.75 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 99.74 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 99.74 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 99.73 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 99.73 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 99.73 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 99.73 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 99.73 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 99.73 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 99.7 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 99.69 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 99.67 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.63 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 99.6 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.1 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 99.03 | |
| 3sft_A | 193 | CHEB, chemotaxis response regulator protein-glutam | 97.61 | |
| 1chd_A | 203 | CHEB methylesterase; chemotaxis protein, serine hy | 97.42 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 97.04 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 96.98 | |
| 3q7r_A | 121 | Transcriptional regulatory protein; CHXR, receiver | 96.46 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 96.43 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 95.95 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 94.78 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 93.22 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 92.17 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 92.17 | |
| 3ogl_Q | 21 | JAZ1 incomplete degron peptide; leucine-rich repea | 91.44 | |
| 1y80_A | 210 | Predicted cobalamin binding protein; corrinoid, fa | 91.17 | |
| 1xrs_B | 262 | D-lysine 5,6-aminomutase beta subunit; TIM barrel, | 90.93 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 90.89 | |
| 2i2x_B | 258 | MTAC, methyltransferase 1; TIM barrel and helix bu | 90.46 | |
| 3kp1_A | 763 | D-ornithine aminomutase E component; 5 aminomutase | 89.25 | |
| 1req_A | 727 | Methylmalonyl-COA mutase; isomerase, intramolecula | 88.92 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 87.69 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 87.24 | |
| 3ogk_Q | 22 | JAZ1 incomplete degron peptide; leucine rich repea | 87.08 | |
| 3ezx_A | 215 | MMCP 1, monomethylamine corrinoid protein 1; N ter | 86.89 | |
| 3o63_A | 243 | Probable thiamine-phosphate pyrophosphorylase; thi | 86.31 | |
| 2xij_A | 762 | Methylmalonyl-COA mutase, mitochondrial; isomerase | 85.98 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 85.09 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 84.07 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 81.56 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 81.12 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 80.43 |
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
Probab=99.93 E-value=9.3e-26 Score=205.53 Aligned_cols=122 Identities=24% Similarity=0.483 Sum_probs=114.0
Q ss_pred CCcEEEEEeCCHHHHHHHHHHHhhCCCE-EEEECCHHHHHHHHHhcCCCceEEEEecCCCCCcHHHHHHHHHhccCCCCc
Q 008761 31 SKVRILLCDNDSNSSDAVFSLLVKCSYQ-VTSVRSPRQVIDALNAEGSDIDLILAEVDLPMTKGLKMLKYITRDKELQRI 109 (554)
Q Consensus 31 skirVLIVDDd~~~r~~L~~lL~~~g~e-V~~A~dg~EALe~L~~~~~~PDLILLDi~MP~mDGlElLr~Ir~~~~~~~i 109 (554)
+++|||||||++.+|..|..+|+..||+ |.+|.+|.+|++.++.. .||+||+|+.||+|||++++++|++....+++
T Consensus 11 k~~rILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~~~--~~DlillD~~MP~mdG~el~~~ir~~~~~~~i 88 (134)
T 3to5_A 11 KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKG--DFDFVVTDWNMPGMQGIDLLKNIRADEELKHL 88 (134)
T ss_dssp TTCCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHH--CCSEEEEESCCSSSCHHHHHHHHHHSTTTTTC
T ss_pred CCCEEEEEeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHHhC--CCCEEEEcCCCCCCCHHHHHHHHHhCCCCCCC
Confidence 4689999999999999999999999996 66899999999999987 89999999999999999999999987767889
Q ss_pred eEEEEecCCCHHHHHHHHHcCCCEEEeCCCCHHHHHHHHHHHHHH
Q 008761 110 PVIMMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLNLWTHMWRR 154 (554)
Q Consensus 110 PIIVLSs~~d~e~~~eAL~aGA~DyL~KP~~~eeL~~~L~~llr~ 154 (554)
|||++|+..+.+...+|+++||+|||.|||+.++|...|++++++
T Consensus 89 pvI~lTa~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~R 133 (134)
T 3to5_A 89 PVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER 133 (134)
T ss_dssp CEEEEESSCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHCC-
T ss_pred eEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHhc
Confidence 999999999999999999999999999999999999999887654
|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >3sft_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; modified doubly-wound/fold, chemoreceptor; 2.15A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1chd_A CHEB methylesterase; chemotaxis protein, serine hydrolase, carboxyl methylesteras; 1.75A {Salmonella typhimurium} SCOP: c.40.1.1 | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} | Back alignment and structure |
|---|
| >1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1 | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A* | Back alignment and structure |
|---|
| >1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >3ogk_Q JAZ1 incomplete degron peptide; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 554 | ||||
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 4e-21 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 1e-20 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 1e-19 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 2e-19 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 3e-19 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 1e-18 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 5e-18 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 5e-18 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 6e-18 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 2e-17 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 5e-17 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 7e-17 | |
| d1a2oa1 | 140 | c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal | 1e-16 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 1e-16 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 4e-16 | |
| d2b4aa1 | 118 | c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba | 4e-16 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 6e-16 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 7e-16 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 8e-16 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 8e-16 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 1e-15 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 1e-15 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 7e-15 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 8e-15 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 1e-14 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 2e-14 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 2e-14 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 3e-14 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 4e-14 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 4e-14 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 9e-14 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 1e-12 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 1e-12 | |
| d1qo0d_ | 189 | c.23.1.3 (D:) Positive regulator of the amidase op | 1e-10 |
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: PhoB receiver domain species: Escherichia coli [TaxId: 562]
Score = 86.9 bits (215), Expect = 4e-21
Identities = 35/121 (28%), Positives = 62/121 (51%), Gaps = 2/121 (1%)
Query: 34 RILLCDNDSNSSDAVFSLLVKCSYQVTSVRSPRQVIDALNAEGSDIDLILAEVDLPMTKG 93
RIL+ ++++ + V +L + +Q ++ LN DLIL + LP G
Sbjct: 2 RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEP--WPDLILLDWMLPGGSG 59
Query: 94 LKMLKYITRDKELQRIPVIMMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLNLWTHMWR 153
++ +K++ R+ + IPV+M++A+ E V+ L GA DY+ KP EL+ + R
Sbjct: 60 IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 119
Query: 154 R 154
R
Sbjct: 120 R 120
|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 554 | |||
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 99.93 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 99.93 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 99.92 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 99.92 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 99.92 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 99.92 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 99.92 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 99.92 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 99.92 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 99.92 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 99.92 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 99.92 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 99.92 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 99.92 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 99.92 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 99.91 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 99.91 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 99.91 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 99.91 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 99.91 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 99.91 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 99.91 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 99.9 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 99.9 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 99.9 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 99.9 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 99.9 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 99.9 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 99.9 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 99.89 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.88 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 99.87 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 99.85 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 99.8 | |
| d1chda_ | 198 | Methylesterase CheB, C-terminal domain {Salmonella | 97.28 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 95.93 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 94.71 | |
| d1xrsb1 | 160 | D-lysine 5,6-aminomutase beta subunit KamE, C-term | 94.25 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 87.73 | |
| d3bula2 | 156 | Methionine synthase, C-terminal domain {Escherichi | 87.12 | |
| d1r8ja2 | 135 | N-terminal domain of the circadian clock protein K | 86.93 | |
| d7reqb2 | 163 | Methylmalonyl-CoA mutase beta subunit, C-terminal | 81.79 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 81.49 | |
| d1dxea_ | 253 | 2-dehydro-3-deoxy-galactarate aldolase {Escherichi | 80.57 |
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: PhoP receiver domain species: Escherichia coli [TaxId: 562]
Probab=99.93 E-value=1.5e-25 Score=197.33 Aligned_cols=118 Identities=20% Similarity=0.396 Sum_probs=113.1
Q ss_pred cEEEEEeCCHHHHHHHHHHHhhCCCEEEEECCHHHHHHHHHhcCCCceEEEEecCCCCCcHHHHHHHHHhccCCCCceEE
Q 008761 33 VRILLCDNDSNSSDAVFSLLVKCSYQVTSVRSPRQVIDALNAEGSDIDLILAEVDLPMTKGLKMLKYITRDKELQRIPVI 112 (554)
Q Consensus 33 irVLIVDDd~~~r~~L~~lL~~~g~eV~~A~dg~EALe~L~~~~~~PDLILLDi~MP~mDGlElLr~Ir~~~~~~~iPII 112 (554)
+|||||||++.++..+..+|+..||+|.+|.++.+|++++.+. .||+||+|+.||++||++++++|++.. +.+|||
T Consensus 1 mrILvVDDd~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~~--~~dliilD~~mP~~~G~e~~~~i~~~~--~~~pvi 76 (119)
T d2pl1a1 1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEH--IPDIAIVDLGLPDEDGLSLIRRWRSND--VSLPIL 76 (119)
T ss_dssp CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS--CCSEEEECSCCSSSCHHHHHHHHHHTT--CCSCEE
T ss_pred CEEEEEeCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHhc--ccceeehhccCCCchhHHHHHHHHhcC--cccceE
Confidence 5899999999999999999999999999999999999999987 899999999999999999999999865 689999
Q ss_pred EEecCCCHHHHHHHHHcCCCEEEeCCCCHHHHHHHHHHHHHH
Q 008761 113 MMSAQDEVSVVVKCLRLGAADYLVKPLRTNELLNLWTHMWRR 154 (554)
Q Consensus 113 VLSs~~d~e~~~eAL~aGA~DyL~KP~~~eeL~~~L~~llr~ 154 (554)
++|+..+.+...+|+++||+|||.||++.++|...+++++++
T Consensus 77 ~lt~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lrR 118 (119)
T d2pl1a1 77 VLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRR 118 (119)
T ss_dssp EEESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHH
T ss_pred eeeccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHHHcc
Confidence 999999999999999999999999999999999999999865
|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1chda_ c.40.1.1 (A:) Methylesterase CheB, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|