Citrus Sinensis ID: 009670

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53
MTAEEKGGSSSDEDGVIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRRKKVDPKDQNRSPHEFEKSYRKRKDQDGEDEDEDGDDDGHENENSTTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDGFGGSHSVNSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAMFPANRNSNLVQGVQTSLEPNQMPQSESTTHIGDFNHINSPTAFTAATGFIDARVAVGSSSSSVSTSLSNLMMLQANPHQAQSRDAYGNQSSLTVASLNQAYFDLGVHDSSNFLDHGRCQESWQDAVQLSKSSSISLPLGEPFILDQVPPNKDNILSSNCYLDISSSIANSTHLENSRGDLSY
ccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHccccccccccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccccEEEEEEEcccccEEEccccHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEcHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mtaeekggsssdedgvidkfpigmrvlavddDQTCLKILEKFLRECQYEVTVTNRAITALKMLREnrnnfdlvisdvympdmdgFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINhgacdyllkpvrmEELKNTWQHVIRrkkvdpkdqnrsphefeksyrkrkdqdgedededgdddghenensttqkkprvVWTTELHTKFIGAVNllgldkavpKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMvasvgskdssylrigaldgfggshsvnspgrlsssalsssyvpgsmigrlnssaglsmhgiassgmikpglsqsfnTSFNTIGknqqamfpanrnsnlvqgvqtslepnqmpqsestthigdfnhinsptaftaaTGFIDARVAVGSSSSSVSTSLSNLMMlqanphqaqsrdaygnqsSLTVASLNQAYFdlgvhdssnfldhgrcqesWQDAVQLSKsssislplgepfildqvppnkdnilssncyldisssiansthlensrgdlsy
mtaeekggsssdedgvidkFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQhvirrkkvdpkdqnrsphefeksyrkrkdqdgedededgdddghenensttqkkprvvWTTELHTKFIGavnllgldkAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDGFGGSHSVNSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAMFPANRNSNLVQGVQTSLEPNQMPQSESTTHIGDFNHINSPTAFTAATGFIDARVAVGSSSSSVSTSLSNLMMLQANPHQAQSRDAYGNQSSLTVASLNQAYFDLGVHDSSNFLDHGRCQESWQDAVQLSKSSSISLPLGEPFILDQVPPNKDNILSSNCYLDISssiansthlensrgdlsy
MTAEEKGGSSSDEDGVIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRRKKVDPKDQNRSPHEFEKSYRKRKDQdgedededgdddgHENENSTTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDGFGGSHSVNspgrlsssalsssyvpgsMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAMFPANRNSNLVQGVQTSLEPNQMPQSESTTHIGDFNHINSPTAFTAATGFIDARVAVGsssssvstslsNLMMLQANPHQAQSRDAYGNQSSLTVASLNQAYFDLGVHDSSNFLDHGRCQESWQDAVQLSKSSSISLPLGEPFILDQVPPNKDNILSSNCYLDISSSIANSTHLENSRGDLSY
***************VIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIR***************************************************RVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVG****SYLRIGALDGF****************************************************************************************************GDFNHINSPTAFTAATGFIDARVAV************************************TVASLNQAYFDLGVHDSSNFLDHGRCQESWQDAV*********LPLGEPFILDQVPPNKDNILSSNCYLDI*******************
*******************FPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIR*****************************************************VWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQK************************************************************************************************************************************************************************************************************************************************************************************************
************EDGVIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRRK**********************************************KKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDGFGGSHSVNSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAMFPANRNSNLVQGVQTSLEPNQMPQSESTTHIGDFNHINSPTAFTAATGFIDARVA**********SLSNLMMLQAN***********NQSSLTVASLNQAYFDLGVHDSSNFLDHGRCQES***********SISLPLGEPFILDQVPPNKDNILSSNCYLDISSSIANST***********
******************KFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRRKKV******************RKDQDGED***********NENSTTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGN*******************R**ALDGFGGSHSVNSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAMFPANRNSNLVQGVQTSLEPNQMP***************S*TAF**ATGFIDARVAVGSSSSSVSTSLSNLMML*************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAEEKGGSSSDEDGVIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRRKKVDPKDQNRSPHEFEKSYRKRKDQDGEDEDEDGDDDGHENENSTTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDGFGGSHSVNSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAMFPANRNSNLVQGVQTSLEPNQMPQSESTTHIGDFNHINSPTAFTAATGFIDARVAVGSSSSSVSTSLSNLMMLQANPHQAQSRDAYGNQSSLTVASLNQAYFDLGVHDSSNFLDHGRCQESWQDAVQLSKSSSISLPLGEPFILDQVPPNKDNILSSNCYLDISSSIANSTHLENSRGDLSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query529 2.2.26 [Sep-21-2011]
Q9FGT7 635 Two-component response re yes no 0.854 0.711 0.441 2e-94
P62598596 Two-component response re yes no 0.631 0.560 0.513 8e-91
O49397552 Two-component response re no no 0.671 0.643 0.479 1e-90
Q940D0 690 Two-component response re no no 0.646 0.495 0.433 9e-81
Q9ZWJ9 664 Two-component response re no no 0.642 0.512 0.451 1e-80
Q9FXD6521 Two-component response re no no 0.504 0.512 0.506 2e-66
Q8L9Y3382 Two-component response re no no 0.436 0.604 0.513 1e-64
Q7Y0W3341 Two-component response re N/A no 0.468 0.727 0.392 4e-44
Q7Y0W5341 Two-component response re no no 0.468 0.727 0.392 4e-44
Q9FJ16292 Putative two-component re no no 0.408 0.739 0.395 1e-40
>sp|Q9FGT7|ARR18_ARATH Two-component response regulator ARR18 OS=Arabidopsis thaliana GN=ARR18 PE=2 SV=2 Back     alignment and function desciption
 Score =  347 bits (889), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 225/510 (44%), Positives = 296/510 (58%), Gaps = 58/510 (11%)

Query: 11  SDEDGVIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNF 70
           S EDG  DKFP+GMRVLAVDD+ TCL+ LE+ L  C+Y VT T  +  AL+MLREN N F
Sbjct: 5   STEDGRHDKFPVGMRVLAVDDNPTCLRKLEELLLRCKYHVTKTMESRKALEMLRENSNMF 64

Query: 71  DLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRME 130
           DLVISDV MPD DGFKLLE +GLEMDLPV+MLSA+SD   VMKGI HGACDYL+KPV ++
Sbjct: 65  DLVISDVEMPDTDGFKLLE-IGLEMDLPVIMLSAHSDYDSVMKGIIHGACDYLVKPVGLK 123

Query: 131 ELKNTWQHVIRR------KKVDPKDQNRSPHEFEKSYRKRKDQ----------------- 167
           EL+N W HV+++      K + P + +  P     + RKRKD+                 
Sbjct: 124 ELQNIWHHVVKKNIKSYAKLLPPSESDSVP----SASRKRKDKVNDSGDEDDSDREEDDG 179

Query: 168 DGEDEDEDGDDDGHENENSTTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNV 227
           +G ++D DG         S T+KKPRVVW+ ELH KF+ AV  LGLDKAVPKKILDLM++
Sbjct: 180 EGSEQDGDG---------SGTRKKPRVVWSQELHQKFVSAVQQLGLDKAVPKKILDLMSI 230

Query: 228 EGLTRENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDG---FGGSHSV 284
           EGLTRENVASHLQK+RL LK++     +     + G++DSSY ++  LDG   F  +  +
Sbjct: 231 EGLTRENVASHLQKYRLYLKKIDEGQQQNMTPDAFGTRDSSYFQMAQLDGLRDFTAARQI 290

Query: 285 NSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFNTIGKNQ 344
            S G LS S L+    P  M   +N      + G+ SS  I+ G  Q+ + S N  G   
Sbjct: 291 PSSGLLSRSHLTKLQPP--MYSSIN------LQGMNSSSFIQQGHHQNSSNSANPFGTYH 342

Query: 345 QAMFPANRNSNLVQGVQTSLEPNQMPQSESTTHIGDFNHINSPTAFTAATGFIDARVAVG 404
             + P  +N NL Q   + LEP Q P+S+S  +IGDF  +           F+D  +  G
Sbjct: 343 STLSPRIQNVNLFQRTSSPLEPLQFPRSKS--YIGDFKGLGD---RAIGGSFLDTCMPFG 397

Query: 405 SSSSSVSTSLSNLMMLQANPHQAQSRDAYGNQSSLTVASLNQAYFDLGVHDSSNFLDHGR 464
           SSS+S+ ++ +N +MLQAN  Q     + G Q  +     N A  ++     S F  H  
Sbjct: 398 SSSTSLPSASTNPLMLQANYTQPLHIASDGIQPCIEGTPSNSASPNISFQGLSRFPGH-- 455

Query: 465 CQESWQDAVQLSKSSSISLPLGEPFILDQV 494
              SWQ  +  ++    SLPL   F+ DQV
Sbjct: 456 ---SWQGNLNTTRFPPSSLPLNLAFLPDQV 482
Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins.
Arabidopsis thaliana (taxid: 3702)
>sp|P62598|ARR12_ARATH Two-component response regulator ARR12 OS=Arabidopsis thaliana GN=ARR12 PE=2 SV=2 Back     alignment and function description
>sp|O49397|ARR10_ARATH Two-component response regulator ARR10 OS=Arabidopsis thaliana GN=ARR10 PE=1 SV=1 Back     alignment and function description
>sp|Q940D0|ARR1_ARATH Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZWJ9|ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana GN=ARR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FXD6|ARR11_ARATH Two-component response regulator ARR11 OS=Arabidopsis thaliana GN=ARR11 PE=1 SV=1 Back     alignment and function description
>sp|Q8L9Y3|ARR14_ARATH Two-component response regulator ARR14 OS=Arabidopsis thaliana GN=ARR14 PE=1 SV=2 Back     alignment and function description
>sp|Q7Y0W3|EHD1_ORYSI Two-component response regulator EHD1 OS=Oryza sativa subsp. indica PE=2 SV=1 Back     alignment and function description
>sp|Q7Y0W5|EHD1_ORYSJ Two-component response regulator EHD1 OS=Oryza sativa subsp. japonica GN=EHD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJ16|APRR4_ARATH Putative two-component response regulator-like APRR4 OS=Arabidopsis thaliana GN=APRR4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query529
359484783 712 PREDICTED: two-component response regula 0.994 0.738 0.549 1e-166
298103722 685 putative B-type response regulator 19 [P 0.973 0.751 0.555 1e-164
147787458 706 hypothetical protein VITISV_005486 [Viti 0.994 0.745 0.534 1e-162
224143990 707 type-b response regulator [Populus trich 0.982 0.735 0.567 1e-162
255565035 676 two-component system sensor histidine ki 0.922 0.721 0.569 1e-161
356556600 697 PREDICTED: two-component response regula 0.958 0.727 0.533 1e-151
356530639 676 PREDICTED: two-component response regula 0.954 0.747 0.533 1e-149
297735895 655 unnamed protein product [Vitis vinifera] 0.873 0.705 0.527 1e-148
449457923 697 PREDICTED: two-component response regula 0.964 0.731 0.537 1e-145
255548782 663 two-component system sensor histidine ki 0.960 0.766 0.532 1e-138
>gi|359484783|ref|XP_002270833.2| PREDICTED: two-component response regulator ARR12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 306/557 (54%), Positives = 394/557 (70%), Gaps = 31/557 (5%)

Query: 1   MTAEEKGGSSSDEDGVIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITAL 60
           MT EE+ G  + EDGV D FP+GMRVLAVDDD TCL +L+  LR CQY+VT TN+AITAL
Sbjct: 1   MTVEERKGGLAGEDGVKDPFPVGMRVLAVDDDPTCLMLLDGLLRRCQYQVTTTNQAITAL 60

Query: 61  KMLRENRNNFDLVISDVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGAC 120
           KMLREN+NNFDLVISDV MPDMDGFKLLELVGLEMDLPV+MLS++SD KLVM+GI HGAC
Sbjct: 61  KMLRENKNNFDLVISDVSMPDMDGFKLLELVGLEMDLPVIMLSSHSDPKLVMRGITHGAC 120

Query: 121 DYLLKPVRMEELKNTWQHVIRRKKVDPKDQNRSPHEFEKSYRKRKDQDGEDEDEDGDDDG 180
           DYLLKPVR+EELKN WQHVIRRKK+D KDQN+S  +    +   +  +G     + D +G
Sbjct: 121 DYLLKPVRIEELKNIWQHVIRRKKIDSKDQNKSADQDNALHADGEGGEGPPSSSNADQNG 180

Query: 181 HENEN---------------------STTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPK 219
             N                        ++QKKPRVVW+ ELH KF+ AVN LG++KAVPK
Sbjct: 181 KLNRKRKDQNEDEEEEGEENGEENEDPSSQKKPRVVWSVELHRKFVAAVNQLGIEKAVPK 240

Query: 220 KILDLMNVEGLTRENVASHLQKFRLSLKRLGN-KTLEAGMVASVGSKDSSYLRIGALDGF 278
           +ILDLMNVEGLTRENVASHLQK+RL LKR+    T +A MVA+ G+KDSSY+R+G+LDGF
Sbjct: 241 RILDLMNVEGLTRENVASHLQKYRLYLKRISCVATQQANMVAAFGAKDSSYMRMGSLDGF 300

Query: 279 GGSHSVNSPGRLSSSALSSSYVPGSMIGRLNSSAGLSMHGIASSGMIKPGLSQSFNTSFN 338
           G    +  PGRL+S+A+ SSY P  M+GRLNS AGLS+ G+ SSG+I+ G +Q+ + S N
Sbjct: 301 GDFRGLAGPGRLNSTAM-SSYPPSGMLGRLNSPAGLSLRGLTSSGLIQTGHAQNSSNSVN 359

Query: 339 TIGKNQQAMFPANRNSNLVQGVQTSLEPNQMPQSES-TTHIGDFNHINSPTAFTAATGFI 397
           T GK Q  + P N++++L QG+ TSLE +Q+ Q +  +T  G+F+ +++ T FT A GF 
Sbjct: 360 THGKLQPVVLPTNQSASLFQGIPTSLELDQLQQRKCISTQRGEFSSVDNTTVFTTANGFP 419

Query: 398 DARVAVGSSSSSVSTSLSNLMMLQANPHQAQSRDAYGNQSSLTVASLNQAYFDLGVHDSS 457
           D+R+ V SSS+S+S + SN +MLQ+NP Q   R    NQSSL   +LN   + +GV  SS
Sbjct: 420 DSRMTVHSSSNSLSNAPSNPLMLQSNPQQTLCRGGLANQSSLKAVTLNPEPYTMGVSGSS 479

Query: 458 NFLDHGRCQESWQDAVQLSKSSSISLPLGEPFILDQVPPN--KDNILSSNCY-----LDI 510
           NFLDHGRC E+WQ A+QLSK  S SLPL EP   D +  N  +++I S+  +     +D 
Sbjct: 480 NFLDHGRCNENWQSALQLSKFPSNSLPLSEPLNCDPLTTNNLREHISSTGSHIRRSPIDF 539

Query: 511 SSSIANSTHLENSRGDL 527
           S++   +  LE+SRG++
Sbjct: 540 SATSVLAGPLEDSRGEM 556

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|298103722|emb|CBM42562.1| putative B-type response regulator 19 [Populus x canadensis] Back     alignment and taxonomy information
>gi|147787458|emb|CAN60088.1| hypothetical protein VITISV_005486 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224143990|ref|XP_002325148.1| type-b response regulator [Populus trichocarpa] gi|222866582|gb|EEF03713.1| type-b response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255565035|ref|XP_002523510.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223537217|gb|EEF38849.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356556600|ref|XP_003546612.1| PREDICTED: two-component response regulator ARR12-like [Glycine max] Back     alignment and taxonomy information
>gi|356530639|ref|XP_003533888.1| PREDICTED: two-component response regulator ARR12-like [Glycine max] Back     alignment and taxonomy information
>gi|297735895|emb|CBI18671.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457923|ref|XP_004146697.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] gi|449505373|ref|XP_004162449.1| PREDICTED: two-component response regulator ARR12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255548782|ref|XP_002515447.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] gi|223545391|gb|EEF46896.1| two-component system sensor histidine kinase/response regulator, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query529
TAIR|locus:2116587552 RR10 "response regulator 10" [ 0.608 0.583 0.517 8.2e-83
TAIR|locus:2040194596 RR12 "response regulator 12" [ 0.642 0.570 0.502 2e-81
TAIR|locus:2093668 690 RR1 "response regulator 1" [Ar 0.260 0.2 0.631 3.8e-72
TAIR|locus:2065398382 RR14 "response regulator 14" [ 0.257 0.356 0.591 5.4e-63
TAIR|locus:2008585521 ARR11 "response regulator 11" 0.432 0.439 0.534 3.1e-60
UNIPROTKB|Q7Y0W3341 Q7Y0W3 "Two-component response 0.249 0.387 0.416 2e-44
UNIPROTKB|Q7Y0W5341 EHD1 "Two-component response r 0.249 0.387 0.416 2e-44
TAIR|locus:2130095 664 RR2 "response regulator 2" [Ar 0.345 0.275 0.502 6.3e-43
TAIR|locus:2155954292 APRR4 "pseudo-response regulat 0.417 0.756 0.391 8.9e-38
TAIR|locus:2141020535 APRR2 [Arabidopsis thaliana (t 0.119 0.117 0.584 2.3e-21
TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 830 (297.2 bits), Expect = 8.2e-83, P = 8.2e-83
 Identities = 173/334 (51%), Positives = 228/334 (68%)

Query:    16 VIDKFPIGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVIS 75
             V+D+FP+GMRVLAVDDDQTCL+IL+  L+ CQY VT TN+A TAL++LREN+N FDLVIS
Sbjct:     9 VLDQFPVGMRVLAVDDDQTCLRILQTLLQRCQYHVTTTNQAQTALELLRENKNKFDLVIS 68

Query:    76 DVYMPDMDGFKLLELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNT 135
             DV MPDMDGFKLLELVGLEMDLPV+MLSA+SD K VMKG+ HGACDYLLKPVR+EELKN 
Sbjct:    69 DVDMPDMDGFKLLELVGLEMDLPVIMLSAHSDPKYVMKGVKHGACDYLLKPVRIEELKNI 128

Query:   136 WQHVIRRKKVDPKDQNRS--PHEFEKSYRKRKDQXXXXXXXXXXXXXHENENSTTQKKPR 193
             WQHV+R+ K+     N S      +K+ RKRK+Q             ++N++ T QKKPR
Sbjct:   129 WQHVVRKSKLKKNKSNVSNGSGNCDKANRKRKEQYEEEEEEERG---NDNDDPTAQKKPR 185

Query:   194 VVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSLKRLGNKT 253
             V+WT ELH KF+ AV+ LG+++AVPKKILDLMNV+ LTRENVASHLQKFR++LK++ +  
Sbjct:   186 VLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVSDDA 245

Query:   254 LEAGMVASVGSKDSSYLRIGALDGFGGSHSVNXXXXXXXXXXXXXXXXXXMIGRLNSSAG 313
             ++    A++   DS ++++ +  G GG +  +                  M+   +S+  
Sbjct:   246 IQQANRAAI---DSHFMQMNSQKGLGGFYHHHRGIPVGSGQFHGGTT---MMRHYSSNRN 299

Query:   314 LSMHGIASSGMIKPGLSQSFNTSFNTIGKNQQAM 347
             L       +GM +P +S SF  + N  G   Q +
Sbjct:   300 LGRLNSLGAGMFQP-VSSSFPRNHNDGGNILQGL 332
GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;IDA
GO:0009736 "cytokinin mediated signaling pathway" evidence=IGI;RCA;TAS
GO:0009735 "response to cytokinin stimulus" evidence=IGI
GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IGI
GO:0031537 "regulation of anthocyanin metabolic process" evidence=IGI;RCA
GO:0048367 "shoot system development" evidence=IGI
GO:0080022 "primary root development" evidence=IGI
GO:0010029 "regulation of seed germination" evidence=RCA
GO:0048831 "regulation of shoot system development" evidence=RCA
TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065398 RR14 "response regulator 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Y0W3 Q7Y0W3 "Two-component response regulator EHD1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Y0W5 EHD1 "Two-component response regulator EHD1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155954 APRR4 "pseudo-response regulator 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141020 APRR2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query529
cd00156113 cd00156, REC, Signal receiver domain; originally t 1e-27
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 3e-25
pfam00072111 pfam00072, Response_reg, Response regulator receiv 5e-25
COG2204464 COG2204, AtoC, Response regulator containing CheY- 2e-24
COG0745229 COG0745, OmpR, Response regulators consisting of a 3e-24
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 3e-22
COG4753475 COG4753, COG4753, Response regulator containing Ch 6e-18
CHL00148240 CHL00148, orf27, Ycf27; Reviewed 8e-17
COG3706435 COG3706, PleD, Response regulator containing a Che 1e-16
TIGR01818463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 6e-16
COG3437360 COG3437, COG3437, Response regulator containing a 6e-15
PRK10365441 PRK10365, PRK10365, transcriptional regulatory pro 1e-14
PLN03162526 PLN03162, PLN03162, golden-2 like transcription fa 2e-14
PRK15479221 PRK15479, PRK15479, transcriptional regulatory pro 2e-14
COG2197211 COG2197, CitB, Response regulator containing a Che 4e-14
COG3947361 COG3947, COG3947, Response regulator containing Ch 1e-13
PRK09581457 PRK09581, pleD, response regulator PleD; Reviewed 2e-13
COG4565224 COG4565, CitB, Response regulator of citrate/malat 2e-13
PRK11361457 PRK11361, PRK11361, acetoacetate metabolism regula 1e-12
smart0044855 smart00448, REC, cheY-homologous receiver domain 3e-11
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response re 4e-11
PRK15347921 PRK15347, PRK15347, two component system sensor ki 5e-11
PRK15115444 PRK15115, PRK15115, response regulator GlrR; Provi 7e-11
PLN03029222 PLN03029, PLN03029, type-a response regulator prot 8e-11
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein 1e-10
PRK09468239 PRK09468, ompR, osmolarity response regulator; Pro 2e-10
COG4566202 COG4566, TtrR, Response regulator [Signal transduc 2e-10
TIGR02154226 TIGR02154, PhoB, phosphate regulon transcriptional 5e-10
TIGR02875262 TIGR02875, spore_0_A, sporulation transcription fa 9e-10
PRK10643222 PRK10643, PRK10643, DNA-binding transcriptional re 9e-10
PRK09836227 PRK09836, PRK09836, DNA-binding transcriptional ac 1e-09
PRK10923469 PRK10923, glnG, nitrogen regulation protein NR(I); 2e-09
PRK10955232 PRK10955, PRK10955, DNA-binding transcriptional re 3e-09
PRK11517223 PRK11517, PRK11517, transcriptional regulatory pro 3e-09
PRK09390202 PRK09390, fixJ, response regulator FixJ; Provision 3e-09
PRK11083228 PRK11083, PRK11083, DNA-binding response regulator 5e-09
COG3707194 COG3707, AmiR, Response regulator with putative an 1e-08
TIGR02956968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor 7e-08
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-c 1e-07
PRK10430239 PRK10430, PRK10430, DNA-binding transcriptional ac 2e-07
PRK11107919 PRK11107, PRK11107, hybrid sensory histidine kinas 4e-07
PRK10816223 PRK10816, PRK10816, DNA-binding transcriptional re 5e-07
PRK09581457 PRK09581, pleD, response regulator PleD; Reviewed 1e-06
COG2201350 COG2201, CheB, Chemotaxis response regulator conta 2e-06
PRK10693303 PRK10693, PRK10693, response regulator of RpoS; Pr 4e-06
PRK099591197 PRK09959, PRK09959, hybrid sensory histidine kinas 4e-06
PRK10046225 PRK10046, dpiA, two-component response regulator D 4e-06
COG4567182 COG4567, COG4567, Response regulator consisting of 6e-06
PRK11697238 PRK11697, PRK11697, putative two-component respons 6e-06
COG3279244 COG3279, LytT, Response regulator of the LytR/AlgR 1e-05
PRK10161229 PRK10161, PRK10161, transcriptional regulator PhoB 3e-05
PRK10529225 PRK10529, PRK10529, DNA-binding transcriptional ac 6e-05
PRK10701240 PRK10701, PRK10701, DNA-binding transcriptional re 8e-05
PRK12555337 PRK12555, PRK12555, chemotaxis-specific methyleste 1e-04
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-04
PRK00742354 PRK00742, PRK00742, chemotaxis-specific methyleste 1e-04
PRK13557540 PRK13557, PRK13557, histidine kinase; Provisional 1e-04
PRK10766221 PRK10766, PRK10766, DNA-binding transcriptional re 2e-04
COG3706435 COG3706, PleD, Response regulator containing a Che 3e-04
PRK10710240 PRK10710, PRK10710, DNA-binding transcriptional re 0.001
PRK10336219 PRK10336, PRK10336, DNA-binding transcriptional re 0.002
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information 
 Score =  106 bits (268), Expect = 1e-27
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 27  LAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFK 86
           L VDDD    ++L + L +  YEV        AL +L E +   DL++ D+ MP MDG +
Sbjct: 1   LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEK--PDLILLDIMMPGMDGLE 58

Query: 87  LL-ELVGLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVI 140
           LL  +     D+P++ L+A+ D +  ++ +  GA DYL KP   EEL    + ++
Sbjct: 59  LLRRIRKRGPDIPIIFLTAHGDDEDAVEALKAGADDYLTKPFSPEELLARIRALL 113

Length = 113
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|178707 PLN03162, PLN03162, golden-2 like transcription factor; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|226456 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional Back     alignment and domain information
>gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional Back     alignment and domain information
>gnl|CDD|236838 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>gnl|CDD|226230 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|182454 PRK10430, PRK10430, DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>gnl|CDD|236848 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|182755 PRK10816, PRK10816, DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182208 PRK10046, dpiA, two-component response regulator DpiA; Provisional Back     alignment and domain information
>gnl|CDD|226933 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|236956 PRK11697, PRK11697, putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>gnl|CDD|225818 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional Back     alignment and domain information
>gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>gnl|CDD|236738 PRK10701, PRK10701, DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|237425 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 529
COG3437360 Response regulator containing a CheY-like receiver 99.98
COG4565224 CitB Response regulator of citrate/malate metaboli 99.91
COG0745229 OmpR Response regulators consisting of a CheY-like 99.85
COG4753475 Response regulator containing CheY-like receiver d 99.84
COG2197211 CitB Response regulator containing a CheY-like rec 99.8
COG2204464 AtoC Response regulator containing CheY-like recei 99.79
PRK10046225 dpiA two-component response regulator DpiA; Provis 99.78
PF00072112 Response_reg: Response regulator receiver domain; 99.76
COG4566202 TtrR Response regulator [Signal transduction mecha 99.75
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.68
PRK10840216 transcriptional regulator RcsB; Provisional 99.67
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 99.66
PRK09483217 response regulator; Provisional 99.66
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 99.66
PLN03029222 type-a response regulator protein; Provisional 99.65
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.65
PRK11173237 two-component response regulator; Provisional 99.64
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 99.64
COG3947361 Response regulator containing CheY-like receiver a 99.63
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 99.63
PRK09836227 DNA-binding transcriptional activator CusR; Provis 99.63
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 99.63
COG3706435 PleD Response regulator containing a CheY-like rec 99.62
PRK11517223 transcriptional regulatory protein YedW; Provision 99.61
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 99.61
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 99.61
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 99.61
CHL00148240 orf27 Ycf27; Reviewed 99.61
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 99.61
PRK10161229 transcriptional regulator PhoB; Provisional 99.6
PRK13856241 two-component response regulator VirG; Provisional 99.6
COG4567182 Response regulator consisting of a CheY-like recei 99.59
PRK11083228 DNA-binding response regulator CreB; Provisional 99.59
PRK09468239 ompR osmolarity response regulator; Provisional 99.59
PRK09935210 transcriptional regulator FimZ; Provisional 99.58
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 99.58
PRK15347921 two component system sensor kinase SsrA; Provision 99.57
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 99.55
PRK10841924 hybrid sensory kinase in two-component regulatory 99.55
KOG0519786 consensus Sensory transduction histidine kinase [S 99.55
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 99.54
PRK11697238 putative two-component response-regulatory protein 99.52
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 99.52
PRK09581457 pleD response regulator PleD; Reviewed 99.52
PRK14084246 two-component response regulator; Provisional 99.52
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.52
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 99.52
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 99.51
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.5
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 99.5
PRK15115444 response regulator GlrR; Provisional 99.49
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.49
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.48
PRK15479221 transcriptional regulatory protein TctD; Provision 99.48
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 99.47
PRK12555337 chemotaxis-specific methylesterase; Provisional 99.46
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 99.46
PRK099591197 hybrid sensory histidine kinase in two-component r 99.46
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.46
PRK15411207 rcsA colanic acid capsular biosynthesis activation 99.46
PRK11091779 aerobic respiration control sensor protein ArcB; P 99.46
PRK15369211 two component system sensor kinase SsrB; Provision 99.45
PRK10403215 transcriptional regulator NarP; Provisional 99.45
PRK13435145 response regulator; Provisional 99.44
PRK09390202 fixJ response regulator FixJ; Provisional 99.44
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.44
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.42
PRK10651216 transcriptional regulator NarL; Provisional 99.42
PRK09581457 pleD response regulator PleD; Reviewed 99.4
PRK13558 665 bacterio-opsin activator; Provisional 99.38
PRK00742354 chemotaxis-specific methylesterase; Provisional 99.38
COG2201350 CheB Chemotaxis response regulator containing a Ch 99.35
COG3707194 AmiR Response regulator with putative antiterminat 99.28
PRK09191261 two-component response regulator; Provisional 99.27
PRK13837828 two-component VirA-like sensor kinase; Provisional 99.24
PLN03162526 golden-2 like transcription factor; Provisional 99.24
cd00156113 REC Signal receiver domain; originally thought to 99.18
PRK13557540 histidine kinase; Provisional 99.15
PRK10693303 response regulator of RpoS; Provisional 99.09
PRK15029 755 arginine decarboxylase; Provisional 99.05
COG3279244 LytT Response regulator of the LytR/AlgR family [T 99.02
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.78
COG2206344 c-di-GMP phosphodiesterase class II (HD-GYP domain 98.68
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 98.2
COG3706435 PleD Response regulator containing a CheY-like rec 98.04
smart0044855 REC cheY-homologous receiver domain. CheY regulate 97.48
PF1348764 HD_5: HD domain; PDB: 3TMD_A 3TM8_B 3TMC_A 3TMB_B. 97.45
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 97.33
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 96.35
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 96.31
PRK02261137 methylaspartate mutase subunit S; Provisional 95.98
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 95.45
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 95.44
PRK10618894 phosphotransfer intermediate protein in two-compon 95.26
PRK15399 713 lysine decarboxylase LdcC; Provisional 94.03
PRK15400 714 lysine decarboxylase CadA; Provisional 93.58
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 92.56
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 92.46
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 92.02
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 91.99
PRK00208250 thiG thiazole synthase; Reviewed 91.66
COG4999140 Uncharacterized domain of BarA-like signal transdu 90.83
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 90.46
PF1008797 DUF2325: Uncharacterized protein conserved in bact 87.93
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 87.05
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 86.81
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 86.21
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 86.16
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 85.62
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 85.21
CHL00162267 thiG thiamin biosynthesis protein G; Validated 84.41
PRK15320251 transcriptional activator SprB; Provisional 82.22
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 81.85
PRK09426714 methylmalonyl-CoA mutase; Reviewed 81.8
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.98  E-value=3.8e-33  Score=285.82  Aligned_cols=242  Identities=26%  Similarity=0.321  Sum_probs=186.1

Q ss_pred             CccEEEEEeCCHHHHHHHHHHHHhCCCeEEEECCHHHHHHHHHhcCCCceEEEEecCCCCCCHHHHHHHHhc-C---CCC
Q 009670           22 IGMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGL-E---MDL   97 (529)
Q Consensus        22 ~~mrVLIVDDd~~v~~~L~~~Le~~gy~V~~a~sa~eALe~L~e~~~~pDLVIlDi~MPdmdGleLL~~Ir~-~---~~i   97 (529)
                      ..++||+|||++..+..++..|+..+|+|..|.++++|++++.+..  +|+||+|++||+|||+++|.+++. .   ..+
T Consensus        13 ~~~~vl~vDD~~~~~~~~~~lL~~~~y~v~~ae~g~~a~kl~~~~~--~dlvllD~~mp~mdg~ev~~~lk~~~p~t~~i   90 (360)
T COG3437          13 EKLTVLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEP--PDLVLLDVRMPEMDGAEVLNKLKAMSPSTRRI   90 (360)
T ss_pred             ccceEEEecCchhHHHHHHHHHHhcccceeeecCchHHHHHhcccC--CceEEeeccCCCccHHHHHHHHHhcCCccccc
Confidence            3589999999999999999999999999999999999999998765  999999999999999999998875 3   468


Q ss_pred             cEEEEecCCCHHHHHHHHhcCCcEeEeCCCCHHHHHHHHHHHHHhccCCCcccCCCchhH-HhhhhcccCCC-CCC----
Q 009670           98 PVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRRKKVDPKDQNRSPHEF-EKSYRKRKDQD-GED----  171 (529)
Q Consensus        98 pVIvlTa~~d~e~v~~al~~GA~DYL~KP~~~eeL~~~l~~vlr~~~~~~~~~~~~~~~~-~~~~~kr~~~~-~~~----  171 (529)
                      |||++|++.+.+...+++..||+|||.||+++.+|..++...+..+.............+ .+..++..+.. ..+    
T Consensus        91 p~i~lT~~~d~~~~~~~~~~g~~dyl~KP~~~~~l~~rv~~~~q~k~~~~~~~~~~~~le~~e~~~~~~e~~~~~~~~~~  170 (360)
T COG3437          91 PVILLTAYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKRNEDFLLDQNLYLELQELRRRTEELAQIEDNLDE  170 (360)
T ss_pred             ceEEEeecCChHHHHHHHHhhHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999766544321111111111111 00011100000 000    


Q ss_pred             CCCCC--CCCCCCccccccCCCcceehhHHHHHHHHHHHHhcCCCc------------------chHHHHHHhcCCCCCC
Q 009670          172 EDEDG--DDDGHENENSTTQKKPRVVWTTELHTKFIGAVNLLGLDK------------------AVPKKILDLMNVEGLT  231 (529)
Q Consensus       172 ~~~~~--~~~~~~~e~~~~~kk~r~vw~~~L~~kflaavn~lGldk------------------avPd~IL~~mk~~~LT  231 (529)
                      ..+..  ..+.++.+      ...|+.|++.+.+.++..  +|+++                  ++||.||  +|+++||
T Consensus       171 t~~~L~~~~E~R~~e------tg~H~~Rv~~~~~~lAe~--lgLse~~v~~i~~AapLHDIGKvaiPD~IL--lKpg~Lt  240 (360)
T COG3437         171 TLEELAALLEVRDYE------TGDHLERVAQYSELLAEL--LGLSEEEVDLIKKAAPLHDIGKVAIPDSIL--LKPGKLT  240 (360)
T ss_pred             HHHHHHHHHHhcccc------hhhHHHHHHHHHHHHHHH--hCCCHHHHHHHHhccchhhcccccCChHHh--cCCCCCC
Confidence            00000  00112222      336778888888777766  88876                  9999999  9999999


Q ss_pred             HHHHHHHHHHHHHHHHHhhhhhhhhhhhhccCCCCchhhhhhhhhhcCCCCccCCCCc
Q 009670          232 RENVASHLQKFRLSLKRLGNKTLEAGMVASVGSKDSSYLRIGALDGFGGSHSVNSPGR  289 (529)
Q Consensus       232 ~eEvAshLqkyr~~Lk~~~~~~~~~~g~~~l~~sd~~~l~~aa~ial~hhe~~dGsG~  289 (529)
                      .||++.        |+.|+.     +|.++|+.+.. +++.|++||+.|||||||||-
T Consensus       241 ~ee~~i--------mk~H~~-----~G~~il~~s~~-~mq~a~eIa~~HHErwDGsGY  284 (360)
T COG3437         241 SEEFEI--------MKGHPI-----LGAEILKSSER-LMQVAAEIARHHHERWDGSGY  284 (360)
T ss_pred             HHHHHH--------HhcchH-----HHHHHHHHHHH-HHHHHHHHHHHhhhccCCCCC
Confidence            999555        999999     99999988776 999999999999999999994

>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG2206 c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PF13487 HD_5: HD domain; PDB: 3TMD_A 3TM8_B 3TMC_A 3TMB_B Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK15320 transcriptional activator SprB; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query529
1irz_A64 Solution Structure Of Arr10-B Belonging To The Garp 2e-21
3nhz_A125 Structure Of N-Terminal Domain Of Mtra Length = 125 9e-12
3nnn_A122 Bef3 Activated Drrd Receiver Domain Length = 122 7e-11
3t6k_A136 Crystal Structure Of A Hypothetical Response Regula 1e-10
3jte_A143 Crystal Structure Of Response Regulator Receiver Do 3e-10
3f6p_A120 Crystal Structure Of Unphosphorelated Receiver Doma 8e-10
2zwm_A130 Crystal Structure Of Yycf Receiver Domain From Baci 8e-10
1l5y_A155 Crystal Structure Of Mg2+ / Bef3-bound Receiver Dom 3e-09
3r0j_A250 Structure Of Phop From Mycobacterium Tuberculosis L 3e-09
3to5_A134 High Resolution Structure Of Chey3 From Vibrio Chol 4e-09
1ys6_A233 Crystal Structure Of The Response Regulatory Protei 5e-09
1qkk_A155 Crystal Structure Of The Receiver Domain And Linker 6e-09
3gt7_A154 Crystal Structure Of Signal Receiver Domain Of Sign 7e-09
2wb4_A459 Activated Diguanylate Cyclase Pled In Complex With 8e-09
1w25_A459 Response Regulator Pled In Complex With C-digmp Len 8e-09
2ayx_A254 Solution Structure Of The E.Coli Rcsc C-Terminus (R 2e-08
3ffw_A128 Crystal Structure Of Chey Triple Mutant F14q, N59k, 2e-08
1zy2_A150 Crystal Structure Of The Phosphorylated Receiver Do 4e-08
1m5t_A124 Crystal Structure Of The Response Regulator Divk Le 5e-08
3ffx_A128 Crystal Structure Of Chey Triple Mutant F14e, N59r, 6e-08
1kgs_A225 Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG 7e-08
3rvn_A132 Structure Of The Chey-Bef3 Complex With Substitutio 8e-08
2ayz_A133 Solution Structure Of The E.Coli Rcsc C-Terminus (R 8e-08
1mvo_A136 Crystal Structure Of The Phop Receiver Domain From 9e-08
3f7n_A128 Crystal Structure Of Chey Triple Mutant F14e, N59m, 9e-08
1yio_A208 Crystallographic Structure Of Response Regulator St 1e-07
1dc7_A124 Structure Of A Transiently Phosphorylated "switch" 1e-07
1krw_A124 Solution Structure And Backbone Dynamics Of Beryllo 1e-07
3fgz_A128 Crystal Structure Of Chey Triple Mutant F14e, N59m, 1e-07
1j56_A124 Minimized Average Structure Of Beryllofluoride-Acti 1e-07
1dz3_A130 Domain-Swapping In The Sporulation Response Regulat 2e-07
3q9s_A249 Crystal Structure Of Rra(1-215) From Deinococcus Ra 2e-07
3fft_A128 Crystal Structure Of Chey Double Mutant F14e, E89r 2e-07
1ab6_A125 Structure Of Chey Mutant F14n, V86t Length = 125 4e-07
1ab5_A125 Structure Of Chey Mutant F14n, V21t Length = 125 4e-07
1d4z_A128 Crystal Structure Of Chey-95iv, A Hyperactive Chey 5e-07
1mih_A129 A Role For Chey Glu 89 In Chez-Mediated Dephosphory 6e-07
1udr_A129 Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Rep 7e-07
1nxo_A120 Micarec Ph7.0 Length = 120 7e-07
1cey_A128 Assignments, Secondary Structure, Global Fold, And 7e-07
1eay_A128 Chey-Binding (P2) Domain Of Chea In Complex With Ch 7e-07
1djm_A129 Solution Structure Of Bef3-Activated Chey From Esch 8e-07
1cye_A129 Three Dimensional Structure Of Chemotactic Che Y Pr 9e-07
1ymv_A129 Signal Transduction Protein Chey Mutant With Phe 14 9e-07
3rvl_A132 Structure Of The Chey-Bef3 Complex With Substitutio 9e-07
3rvj_A132 Structure Of The Chey-Bef3 Complex With Substitutio 9e-07
3eq2_A394 Structure Of Hexagonal Crystal Form Of Pseudomonas 9e-07
3rvp_A132 Structure Of The Chey-Bef3 Complex With Substitutio 1e-06
2oqr_A230 The Structure Of The Response Regulator Regx3 From 1e-06
3myy_A128 Structure Of E. Coli Chey Mutant A113p Bound To Ber 1e-06
3oo0_A129 Structure Of Apo Chey A113p Length = 129 1e-06
3f7a_A394 Structure Of Orthorhombic Crystal Form Of Pseudomon 1e-06
1ymu_A130 Signal Transduction Protein Chey Mutant With Met 17 1e-06
1qmp_A130 Phosphorylated Aspartate In The Crystal Structure O 1e-06
1zit_A121 Structure Of The Receiver Domain Of Ntrc4 From Aqui 1e-06
1s8n_A205 Crystal Structure Of Rv1626 From Mycobacterium Tube 1e-06
1dc8_A124 Structure Of A Transiently Phosphorylated "switch" 2e-06
2che_A128 Structure Of The Mg2+-Bound Form Of Chey And Mechan 2e-06
2fka_A129 Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Che 2e-06
1vlz_A128 Uncoupled Phosphorylation And Activation In Bacteri 2e-06
3olx_A129 Structural And Functional Effects Of Substitution A 2e-06
1dbw_A126 Crystal Structure Of Fixj-N Length = 126 2e-06
5chy_A128 Structure Of Chemotaxis Protein Chey Length = 128 2e-06
3olw_A129 Structural And Functional Effects Of Substitution A 2e-06
3olv_A129 Structural And Functional Effects Of Substitution A 2e-06
2qzj_A136 Crystal Structure Of A Two-Component Response Regul 3e-06
1p6u_A129 Nmr Structure Of The Bef3-Activated Structure Of Th 3e-06
3h1g_A129 Crystal Structure Of Chey Mutant T84a Of Helicobact 3e-06
3oly_A129 Structural And Functional Effects Of Substitution A 3e-06
3dzd_A368 Crystal Structure Of Sigma54 Activator Ntrc4 In The 3e-06
1jbe_A128 1.08 A Structure Of Apo-Chey Reveals Meta-Active Co 3e-06
3eod_A130 Crystal Structure Of N-Terminal Domain Of E. Coli R 4e-06
1ehc_A128 Structure Of Signal Transduction Protein Chey Lengt 4e-06
2rjn_A154 Crystal Structure Of An Uncharacterized Protein Q2b 4e-06
1nxt_A120 Micarec Ph 4.0 Length = 120 4e-06
2chy_A128 Three-Dimensional Structure Of Chey, The Response R 5e-06
1c4w_A128 1.9 A Structure Of A-Thiophosphonate Modified Chey 5e-06
1zdm_A129 Crystal Structure Of Activated Chey Bound To Xe Len 5e-06
3tmy_A120 Chey From Thermotoga Maritima (Mn-Iii) Length = 120 5e-06
3cfy_A137 Crystal Structure Of Signal Receiver Domain Of Puta 5e-06
1e6l_A127 Two-Component Signal Transduction System D13a Mutan 6e-06
6chy_A128 Structure Of Chemotaxis Protein Chey Length = 128 6e-06
1e6m_A128 Two-Component Signal Transduction System D57a Mutan 6e-06
3m6m_D143 Crystal Structure Of Rpff Complexed With Rec Domain 6e-06
1u0s_Y118 Chemotaxis Kinase Chea P2 Domain In Complex With Re 7e-06
1e6k_A130 Two-Component Signal Transduction System D12a Mutan 7e-06
3gwg_A129 Crystal Structure Of Chey Of Helicobacter Pylori Le 1e-05
2id7_A128 1.75 A Structure Of T87i Phosphono-Chey Length = 12 1e-05
1d5w_A126 Phosphorylated Fixj Receiver Domain Length = 126 2e-05
2qr3_A140 Crystal Structure Of The N-Terminal Signal Receiver 2e-05
3hv2_A153 Crystal Structure Of Signal Receiver Domain Of Hd D 2e-05
2qxy_A142 Crystal Structure Of A Response Regulator From Ther 2e-05
1zh2_A121 Crystal Structure Of The Calcium-Bound Receiver Dom 3e-05
1f51_E119 A Transient Interaction Between Two Phosphorelay Pr 3e-05
2id9_A128 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length 4e-05
1srr_A124 Crystal Structure Of A Phosphatase Resistant Mutant 5e-05
1zgz_A122 Crystal Structure Of The Receiver Domain Of Tmao Re 5e-05
1pux_A124 Nmr Solution Structure Of Bef3-Activated Spo0f, 20 5e-05
3q15_C126 Crystal Structure Of Raph Complexed With Spo0f Leng 6e-05
1b00_A127 Phob Receiver Domain From Escherichia Coli Length = 7e-05
3h1f_A129 Crystal Structure Of Chey Mutant D53a Of Helicobact 7e-05
1zes_A125 Bef3- Activated Phob Receiver Domain Length = 125 7e-05
1a2o_A349 Structural Basis For Methylesterase Cheb Regulation 8e-05
3nns_A117 Bef3 Activated Drrb Receiver Domain Length = 117 9e-05
2gwr_A238 Crystal Structure Of The Response Regulator Protein 1e-04
2jvj_A132 Nmr Solution Structure Of The Hyper-Sporulation Res 1e-04
2jvi_A132 Nmr Solution Structure Of The Hyper-Sporulation Res 1e-04
1ny5_A387 Crystal Structure Of Sigm54 Activator (Aaa+ Atpase) 2e-04
2pkx_A121 E.Coli Response Regulator Phop Receiver Domain Leng 2e-04
3dge_C122 Structure Of A Histidine Kinase-response Regulator 2e-04
2jvk_A132 Nmr Solution Structure Of The Hyper-Sporulation Res 3e-04
3cu5_A141 Crystal Structure Of A Two Component Transcriptiona 3e-04
1hey_A128 Investigating The Structural Determinants Of The P2 3e-04
2ftk_E124 Berylloflouride Spo0f Complex With Spo0b Length = 1 3e-04
1p2f_A220 Crystal Structure Analysis Of Response Regulator Dr 4e-04
2jb9_A127 Phob Response Regulator Receiver Domain Constitutiv 6e-04
3c97_A140 Crystal Structure Of The Response Regulator Receive 7e-04
3a0u_A116 Crystal Structure Of Response Regulator Protein Trr 7e-04
>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family Of Plant Myb-Related Dna Binding Motifs Of The Arabidopsis Response Regulators Length = 64 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (249), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/63 (73%), Positives = 57/63 (90%)
Query: 187 TTQKKPRVVWTTELHTKFIGAVNLLGLDKAVPKKILDLMNVEGLTRENVASHLQKFRLSL 246
           T QKKPRV+WT ELH KF+ AV+ LG+++AVPKKILDLMNV+ LTRENVASHLQKFR++L
Sbjct: 1   TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVAL 60
Query: 247 KRL 249
           K++
Sbjct: 61  KKV 63
>pdb|3NHZ|A Chain A, Structure Of N-Terminal Domain Of Mtra Length = 125 Back     alignment and structure
>pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 Back     alignment and structure
>pdb|3T6K|A Chain A, Crystal Structure Of A Hypothetical Response Regulator (Caur_3799) From Chloroflexus Aurantiacus J-10-Fl At 1.86 A Resolution Length = 136 Back     alignment and structure
>pdb|3JTE|A Chain A, Crystal Structure Of Response Regulator Receiver Domain Protein From Clostridium Thermocellum Length = 143 Back     alignment and structure
>pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 Back     alignment and structure
>pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 Back     alignment and structure
>pdb|1L5Y|A Chain A, Crystal Structure Of Mg2+ / Bef3-bound Receiver Domain Of Sinorhizobium Meliloti Dctd Length = 155 Back     alignment and structure
>pdb|3R0J|A Chain A, Structure Of Phop From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 Back     alignment and structure
>pdb|1YS6|A Chain A, Crystal Structure Of The Response Regulatory Protein Prra From Mycobacterium Tuberculosis Length = 233 Back     alignment and structure
>pdb|1QKK|A Chain A, Crystal Structure Of The Receiver Domain And Linker Region Of Dctd From Sinorhizobium Meliloti Length = 155 Back     alignment and structure
>pdb|3GT7|A Chain A, Crystal Structure Of Signal Receiver Domain Of Signal Transduction Histidine Kinase From Syntrophus Aciditrophicus Length = 154 Back     alignment and structure
>pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
>pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-digmp Length = 459 Back     alignment and structure
>pdb|2AYX|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 700-949) Containing Linker Region And Phosphoreceiver Domain Length = 254 Back     alignment and structure
>pdb|3FFW|A Chain A, Crystal Structure Of Chey Triple Mutant F14q, N59k, E89y Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1ZY2|A Chain A, Crystal Structure Of The Phosphorylated Receiver Domain Of The Transcription Regulator Ntrc1 From Aquifex Aeolicus Length = 150 Back     alignment and structure
>pdb|1M5T|A Chain A, Crystal Structure Of The Response Regulator Divk Length = 124 Back     alignment and structure
>pdb|3FFX|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59r, E89h Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1KGS|A Chain A, Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG FROM THERMOTOGA Maritima Length = 225 Back     alignment and structure
>pdb|3RVN|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89y Length = 132 Back     alignment and structure
>pdb|2AYZ|A Chain A, Solution Structure Of The E.Coli Rcsc C-Terminus (Residues 817-949) Containing Phosphoreceiver Domain Length = 133 Back     alignment and structure
>pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 Back     alignment and structure
>pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1YIO|A Chain A, Crystallographic Structure Of Response Regulator Styr From Pseudomonas Fluorescens Length = 208 Back     alignment and structure
>pdb|1DC7|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 Back     alignment and structure
>pdb|1KRW|A Chain A, Solution Structure And Backbone Dynamics Of Beryllofluoride- Activated Ntrc Receiver Domain Length = 124 Back     alignment and structure
>pdb|3FGZ|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89r Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1J56|A Chain A, Minimized Average Structure Of Beryllofluoride-Activated Ntrc Receiver Domain: Model Structure Incorporating Active Site Contacts Length = 124 Back     alignment and structure
>pdb|1DZ3|A Chain A, Domain-Swapping In The Sporulation Response Regulator Spo0a Length = 130 Back     alignment and structure
>pdb|3Q9S|A Chain A, Crystal Structure Of Rra(1-215) From Deinococcus Radiodurans Length = 249 Back     alignment and structure
>pdb|3FFT|A Chain A, Crystal Structure Of Chey Double Mutant F14e, E89r Complexed With Bef3- And Mn2+ Length = 128 Back     alignment and structure
>pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t Length = 125 Back     alignment and structure
>pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t Length = 125 Back     alignment and structure
>pdb|1D4Z|A Chain A, Crystal Structure Of Chey-95iv, A Hyperactive Chey Mutant Length = 128 Back     alignment and structure
>pdb|1MIH|A Chain A, A Role For Chey Glu 89 In Chez-Mediated Dephosphorylation Of The E. Coli Chemotaxis Response Regulator Chey Length = 129 Back     alignment and structure
>pdb|1UDR|A Chain A, Chey Mutant With Lys 91 Replaced By Asp, Lys 92 Replaced By Ala, Ile 96 Replaced By Lys And Ala 98 Replaced By Leu (Stabilizing Mutations In Helix 4) Length = 129 Back     alignment and structure
>pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 Back     alignment and structure
>pdb|1CEY|A Chain A, Assignments, Secondary Structure, Global Fold, And Dynamics Of Chemotaxis Y Protein Using Three-And Four-Dimensional Heteronuclear (13c,15n) Nmr Spectroscopy Length = 128 Back     alignment and structure
>pdb|1EAY|A Chain A, Chey-Binding (P2) Domain Of Chea In Complex With Chey From Escherichia Coli Length = 128 Back     alignment and structure
>pdb|1DJM|A Chain A, Solution Structure Of Bef3-Activated Chey From Escherichia Coli Length = 129 Back     alignment and structure
>pdb|1CYE|A Chain A, Three Dimensional Structure Of Chemotactic Che Y Protein In Aqueous Solution By Nuclear Magnetic Resonance Methods Length = 129 Back     alignment and structure
>pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14 Replaced By Gly, Ser 15 Replaced By Gly, And Met 17 Replaced By Gly Length = 129 Back     alignment and structure
>pdb|3RVL|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89r Length = 132 Back     alignment and structure
>pdb|3RVJ|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89q Length = 132 Back     alignment and structure
>pdb|3EQ2|A Chain A, Structure Of Hexagonal Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 Back     alignment and structure
>pdb|3RVP|A Chain A, Structure Of The Chey-Bef3 Complex With Substitutions At 59 And 89: N59d And E89k Length = 132 Back     alignment and structure
>pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 Back     alignment and structure
>pdb|3MYY|A Chain A, Structure Of E. Coli Chey Mutant A113p Bound To Beryllium Fluoride Length = 128 Back     alignment and structure
>pdb|3OO0|A Chain A, Structure Of Apo Chey A113p Length = 129 Back     alignment and structure
>pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 Back     alignment and structure
>pdb|1YMU|A Chain A, Signal Transduction Protein Chey Mutant With Met 17 Replaced By Gly (M17g) Length = 130 Back     alignment and structure
>pdb|1QMP|A Chain A, Phosphorylated Aspartate In The Crystal Structure Of The Sporulation Response Regulator, Spo0a Length = 130 Back     alignment and structure
>pdb|1ZIT|A Chain A, Structure Of The Receiver Domain Of Ntrc4 From Aquifex Aeolicus Length = 121 Back     alignment and structure
>pdb|1S8N|A Chain A, Crystal Structure Of Rv1626 From Mycobacterium Tuberculosis Length = 205 Back     alignment and structure
>pdb|1DC8|A Chain A, Structure Of A Transiently Phosphorylated "switch" In Bacterial Signal Transduction Length = 124 Back     alignment and structure
>pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of Phosphoryl Transfer In Bacterial Chemotaxis Length = 128 Back     alignment and structure
>pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In Complex With Chez(200-214) Solved From A F432 Crystal Grown In Caps (Ph 10.5) Length = 129 Back     alignment and structure
>pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To Isoleucine Mutant At Position 87 Of Chey Length = 128 Back     alignment and structure
>pdb|3OLX|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88s-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|1DBW|A Chain A, Crystal Structure Of Fixj-N Length = 126 Back     alignment and structure
>pdb|5CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 Back     alignment and structure
>pdb|3OLW|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88t-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|3OLV|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88v-Bef3-Mg Complex Length = 129 Back     alignment and structure
>pdb|2QZJ|A Chain A, Crystal Structure Of A Two-Component Response Regulator From Clostridium Difficile Length = 136 Back     alignment and structure
>pdb|1P6U|A Chain A, Nmr Structure Of The Bef3-Activated Structure Of The Response Regulator Chey2-Mg2+ From Sinorhizobium Meliloti Length = 129 Back     alignment and structure
>pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3OLY|A Chain A, Structural And Functional Effects Of Substitution At Position T+1 In Chey: Cheya88m-Bef3-Mn Complex Length = 129 Back     alignment and structure
>pdb|3DZD|A Chain A, Crystal Structure Of Sigma54 Activator Ntrc4 In The Inactive State Length = 368 Back     alignment and structure
>pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active Conformation Length = 128 Back     alignment and structure
>pdb|3EOD|A Chain A, Crystal Structure Of N-Terminal Domain Of E. Coli Rssb Length = 130 Back     alignment and structure
>pdb|1EHC|A Chain A, Structure Of Signal Transduction Protein Chey Length = 128 Back     alignment and structure
>pdb|2RJN|A Chain A, Crystal Structure Of An Uncharacterized Protein Q2bku2 From Neptuniibacter Caesariensis Length = 154 Back     alignment and structure
>pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 Back     alignment and structure
>pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response Regulator Of Bacterial Chemotaxis Length = 128 Back     alignment and structure
>pdb|1C4W|A Chain A, 1.9 A Structure Of A-Thiophosphonate Modified Chey D57c Length = 128 Back     alignment and structure
>pdb|1ZDM|A Chain A, Crystal Structure Of Activated Chey Bound To Xe Length = 129 Back     alignment and structure
>pdb|3TMY|A Chain A, Chey From Thermotoga Maritima (Mn-Iii) Length = 120 Back     alignment and structure
>pdb|3CFY|A Chain A, Crystal Structure Of Signal Receiver Domain Of Putative Luxo Repressor Protein From Vibrio Parahaemolyticus Length = 137 Back     alignment and structure
>pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of Chey Length = 127 Back     alignment and structure
>pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey Length = 128 Back     alignment and structure
>pdb|1E6M|A Chain A, Two-Component Signal Transduction System D57a Mutant Of Chey Length = 128 Back     alignment and structure
>pdb|3M6M|D Chain D, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 143 Back     alignment and structure
>pdb|1U0S|Y Chain Y, Chemotaxis Kinase Chea P2 Domain In Complex With Response Regulator Chey From The Thermophile Thermotoga Maritima Length = 118 Back     alignment and structure
>pdb|1E6K|A Chain A, Two-Component Signal Transduction System D12a Mutant Of Chey Length = 130 Back     alignment and structure
>pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|2ID7|A Chain A, 1.75 A Structure Of T87i Phosphono-Chey Length = 128 Back     alignment and structure
>pdb|1D5W|A Chain A, Phosphorylated Fixj Receiver Domain Length = 126 Back     alignment and structure
>pdb|2QR3|A Chain A, Crystal Structure Of The N-Terminal Signal Receiver Domain Of Two- Component System Response Regulator From Bacteroides Fragilis Length = 140 Back     alignment and structure
>pdb|3HV2|A Chain A, Crystal Structure Of Signal Receiver Domain Of Hd Domain- Containing Protein From Pseudomonas Fluorescens Pf-5 Length = 153 Back     alignment and structure
>pdb|2QXY|A Chain A, Crystal Structure Of A Response Regulator From Thermotoga Maritima Length = 142 Back     alignment and structure
>pdb|1ZH2|A Chain A, Crystal Structure Of The Calcium-Bound Receiver Domain Of Kdp Potassium Transport System Response Regulator Kdpe Length = 121 Back     alignment and structure
>pdb|1F51|E Chain E, A Transient Interaction Between Two Phosphorelay Proteins Trapped In A Crystal Lattice Reveals The Mechanism Of Molecular Recognition And Phosphotransfer In Singal Transduction Length = 119 Back     alignment and structure
>pdb|2ID9|A Chain A, 1.85 A Structure Of T87iY106W PHOSPHONO-Chey Length = 128 Back     alignment and structure
>pdb|1SRR|A Chain A, Crystal Structure Of A Phosphatase Resistant Mutant Of Sporulation Response Regulator Spo0f From Bacillus Subtilis Length = 124 Back     alignment and structure
>pdb|1ZGZ|A Chain A, Crystal Structure Of The Receiver Domain Of Tmao Respiratory System Response Regulator Torr Length = 122 Back     alignment and structure
>pdb|1PUX|A Chain A, Nmr Solution Structure Of Bef3-Activated Spo0f, 20 Conformers Length = 124 Back     alignment and structure
>pdb|3Q15|C Chain C, Crystal Structure Of Raph Complexed With Spo0f Length = 126 Back     alignment and structure
>pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 Back     alignment and structure
>pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 Back     alignment and structure
>pdb|1A2O|A Chain A, Structural Basis For Methylesterase Cheb Regulation By A Phosphorylation-Activated Domain Length = 349 Back     alignment and structure
>pdb|3NNS|A Chain A, Bef3 Activated Drrb Receiver Domain Length = 117 Back     alignment and structure
>pdb|2GWR|A Chain A, Crystal Structure Of The Response Regulator Protein Mtra From Mycobacterium Tuberculosis Length = 238 Back     alignment and structure
>pdb|2JVJ|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant I90a From Bacillus Subtilis Length = 132 Back     alignment and structure
>pdb|2JVI|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant H101a From Bacillus Subtilis Length = 132 Back     alignment and structure
>pdb|1NY5|A Chain A, Crystal Structure Of Sigm54 Activator (Aaa+ Atpase) In The Inactive State Length = 387 Back     alignment and structure
>pdb|2PKX|A Chain A, E.Coli Response Regulator Phop Receiver Domain Length = 121 Back     alignment and structure
>pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>pdb|2JVK|A Chain A, Nmr Solution Structure Of The Hyper-Sporulation Response Regulator Spo0f Mutant L66a From Bacillus Subtilis Length = 132 Back     alignment and structure
>pdb|3CU5|A Chain A, Crystal Structure Of A Two Component Transcriptional Regulator Arac From Clostridium Phytofermentans Isdg Length = 141 Back     alignment and structure
>pdb|1HEY|A Chain A, Investigating The Structural Determinants Of The P21-Like Triphosphate And Mg2+ Binding Site Length = 128 Back     alignment and structure
>pdb|2FTK|E Chain E, Berylloflouride Spo0f Complex With Spo0b Length = 124 Back     alignment and structure
>pdb|1P2F|A Chain A, Crystal Structure Analysis Of Response Regulator Drrb, A Thermotoga Maritima OmprPHOB HOMOLOG Length = 220 Back     alignment and structure
>pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 Back     alignment and structure
>pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 Back     alignment and structure
>pdb|3A0U|A Chain A, Crystal Structure Of Response Regulator Protein Trra (Tm1360) From Thermotoga Maritima In Complex With Mg(2+)- Bef (Wild Type) Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query529
3hdg_A137 Uncharacterized protein; two-component sensor acti 1e-30
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 5e-30
1srr_A124 SPO0F, sporulation response regulatory protein; as 1e-29
2rjn_A154 Response regulator receiver:metal-dependent phosph 2e-29
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 1e-28
2qxy_A142 Response regulator; regulation of transcription, N 2e-28
3jte_A143 Response regulator receiver protein; structural ge 2e-28
4dad_A146 Putative pilus assembly-related protein; response 2e-28
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 2e-28
3cfy_A137 Putative LUXO repressor protein; structural genomi 3e-28
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 4e-28
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 4e-28
3rqi_A184 Response regulator protein; structural genomics, s 7e-28
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 1e-27
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 1e-27
3hdv_A136 Response regulator; PSI-II, structural genomics, P 5e-27
3cg0_A140 Response regulator receiver modulated diguanylate 8e-27
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 3e-26
3eqz_A135 Response regulator; structural genomics, unknown f 2e-25
3h5i_A140 Response regulator/sensory box protein/ggdef domai 2e-25
3bre_A358 Probable two-component response regulator; protein 2e-25
3i42_A127 Response regulator receiver domain protein (CHEY- 3e-25
2qr3_A140 Two-component system response regulator; structura 5e-25
1w25_A459 Stalked-cell differentiation controlling protein; 8e-25
1w25_A459 Stalked-cell differentiation controlling protein; 5e-19
3luf_A259 Two-component system response regulator/ggdef doma 9e-25
3luf_A259 Two-component system response regulator/ggdef doma 4e-23
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 1e-24
3eq2_A394 Probable two-component response regulator; adaptor 1e-24
3crn_A132 Response regulator receiver domain protein, CHEY-; 1e-24
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 1e-24
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 4e-24
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 5e-24
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 1e-23
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 2e-23
3gt7_A154 Sensor protein; structural genomics, signal receiv 2e-23
3grc_A140 Sensor protein, kinase; protein structure initiati 2e-23
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 5e-23
3cnb_A143 DNA-binding response regulator, MERR family; signa 5e-23
1s8n_A205 Putative antiterminator; RV1626, structural genomi 7e-23
3n53_A140 Response regulator receiver modulated diguanylate; 1e-22
3c3m_A138 Response regulator receiver protein; structural ge 2e-22
3snk_A135 Response regulator CHEY-like protein; P-loop conta 3e-22
1ys7_A233 Transcriptional regulatory protein PRRA; response 4e-22
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 4e-22
3nhm_A133 Response regulator; protein structure initiative I 5e-22
3r0j_A250 Possible two component system response transcript 7e-22
3lua_A140 Response regulator receiver protein; two-component 8e-22
2zay_A147 Response regulator receiver protein; structural ge 8e-22
3q9s_A249 DNA-binding response regulator; DNA binding protei 1e-21
3lte_A132 Response regulator; structural genomics, PSI, prot 1e-21
3n0r_A286 Response regulator; sigma factor, receiver, two-co 2e-21
2qv0_A143 Protein MRKE; structural genomics, transcription, 2e-21
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 2e-21
1yio_A208 Response regulatory protein; transcription regulat 3e-21
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 4e-21
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 4e-21
3a10_A116 Response regulator; phosphoacceptor, signaling pro 1e-20
2rdm_A132 Response regulator receiver protein; structural ge 2e-20
3cg4_A142 Response regulator receiver domain protein (CHEY-; 6e-20
2gwr_A238 DNA-binding response regulator MTRA; two-component 7e-20
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 7e-20
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 1e-19
1mb3_A124 Cell division response regulator DIVK; signal tran 2e-19
2oqr_A230 Sensory transduction protein REGX3; response regul 2e-19
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 3e-19
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 4e-19
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 4e-19
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 6e-19
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 6e-19
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 6e-19
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 1e-18
1zgz_A122 Torcad operon transcriptional regulatory protein; 2e-18
1xhf_A123 DYE resistance, aerobic respiration control protei 3e-18
2hqr_A223 Putative transcriptional regulator; phosporylation 9e-18
3heb_A152 Response regulator receiver domain protein (CHEY); 1e-17
3kto_A136 Response regulator receiver protein; PSI-II,struct 1e-17
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 2e-17
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 3e-17
2pln_A137 HP1043, response regulator; signaling protein; 1.8 3e-17
3c97_A140 Signal transduction histidine kinase; structural g 5e-17
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 6e-17
1mvo_A136 PHOP response regulator; phosphate regulon, transc 8e-17
2gkg_A127 Response regulator homolog; social motility, recei 8e-17
2ayx_A254 Sensor kinase protein RCSC; two independent struct 9e-17
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 3e-16
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 4e-16
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 9e-16
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 1e-15
1dz3_A130 Stage 0 sporulation protein A; response regulator, 1e-14
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 6e-14
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 4e-13
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 8e-13
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 1e-12
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 2e-12
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 3e-12
2qsj_A154 DNA-binding response regulator, LUXR family; struc 9e-12
3f6c_A134 Positive transcription regulator EVGA; structural 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 1e-09
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 3e-09
3sy8_A400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 2e-08
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 2e-08
3cz5_A153 Two-component response regulator, LUXR family; str 3e-08
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 4e-08
3eul_A152 Possible nitrate/nitrite response transcriptional 5e-07
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 2e-06
3c3w_A225 Two component transcriptional regulatory protein; 3e-06
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 7e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 8e-04
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
 Score =  114 bits (289), Expect = 1e-30
 Identities = 28/131 (21%), Positives = 56/131 (42%), Gaps = 3/131 (2%)

Query: 23  GMRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDM 82
            +++L V+DD    + L   +     EV          ++   +    D++I+D+ MP +
Sbjct: 7   ALKILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHA--PDVIITDIRMPKL 64

Query: 83  DGFKLLELV-GLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIR 141
            G ++L+ +        V+++SA+S+ K  +K I  G   +L KP+    L  T +    
Sbjct: 65  GGLEMLDRIKAGGAKPYVIVISAFSEMKYFIKAIELGVHLFLPKPIEPGRLMETLEDFRH 124

Query: 142 RKKVDPKDQNR 152
            K       + 
Sbjct: 125 IKLAKEGHHHH 135
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query529
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.92
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.87
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.87
2lpm_A123 Two-component response regulator; transcription re 99.86
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.86
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.85
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.84
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.83
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.83
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.83
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.83
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.82
3rqi_A184 Response regulator protein; structural genomics, s 99.82
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.82
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.82
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.82
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.82
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.82
1xhf_A123 DYE resistance, aerobic respiration control protei 99.82
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.81
3jte_A143 Response regulator receiver protein; structural ge 99.81
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.81
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.81
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.81
1mb3_A124 Cell division response regulator DIVK; signal tran 99.81
3lua_A140 Response regulator receiver protein; two-component 99.81
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.81
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.81
3f6c_A134 Positive transcription regulator EVGA; structural 99.81
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.81
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.81
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.81
3grc_A140 Sensor protein, kinase; protein structure initiati 99.81
3r0j_A250 Possible two component system response transcript 99.81
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.81
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.81
3heb_A152 Response regulator receiver domain protein (CHEY); 99.81
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.81
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.81
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.81
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.8
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.8
3i42_A127 Response regulator receiver domain protein (CHEY- 99.8
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.8
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.8
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.8
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.8
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.8
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.8
3nhm_A133 Response regulator; protein structure initiative I 99.8
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.79
2zay_A147 Response regulator receiver protein; structural ge 99.79
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.79
3q9s_A249 DNA-binding response regulator; DNA binding protei 99.79
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.79
4dad_A146 Putative pilus assembly-related protein; response 99.79
3luf_A259 Two-component system response regulator/ggdef doma 99.79
3eul_A152 Possible nitrate/nitrite response transcriptional 99.79
3c3m_A138 Response regulator receiver protein; structural ge 99.79
3cg0_A140 Response regulator receiver modulated diguanylate 99.79
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.79
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.79
3n53_A140 Response regulator receiver modulated diguanylate; 99.78
3lte_A132 Response regulator; structural genomics, PSI, prot 99.78
2qr3_A140 Two-component system response regulator; structura 99.78
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.78
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 99.78
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.77
3c3w_A225 Two component transcriptional regulatory protein; 99.77
2qxy_A142 Response regulator; regulation of transcription, N 99.77
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.77
1yio_A208 Response regulatory protein; transcription regulat 99.77
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.77
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.77
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 99.77
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.77
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.77
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.76
3cz5_A153 Two-component response regulator, LUXR family; str 99.76
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.76
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.76
2gkg_A127 Response regulator homolog; social motility, recei 99.76
3eq2_A394 Probable two-component response regulator; adaptor 99.76
2oqr_A230 Sensory transduction protein REGX3; response regul 99.76
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.75
1ys7_A233 Transcriptional regulatory protein PRRA; response 99.75
2gwr_A238 DNA-binding response regulator MTRA; two-component 99.75
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.75
1w25_A459 Stalked-cell differentiation controlling protein; 99.74
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.74
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.73
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.73
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.73
3c97_A140 Signal transduction histidine kinase; structural g 99.73
2rdm_A132 Response regulator receiver protein; structural ge 99.73
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.73
3eqz_A135 Response regulator; structural genomics, unknown f 99.72
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.72
3bre_A358 Probable two-component response regulator; protein 99.72
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 99.71
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.71
3sy8_A400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.69
2hqr_A223 Putative transcriptional regulator; phosporylation 99.69
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.69
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.68
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.63
3luf_A259 Two-component system response regulator/ggdef doma 99.6
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.57
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.52
1w25_A459 Stalked-cell differentiation controlling protein; 98.93
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.93
2ayx_A254 Sensor kinase protein RCSC; two independent struct 97.11
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 96.93
3tm8_A328 BD1817, uncharacterized protein; HD-GYP, phosphodi 96.83
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 96.21
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 95.69
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 94.6
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 93.21
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 91.53
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 90.42
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 87.36
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 87.03
2l69_A134 Rossmann 2X3 fold protein; structural genomics, no 85.65
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 85.37
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 84.62
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 82.61
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 80.32
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
Probab=99.92  E-value=6.5e-25  Score=198.91  Aligned_cols=119  Identities=30%  Similarity=0.562  Sum_probs=110.3

Q ss_pred             CccEEEEEeCCHHHHHHHHHHHHhCCCe-EEEECCHHHHHHHHHhcCCCceEEEEecCCCCCCHHHHHHHHhc---CCCC
Q 009670           22 IGMRVLAVDDDQTCLKILEKFLRECQYE-VTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGL---EMDL   97 (529)
Q Consensus        22 ~~mrVLIVDDd~~v~~~L~~~Le~~gy~-V~~a~sa~eALe~L~e~~~~pDLVIlDi~MPdmdGleLL~~Ir~---~~~i   97 (529)
                      .++|||||||++.++..++.+|+..||+ |..|.++.+|++.+++..  |||||+|+.||+|||+++++.+|.   .+++
T Consensus        11 k~~rILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~~~~--~DlillD~~MP~mdG~el~~~ir~~~~~~~i   88 (134)
T 3to5_A           11 KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGD--FDFVVTDWNMPGMQGIDLLKNIRADEELKHL   88 (134)
T ss_dssp             TTCCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHHC--CSEEEEESCCSSSCHHHHHHHHHHSTTTTTC
T ss_pred             CCCEEEEEeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHHhCC--CCEEEEcCCCCCCCHHHHHHHHHhCCCCCCC
Confidence            4689999999999999999999999997 668999999999998875  999999999999999999998874   3679


Q ss_pred             cEEEEecCCCHHHHHHHHhcCCcEeEeCCCCHHHHHHHHHHHHHh
Q 009670           98 PVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRR  142 (529)
Q Consensus        98 pVIvlTa~~d~e~v~~al~~GA~DYL~KP~~~eeL~~~l~~vlr~  142 (529)
                      |||++|++.+.+...+++++||+|||.|||+.++|..+++++++|
T Consensus        89 pvI~lTa~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~R  133 (134)
T 3to5_A           89 PVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER  133 (134)
T ss_dssp             CEEEEESSCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHCC-
T ss_pred             eEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999988754
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3tm8_A BD1817, uncharacterized protein; HD-GYP, phosphodiesterase, unknown function, hydrolase,signa protein; 1.28A {Bdellovibrio bacteriovorus} PDB: 3tmb_A 3tmc_A 3tmd_A Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>2l69_A Rossmann 2X3 fold protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Artificial gene} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 529
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 6e-29
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 4e-28
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 8e-27
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 9e-27
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 2e-26
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 3e-26
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 8e-26
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 2e-25
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 7e-25
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 7e-25
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 2e-24
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 2e-24
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 2e-24
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 4e-24
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 6e-24
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 8e-24
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 2e-23
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 3e-23
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 3e-23
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 3e-23
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 4e-23
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 8e-23
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 9e-23
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 1e-22
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 2e-22
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 4e-22
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 1e-21
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 1e-21
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 2e-21
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 3e-21
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 1e-20
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 5e-20
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 6e-20
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 2e-19
d1qo0d_189 c.23.1.3 (D:) Positive regulator of the amidase op 4e-16
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: Sporulation response regulator Spo0A
species: Bacillus stearothermophilus [TaxId: 1422]

 Score =  108 bits (272), Expect = 6e-29
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 24  MRVLAVDDDQTCLKILEKFLRE--CQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPD 81
           ++V   DD++  + +L++++        +         L+ML E R   D+++ D+ MP 
Sbjct: 2   IKVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEKR--PDILLLDIIMPH 59

Query: 82  MDGFKLLELV--GLEMDLPVVMLSAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHV 139
           +DG  +LE +  G E    V+ML+A+    +  K +  GA  ++LKP  ME L +  + V
Sbjct: 60  LDGLAVLERIRAGFEHQPNVIMLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQV 119

Query: 140 IRR 142
             +
Sbjct: 120 YGK 122
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query529
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.93
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.92
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.92
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.92
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.92
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.92
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.92
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.92
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.92
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.91
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.91
d1s8na_190 Probable two-component system transcriptional regu 99.91
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.91
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.91
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.91
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.91
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.9
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.9
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.9
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.9
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.9
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.9
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.89
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.89
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.89
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.89
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.89
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.88
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.88
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.88
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.88
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.85
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.83
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.82
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.37
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 89.56
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 88.73
d1r8ja2135 N-terminal domain of the circadian clock protein K 81.64
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 81.45
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 81.27
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: PhoP receiver domain
species: Escherichia coli [TaxId: 562]

Probab=99.93  E-value=2.6e-25  Score=194.92  Aligned_cols=117  Identities=30%  Similarity=0.424  Sum_probs=111.7

Q ss_pred             cEEEEEeCCHHHHHHHHHHHHhCCCeEEEECCHHHHHHHHHhcCCCceEEEEecCCCCCCHHHHHHHHhc-CCCCcEEEE
Q 009670           24 MRVLAVDDDQTCLKILEKFLRECQYEVTVTNRAITALKMLRENRNNFDLVISDVYMPDMDGFKLLELVGL-EMDLPVVML  102 (529)
Q Consensus        24 mrVLIVDDd~~v~~~L~~~Le~~gy~V~~a~sa~eALe~L~e~~~~pDLVIlDi~MPdmdGleLL~~Ir~-~~~ipVIvl  102 (529)
                      ||||||||++.++..++.+|+..||+|..+.++.+|++++++..  ||+||+|+.||++||+++++.++. .+.+|||++
T Consensus         1 mrILvVDDd~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~~~--~dliilD~~mP~~~G~e~~~~i~~~~~~~pvi~l   78 (119)
T d2pl1a1           1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHI--PDIAIVDLGLPDEDGLSLIRRWRSNDVSLPILVL   78 (119)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHSC--CSEEEECSCCSSSCHHHHHHHHHHTTCCSCEEEE
T ss_pred             CEEEEEeCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHhcc--cceeehhccCCCchhHHHHHHHHhcCcccceEee
Confidence            79999999999999999999999999999999999999999865  999999999999999999998864 578999999


Q ss_pred             ecCCCHHHHHHHHhcCCcEeEeCCCCHHHHHHHHHHHHHh
Q 009670          103 SAYSDTKLVMKGINHGACDYLLKPVRMEELKNTWQHVIRR  142 (529)
Q Consensus       103 Ta~~d~e~v~~al~~GA~DYL~KP~~~eeL~~~l~~vlr~  142 (529)
                      |++.+.+...+++++||+|||.||++.++|..+++++++|
T Consensus        79 t~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lrR  118 (119)
T d2pl1a1          79 TARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRR  118 (119)
T ss_dssp             ESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHH
T ss_pred             eccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHHHcc
Confidence            9999999999999999999999999999999999999875
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure