Citrus Sinensis ID: 010331

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510---
MASIALSASAALLPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFISFAASNSSGRNGDLVVTSEDESASQTYTWPDKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSELERRNFERLEEKGIVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLTKVLSSS
ccccccccccEEEcccccccccccccccccccccccccccccccEEEEEcccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHHHHcccccccccEEEEEcccccccccccHHHHHcccccccccHHHHHHHHcccccEEEEEEEEEEcccccEEEccccccccccEEEccccEEEcccEEEEEccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccccEEcccEEEEEEccccHHHHHHHHHHHccccEEEEEEEEccccccccccHHHHHHHHHHHHHcccEEEccccEEEEEccEEEEccEEEEccEEEEEcccccccccccccccccccccccccccEEEcccccccccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEEccccEEEcccccccEEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHEEEcccccccc
ccHHHHHccHHHHHHHHHccccccccccccHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccccccccEEEEEEccccccHcHHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEEEcccHcccEEEEcccccccccEEEEccccEEcccEEEEEEcccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHcEEEEEccccHHHHHHHHHHHHHHHccHHHHHEHHHccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEccccEEccccEEcccEEEEEccccccccccccHHHHHcccccccccEEEEcccccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEEccccEEEEcccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccHHcccc
MASIALSASAAllplkrnsgawsklfpfssksylsfktcrKNRFIsfaasnssgrngdlvvtsedesasqtytwpdkkkpricilgggfgGLYTALRLEslvwqddkkpqvllvdqserfvfKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVkllcpsdhlgvngpmacthggtvllesgliveYDWLVlslgaepkldvvpgaaefafpfstledaCRVDRKLSELERRNFERLEEKGIVQAINVEtticptgtpgnrEAALKVLSARKVQLVLGYFVRCIRRVGefeasvkqpesgaipniaadknsdkYILELQPAIKGLESQIFEADLVLWtvgskpllphveppnnrlhdlplnargqaetdetlcvkghprifalgdssalrdssgrplpatAQVAFQQADFAGWnlwaaindrpllpfrfQNLGEMMILgrndaavspsfvegvtldgpighsARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLTKVLSSS
MASIALSASAALLPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFIsfaasnssgrngdLVVTSEDESasqtytwpdkkkprICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFafpfstledacRVDRKLSElerrnferleekgivqainvetticptgtpgNREAALKVLSARKVQLVLGYFVRCIRRVGEfeasvkqpesgaipniaadknsDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLTKVLSSS
MasialsasaallPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFISFAASNSSGRNGDLVVTSEDESASQTYTWPDKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKlselerrnferleeKGIVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLTKVLSSS
***********LLPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFISFA***********************YTWPDKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSELERRNFERLEEKGIVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEAS***********I****NSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPH***********************TLCVKGHPRIFAL****************TAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTL*******
********SAALLPL************************RKNRF*************************************ICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSELERRNF*******IVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRR***************IPNIAADKNSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQ***T******
MASIALSASAALLPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFISFAASN**********************WPDKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSELERRNFERLEEKGIVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQST********
*********AALLPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFISFAASNS***********************DKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSELERRNFERLEEKGIVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLT******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIALSASAALLPLKRNSGAWSKLFPFSSKSYLSFKTCRKNRFISFAASNSSGRNGDLVVTSEDESASQTYTWPDKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSELERRNFERLEEKGIVQAINVETTICPTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLTKVLSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query513 2.2.26 [Sep-21-2011]
Q8GXR9519 NADH dehydrogenase C1, ch yes no 0.869 0.859 0.662 0.0
O05267406 NADH dehydrogenase-like p yes no 0.664 0.839 0.268 7e-17
Q4L4V6402 NADH dehydrogenase-like p yes no 0.656 0.838 0.238 1e-11
Q49W80402 NADH dehydrogenase-like p yes no 0.621 0.793 0.232 2e-11
Q5HQM1402 NADH dehydrogenase-like p yes no 0.645 0.823 0.24 3e-11
O80874508 Alternative NAD(P)H dehyd no no 0.752 0.759 0.240 7e-11
Q8CPV5402 NADH dehydrogenase-like p yes no 0.645 0.823 0.237 1e-10
P44856444 NADH dehydrogenase OS=Hae yes no 0.625 0.722 0.231 2e-10
Q8NXG0402 NADH dehydrogenase-like p yes no 0.703 0.898 0.218 1e-09
Q6GAY5402 NADH dehydrogenase-like p yes no 0.703 0.898 0.218 1e-09
>sp|Q8GXR9|DHNA_ARATH NADH dehydrogenase C1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=NDC1 PE=1 SV=2 Back     alignment and function desciption
 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/495 (66%), Positives = 380/495 (76%), Gaps = 49/495 (9%)

Query: 44  FISFAASNSSGRNGDLVVTSEDESASQTYTWPDKKKPRICILGGGFGGLYTALRLESLVW 103
           ++S A +N+SG        S++E+A +TY+WPD K+PR+CILGGGFGGLYTALRLESLVW
Sbjct: 49  YLSRAVTNNSGTTE----ISDNETAPRTYSWPDNKRPRVCILGGGFGGLYTALRLESLVW 104

Query: 104 QDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLC 163
            +DKKPQV+LVDQSERFVFKPMLYELLSGEVD WEIAPRF+DLL NTG+QF +DRVK L 
Sbjct: 105 PEDKKPQVVLVDQSERFVFKPMLYELLSGEVDVWEIAPRFSDLLTNTGIQFLRDRVKTLL 164

Query: 164 PSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLED 223
           P DHLGVNG      GGTVLLESG  +EYDWLVL+LGAE KLDVVPGA E AFPF TLED
Sbjct: 165 PCDHLGVNGSEISVTGGTVLLESGFKIEYDWLVLALGAESKLDVVPGAMELAFPFYTLED 224

Query: 224 ACRVDRKLSELERRNF-------------------------ERLEEKGIVQAINVETTIC 258
           A RV+ KLS+LER+NF                         ERL+++GIVQ+INV   I 
Sbjct: 225 AIRVNEKLSKLERKNFKDGSAIKVAVVGCGYAGVELAATISERLQDRGIVQSINVSKNIL 284

Query: 259 PTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDK 318
            +   GNREAA+KVL++RKVQL+LGY V+ I+R    E                    + 
Sbjct: 285 TSAPDGNREAAMKVLTSRKVQLLLGYLVQSIKRASNLE------------------EDEG 326

Query: 319 YILELQPAIKGLESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLC 378
           Y LELQPA +GLESQI EAD+VLWTVG+KPLL  +EP    +  LPLNARGQAETDETL 
Sbjct: 327 YFLELQPAERGLESQIIEADIVLWTVGAKPLLTKLEPSGPNV--LPLNARGQAETDETLR 384

Query: 379 VKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLG 438
           VKGHPRIFALGDSS+LRDS+G+ LP TAQVAFQ+ADF GWN+WAAIN+RPLLPFRFQNLG
Sbjct: 385 VKGHPRIFALGDSSSLRDSNGKILPTTAQVAFQEADFTGWNIWAAINNRPLLPFRFQNLG 444

Query: 439 EMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDS 498
           EMM LGR DAA+SPSF+EG+TL+GPIGH+ARKLAYLIRLPTDEHR KVG+SW  KSA+DS
Sbjct: 445 EMMTLGRYDAAISPSFIEGLTLEGPIGHAARKLAYLIRLPTDEHRFKVGISWFAKSAVDS 504

Query: 499 VALLQSTLTKVLSSS 513
           +ALLQS LTKVLS S
Sbjct: 505 IALLQSNLTKVLSGS 519
Involved in an elecron flow toward the plastoglobule plastoquinone pool. Required for plastochromanol-8 accumulation and for phylloquinone (vitamin K1) production.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: -EC: .EC: -
>sp|O05267|YUMB_BACSU NADH dehydrogenase-like protein YumB OS=Bacillus subtilis (strain 168) GN=yumB PE=3 SV=1 Back     alignment and function description
>sp|Q4L4V6|Y2010_STAHJ NADH dehydrogenase-like protein SH2010 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2010 PE=3 SV=1 Back     alignment and function description
>sp|Q49W80|Y1834_STAS1 NADH dehydrogenase-like protein SSP1834 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1834 PE=3 SV=1 Back     alignment and function description
>sp|Q5HQM1|Y527_STAEQ NADH dehydrogenase-like protein SERP0527 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP0527 PE=3 SV=1 Back     alignment and function description
>sp|O80874|NDA2_ARATH Alternative NAD(P)H dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=NDA2 PE=1 SV=1 Back     alignment and function description
>sp|Q8CPV5|Y635_STAES NADH dehydrogenase-like protein SE_0635 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_0635 PE=3 SV=1 Back     alignment and function description
>sp|P44856|DHNA_HAEIN NADH dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ndh PE=3 SV=1 Back     alignment and function description
>sp|Q8NXG0|Y823_STAAW NADH dehydrogenase-like protein MW0823 OS=Staphylococcus aureus (strain MW2) GN=MW0823 PE=3 SV=1 Back     alignment and function description
>sp|Q6GAY5|Y811_STAAS NADH dehydrogenase-like protein SAS0811 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0811 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
359480765543 PREDICTED: NADH dehydrogenase C1, chloro 0.998 0.942 0.704 0.0
296082616526 unnamed protein product [Vitis vinifera] 0.964 0.941 0.693 0.0
255574196536 NADH dehydrogenase, putative [Ricinus co 0.992 0.949 0.690 0.0
224093652553 predicted protein [Populus trichocarpa] 0.925 0.858 0.676 0.0
147790504504 hypothetical protein VITISV_003541 [Viti 0.927 0.944 0.656 0.0
356512870544 PREDICTED: NADH dehydrogenase C1, chloro 0.994 0.937 0.658 0.0
449457355542 PREDICTED: NADH dehydrogenase C1, chloro 0.988 0.935 0.644 0.0
449480895542 PREDICTED: NADH dehydrogenase C1, chloro 0.988 0.935 0.642 0.0
297810995519 hypothetical protein ARALYDRAFT_908854 [ 0.867 0.857 0.669 0.0
147641610519 RecName: Full=NADH dehydrogenase C1, chl 0.869 0.859 0.662 0.0
>gi|359480765|ref|XP_002273522.2| PREDICTED: NADH dehydrogenase C1, chloroplastic/mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/544 (70%), Positives = 435/544 (79%), Gaps = 32/544 (5%)

Query: 1   MASIALSASAALLPLKRNSG---AWSKLFPFSSKSY---LSFKTCRKNRFISFAASNSSG 54
           MA +ALSAS  L    R SG    W  LFP SS+     +S     +++  SF AS ++ 
Sbjct: 1   MAQMALSASPTLTLFNRVSGRSKQWGMLFPGSSRKLAINMSILMNFQSKGFSFVASGATQ 60

Query: 55  RNGDLVVTSEDESASQTYTWPDKKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLV 114
            NG +    E E+AS+ YTWPDKKKPR+CILGGGFGGLYTALRLESLVW +DKKPQVLLV
Sbjct: 61  WNGGVAELVEGEAASRPYTWPDKKKPRVCILGGGFGGLYTALRLESLVWPEDKKPQVLLV 120

Query: 115 DQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPM 174
           DQSERFVFKPMLYELL+GEVDAWEIAPRF+DLLANTGVQFF+DRVK+L PSDHLG+NGP 
Sbjct: 121 DQSERFVFKPMLYELLTGEVDAWEIAPRFSDLLANTGVQFFQDRVKVLHPSDHLGMNGPT 180

Query: 175 ACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLSEL 234
             + GGTV LESGL++EYDWLVL+LGAE KLDVVPGAAEFA PFSTLEDACRVD +L  L
Sbjct: 181 VSSCGGTVHLESGLVIEYDWLVLALGAEAKLDVVPGAAEFALPFSTLEDACRVDNRLRTL 240

Query: 235 ERRNF-------------------------ERLEEKGIVQAINVETTICPTGTPGNREAA 269
           ER+ F                         ERL++KGIVQAINVETTICPT  PGNREAA
Sbjct: 241 ERKRFGRDFPIRVAVVGCGYSGVELAATVSERLQDKGIVQAINVETTICPTAPPGNREAA 300

Query: 270 LKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKG 329
           LKVLS+R V+L+LG+FVRCIR+    E S KQ ESG + + AA+   +K ILELQPA +G
Sbjct: 301 LKVLSSRNVELLLGFFVRCIRKASISEVSEKQTESGTLLDAAAEHEPEKLILELQPAERG 360

Query: 330 LESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALG 389
           L+SQI EADL+LWTVGSKP LP +E P    H+LPLNARGQAETDETL VKGHPRIFA+G
Sbjct: 361 LQSQILEADLILWTVGSKPQLPQLE-PCEWPHELPLNARGQAETDETLRVKGHPRIFAVG 419

Query: 390 DSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAA 449
           DSS+LRDS G+ LPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMM LGRNDAA
Sbjct: 420 DSSSLRDSKGKLLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMTLGRNDAA 479

Query: 450 VSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAIDSVALLQSTLTKV 509
           +SPSF+EG+TL+GPIGH+ARKLAYLIRLPTDEHRLKVG+SWLTKSAIDSVA +QS++ KV
Sbjct: 480 ISPSFIEGLTLEGPIGHAARKLAYLIRLPTDEHRLKVGISWLTKSAIDSVAAVQSSVIKV 539

Query: 510 LSSS 513
           LS S
Sbjct: 540 LSGS 543

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296082616|emb|CBI21621.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574196|ref|XP_002528013.1| NADH dehydrogenase, putative [Ricinus communis] gi|223532582|gb|EEF34369.1| NADH dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224093652|ref|XP_002309949.1| predicted protein [Populus trichocarpa] gi|222852852|gb|EEE90399.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147790504|emb|CAN61189.1| hypothetical protein VITISV_003541 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512870|ref|XP_003525138.1| PREDICTED: NADH dehydrogenase C1, chloroplastic/mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|449457355|ref|XP_004146414.1| PREDICTED: NADH dehydrogenase C1, chloroplastic/mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449480895|ref|XP_004156024.1| PREDICTED: NADH dehydrogenase C1, chloroplastic/mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297810995|ref|XP_002873381.1| hypothetical protein ARALYDRAFT_908854 [Arabidopsis lyrata subsp. lyrata] gi|297319218|gb|EFH49640.1| hypothetical protein ARALYDRAFT_908854 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147641610|sp|Q8GXR9.2|DHNA_ARATH RecName: Full=NADH dehydrogenase C1, chloroplastic/mitochondrial; Flags: Precursor Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query513
TIGR_CMR|SO_3517429 SO_3517 "NADH dehydrogenase" [ 0.220 0.263 0.313 5.5e-15
TIGR_CMR|GSU_0493419 GSU_0493 "pyridine nucleotide- 0.237 0.291 0.333 7.5e-14
UNIPROTKB|Q81XC7392 BAS4935 "Pyridine nucleotide-d 0.171 0.224 0.382 3.4e-13
TIGR_CMR|BA_5313392 BA_5313 "pyridine nucleotide-d 0.171 0.224 0.382 3.4e-13
UNIPROTKB|Q81XS1403 BAS4796 "Pyridine nucleotide-d 0.218 0.277 0.268 3.9e-12
TIGR_CMR|BA_5159403 BA_5159 "pyridine nucleotide-d 0.218 0.277 0.268 3.9e-12
UNIPROTKB|P00393434 ndh [Escherichia coli K-12 (ta 0.701 0.829 0.240 3.1e-10
TAIR|locus:2045708508 NDA2 "AT2G29990" [Arabidopsis 0.350 0.354 0.289 4e-10
ASPGD|ASPL0000028441516 ndiA [Emericella nidulans (tax 0.288 0.286 0.283 1.4e-09
TAIR|locus:2007427510 NDA1 "AT1G07180" [Arabidopsis 0.255 0.256 0.294 1.8e-09
TIGR_CMR|SO_3517 SO_3517 "NADH dehydrogenase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 139 (54.0 bits), Expect = 5.5e-15, Sum P(2) = 5.5e-15
 Identities = 37/118 (31%), Positives = 56/118 (47%)

Query:   331 ESQIFEADLVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGD 390
             +  + +A L +W  G K   P           LP+  R Q E D  + VKG   I+A+GD
Sbjct:   256 DGDMIKASLKVWAAGVKG--PKAF---QNFSKLPITPRNQVEVDACMRVKGQQDIYAIGD 310

Query:   391 SSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDA 448
              + L   SG+P+P  AQ A Q AD    N+   +  +   PF +++ G ++ L R  A
Sbjct:   311 CALLILDSGQPVPPRAQAAAQMADTLYENIVNRLQGKVEKPFVYKDYGSLVSLSRFSA 368
GO:0003954 "NADH dehydrogenase activity" evidence=ISS
TIGR_CMR|GSU_0493 GSU_0493 "pyridine nucleotide-disulphide oxidoreductase family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q81XC7 BAS4935 "Pyridine nucleotide-disulphide oxidoreductase" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5313 BA_5313 "pyridine nucleotide-disulphide oxidoreductase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q81XS1 BAS4796 "Pyridine nucleotide-disulphide oxidoreductase" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5159 BA_5159 "pyridine nucleotide-disulphide oxidoreductase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P00393 ndh [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TAIR|locus:2045708 NDA2 "AT2G29990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000028441 ndiA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2007427 NDA1 "AT1G07180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GXR9DHNA_ARATH1, ., 6, ., -, ., -0.66260.86930.8593yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00019273001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (642 aa)
(Vitis vinifera)
Predicted Functional Partners:
ndhJ
NADH dehydrogenase subunit J ; NDH shuttles electrons from NAD(P)H-plastoquinone, via FMN and i [...] (158 aa)
      • 0.463
GSVIVG00029202001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (297 aa)
•  •  • 0.437
GSVIVG00023910001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (216 aa)
   •  • 0.424
GSVIVG00015518001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (99 aa)
      • 0.408
GSVIVG00035617001
SubName- Full=Chromosome undetermined scaffold_79, whole genome shotgun sequence; (403 aa)
      • 0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 5e-74
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 5e-21
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 9e-16
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 3e-11
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 6e-08
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 5e-04
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information 
 Score =  239 bits (612), Expect = 5e-74
 Identities = 129/455 (28%), Positives = 190/455 (41%), Gaps = 100/455 (21%)

Query: 79  KPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWE 138
           K RI ILGGGFGGL  A RL     +     ++ LVD+ +  +F P+LYE+ +G +   E
Sbjct: 3   KKRIVILGGGFGGLSAAKRLA----RKLPDVEITLVDRRDYHLFTPLLYEVATGTLSESE 58

Query: 139 IAPRFADLLA-NTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVL 197
           IA     LL  +  VQF +  V          ++          V L     + YD+LV+
Sbjct: 59  IAIPLRALLRKSGNVQFVQGEVT--------DID-----RDAKKVTLADLGEISYDYLVV 105

Query: 198 SLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKL-SELERRNFERLEEK----------- 245
           +LG+E     +PGAAE+AF   TLEDA R+ R L    E+ + E  +             
Sbjct: 106 ALGSETNYFGIPGAAEYAFGLKTLEDALRLRRHLLEAFEKASQEEDDRALLTIVIVGGGP 165

Query: 246 -GI-------------------------VQAINVETTICPTGTPGNREAALKVLSARKVQ 279
            G+                         V  +     I P   P   + A + L    V+
Sbjct: 166 TGVELAGELAERLHRLLKKFRVDPSELRVILVEAGPRILPMFPPKLSKYAERALEKLGVE 225

Query: 280 LVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADL 339
           ++LG               V +     +      K+ ++ I                AD 
Sbjct: 226 VLLG-------------TPVTEVTPDGVTL----KDGEEEI---------------PADT 253

Query: 340 VLWTVGSKPLLPHVEPPNNR-LHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSS 398
           V+W  G +        P  + L  L  + RG+   + TL V GHP IFA GD +A+ D  
Sbjct: 254 VVWAAGVRA------SPLLKDLSGLETDRRGRLVVNPTLQVPGHPDIFAAGDCAAVID-- 305

Query: 399 GRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNLGEMMILGRNDAAVSPSFVEGV 458
            RP+P TAQ A QQ ++A  N+ A +  +PL PF++++ G +  LG   A      + GV
Sbjct: 306 PRPVPPTAQAAHQQGEYAAKNIKARLKGKPLKPFKYKDKGTLASLGDFSAVAD---LGGV 362

Query: 459 TLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTK 493
            L G +    ++ AYL  L     RL V + WLT 
Sbjct: 363 KLKGFLAWLLKRAAYLYYLLGIRSRLAVALYWLTT 397

Length = 405
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 513
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
PLN02507499 glutathione reductase 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.98
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.98
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.98
TIGR02053463 MerA mercuric reductase. This model represents the 99.97
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.97
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.97
PLN02546558 glutathione reductase 99.97
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.97
PRK06370463 mercuric reductase; Validated 99.97
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.97
PRK14694468 putative mercuric reductase; Provisional 99.97
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.97
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.97
PRK07846451 mycothione reductase; Reviewed 99.97
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.97
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.97
PTZ00058561 glutathione reductase; Provisional 99.97
PRK05976472 dihydrolipoamide dehydrogenase; Validated 99.97
PRK13748561 putative mercuric reductase; Provisional 99.97
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.97
PRK14727479 putative mercuric reductase; Provisional 99.97
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.97
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.97
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.97
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.96
PRK10262321 thioredoxin reductase; Provisional 99.96
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.96
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.96
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.96
PTZ00052499 thioredoxin reductase; Provisional 99.96
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.96
PTZ00153659 lipoamide dehydrogenase; Provisional 99.96
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.96
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 99.96
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.96
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.95
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.95
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.95
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.95
PRK12831464 putative oxidoreductase; Provisional 99.95
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.94
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.94
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.94
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.94
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.94
PRK12814652 putative NADPH-dependent glutamate synthase small 99.93
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.93
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.93
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.92
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 99.91
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.91
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.9
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.9
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.9
PRK13984604 putative oxidoreductase; Provisional 99.9
KOG4716503 consensus Thioredoxin reductase [Posttranslational 99.89
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.89
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.89
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 99.88
PLN02852491 ferredoxin-NADP+ reductase 99.88
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.87
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.85
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.83
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.78
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.73
KOG2755334 consensus Oxidoreductase [General function predict 99.67
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.65
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.64
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.6
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.52
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.49
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.4
PTZ00188506 adrenodoxin reductase; Provisional 99.38
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.31
COG2081408 Predicted flavoproteins [General function predicti 99.03
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.01
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.0
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.99
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 98.98
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.94
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.91
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.88
PLN02463447 lycopene beta cyclase 98.83
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.8
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.79
COG4529474 Uncharacterized protein conserved in bacteria [Fun 98.77
PRK08401466 L-aspartate oxidase; Provisional 98.75
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.61
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.6
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.59
PRK06847375 hypothetical protein; Provisional 98.58
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.57
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.55
COG0579429 Predicted dehydrogenase [General function predicti 98.54
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.54
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.53
PRK07804541 L-aspartate oxidase; Provisional 98.52
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.52
PLN02697529 lycopene epsilon cyclase 98.51
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.5
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.5
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.49
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.49
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.49
PRK08275554 putative oxidoreductase; Provisional 98.48
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.48
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.48
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.47
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.46
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.46
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 98.46
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.45
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.45
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.45
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.44
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.43
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.42
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.41
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.41
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.4
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.4
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.4
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.4
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.4
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.39
PLN02661357 Putative thiazole synthesis 98.39
PRK06184502 hypothetical protein; Provisional 98.39
PRK10157428 putative oxidoreductase FixC; Provisional 98.39
PRK06834488 hypothetical protein; Provisional 98.38
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.37
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.36
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.36
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.36
PRK08071510 L-aspartate oxidase; Provisional 98.36
PRK10015429 oxidoreductase; Provisional 98.36
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.36
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.35
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 98.33
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.33
PRK08163396 salicylate hydroxylase; Provisional 98.33
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.33
PRK09077536 L-aspartate oxidase; Provisional 98.33
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.32
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.32
PRK07190487 hypothetical protein; Provisional 98.32
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.31
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.31
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.31
PRK09126392 hypothetical protein; Provisional 98.31
PRK11728393 hydroxyglutarate oxidase; Provisional 98.29
PRK13512438 coenzyme A disulfide reductase; Provisional 98.29
PRK07236386 hypothetical protein; Provisional 98.29
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.29
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.29
PRK06126 545 hypothetical protein; Provisional 98.28
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.28
PRK08244493 hypothetical protein; Provisional 98.28
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.27
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.27
PRK06116450 glutathione reductase; Validated 98.27
PRK07045388 putative monooxygenase; Reviewed 98.26
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.25
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.25
PRK09897 534 hypothetical protein; Provisional 98.25
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.24
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.24
PRK05868372 hypothetical protein; Validated 98.24
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.23
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 98.23
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.23
PRK06370463 mercuric reductase; Validated 98.23
PRK08013400 oxidoreductase; Provisional 98.23
PRK06996398 hypothetical protein; Provisional 98.23
PRK07588391 hypothetical protein; Provisional 98.22
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.21
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 98.21
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.2
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.2
PRK05257494 malate:quinone oxidoreductase; Validated 98.2
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.19
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.19
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.19
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.19
PRK06753373 hypothetical protein; Provisional 98.19
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.19
TIGR02053463 MerA mercuric reductase. This model represents the 98.19
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.19
PRK07846451 mycothione reductase; Reviewed 98.19
PLN02507499 glutathione reductase 98.18
PRK06185407 hypothetical protein; Provisional 98.18
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.18
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.17
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.17
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.17
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.16
PRK14694468 putative mercuric reductase; Provisional 98.16
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.16
PRK07512513 L-aspartate oxidase; Provisional 98.16
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.16
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.15
PRK11445351 putative oxidoreductase; Provisional 98.14
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.14
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.14
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.12
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.12
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.11
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.11
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.11
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.11
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.11
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.1
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.09
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.08
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.08
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.07
PTZ00052499 thioredoxin reductase; Provisional 98.06
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.06
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.04
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.03
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.03
PTZ00058561 glutathione reductase; Provisional 98.03
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.02
PRK13748561 putative mercuric reductase; Provisional 98.02
PRK14727479 putative mercuric reductase; Provisional 98.01
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.01
PRK06475400 salicylate hydroxylase; Provisional 98.0
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.0
PLN02985514 squalene monooxygenase 97.99
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.97
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 97.93
PRK10262321 thioredoxin reductase; Provisional 97.93
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.92
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.92
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.91
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.9
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.9
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.88
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 97.88
PLN02546558 glutathione reductase 97.86
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.85
PTZ00153659 lipoamide dehydrogenase; Provisional 97.83
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 97.83
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.81
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 97.8
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 97.8
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.78
KOG2853509 consensus Possible oxidoreductase [General functio 97.77
PTZ00367 567 squalene epoxidase; Provisional 97.76
PLN02612567 phytoene desaturase 97.76
PRK06175433 L-aspartate oxidase; Provisional 97.67
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.64
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.62
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.62
PRK08294 634 phenol 2-monooxygenase; Provisional 97.62
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 97.59
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 97.59
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.59
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 97.54
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.48
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.46
COG3349485 Uncharacterized conserved protein [Function unknow 97.44
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 97.44
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.44
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.43
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.43
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.39
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 97.39
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.38
PRK12831464 putative oxidoreductase; Provisional 97.36
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.35
PLN02268435 probable polyamine oxidase 97.35
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.31
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.31
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 97.3
PRK07208479 hypothetical protein; Provisional 97.29
PRK12416463 protoporphyrinogen oxidase; Provisional 97.24
PLN02576496 protoporphyrinogen oxidase 97.24
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.22
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.22
PRK07233434 hypothetical protein; Provisional 97.21
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.19
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.18
PRK07538413 hypothetical protein; Provisional 97.17
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.13
KOG2852380 consensus Possible oxidoreductase [General functio 97.13
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.12
PLN02529 738 lysine-specific histone demethylase 1 97.09
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.08
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.08
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.07
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.03
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.02
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.0
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.99
KOG1298509 consensus Squalene monooxygenase [Lipid transport 96.97
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 96.95
PRK08274466 tricarballylate dehydrogenase; Validated 96.95
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 96.95
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 96.91
PLN02328 808 lysine-specific histone demethylase 1 homolog 96.89
PRK07121492 hypothetical protein; Validated 96.86
PLN02568 539 polyamine oxidase 96.86
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.85
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.8
PLN02676487 polyamine oxidase 96.8
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 96.78
PLN02487569 zeta-carotene desaturase 96.77
PRK12842 574 putative succinate dehydrogenase; Reviewed 96.76
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 96.72
TIGR02730493 carot_isom carotene isomerase. Members of this fam 96.72
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 96.69
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.65
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 96.62
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 96.6
PRK12814652 putative NADPH-dependent glutamate synthase small 96.58
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 96.57
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 96.55
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.54
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.53
PLN02464 627 glycerol-3-phosphate dehydrogenase 96.53
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.52
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 96.5
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 96.49
PRK12779944 putative bifunctional glutamate synthase subunit b 96.43
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 96.42
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 96.41
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.34
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 96.31
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.3
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 96.26
PRK12839 572 hypothetical protein; Provisional 96.23
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.22
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.21
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.2
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.18
PRK02106 560 choline dehydrogenase; Validated 96.16
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.12
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 96.05
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.04
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.04
PLN02815594 L-aspartate oxidase 96.01
PRK13984604 putative oxidoreductase; Provisional 96.01
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 95.99
PLN03000 881 amine oxidase 95.93
PRK07395 553 L-aspartate oxidase; Provisional 95.9
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 95.88
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 95.83
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 95.82
KOG2960328 consensus Protein involved in thiamine biosynthesi 95.81
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 95.75
COG2081408 Predicted flavoproteins [General function predicti 95.71
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 95.65
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 95.65
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 95.57
COG3573 552 Predicted oxidoreductase [General function predict 95.54
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 95.49
PLN02976 1713 amine oxidase 95.49
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 95.43
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.34
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 95.32
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 95.31
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 95.17
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.15
PRK12771564 putative glutamate synthase (NADPH) small subunit; 95.03
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 95.03
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 94.78
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.67
PLN02785 587 Protein HOTHEAD 94.48
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 94.27
PRK05562223 precorrin-2 dehydrogenase; Provisional 94.04
PRK06719157 precorrin-2 dehydrogenase; Validated 93.8
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 93.65
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 93.46
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 93.29
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.25
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 93.18
KOG4716503 consensus Thioredoxin reductase [Posttranslational 93.07
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.88
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.65
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 92.62
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 92.57
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 91.95
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 91.85
PRK06847375 hypothetical protein; Provisional 91.54
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 91.44
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.43
PRK04148134 hypothetical protein; Provisional 91.41
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 90.86
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 90.7
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 90.55
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 90.43
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 90.43
PRK10669558 putative cation:proton antiport protein; Provision 90.42
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 90.01
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 89.94
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 89.9
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 89.74
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 89.57
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 89.37
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 89.31
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 88.86
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 88.8
PRK06834 488 hypothetical protein; Provisional 88.71
PRK09496453 trkA potassium transporter peripheral membrane com 88.03
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 88.0
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 87.93
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 87.89
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 87.2
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 87.11
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 87.02
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 86.98
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 86.96
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.95
PRK03659601 glutathione-regulated potassium-efflux system prot 86.94
PRK065671028 putative bifunctional glutamate synthase subunit b 86.91
PF01134392 GIDA: Glucose inhibited division protein A; InterP 86.9
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.84
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 86.82
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 86.68
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 86.67
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.63
TIGR00275400 flavoprotein, HI0933 family. The model when search 86.58
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 86.56
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 86.19
PRK03562621 glutathione-regulated potassium-efflux system prot 86.16
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 86.05
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 86.01
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 85.9
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.85
cd01483143 E1_enzyme_family Superfamily of activating enzymes 85.72
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 85.57
PRK00536262 speE spermidine synthase; Provisional 85.3
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.19
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 85.11
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 85.07
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 85.04
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 84.81
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 84.79
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 84.77
PRK11728393 hydroxyglutarate oxidase; Provisional 84.61
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 84.5
COG0281432 SfcA Malic enzyme [Energy production and conversio 84.45
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 84.44
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 84.4
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 84.34
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 84.06
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 84.05
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 84.0
PRK08229341 2-dehydropantoate 2-reductase; Provisional 83.97
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 83.82
PRK08306296 dipicolinate synthase subunit A; Reviewed 83.72
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 83.68
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 83.62
PTZ00082321 L-lactate dehydrogenase; Provisional 83.51
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 83.47
PRK12549284 shikimate 5-dehydrogenase; Reviewed 83.37
PRK09126392 hypothetical protein; Provisional 83.25
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 83.15
PRK07190 487 hypothetical protein; Provisional 83.14
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 83.1
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 83.08
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 83.08
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 83.07
PRK06249313 2-dehydropantoate 2-reductase; Provisional 82.93
PLN02353473 probable UDP-glucose 6-dehydrogenase 82.9
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 82.87
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 82.79
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 82.74
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 82.65
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 82.61
PRK12842574 putative succinate dehydrogenase; Reviewed 82.43
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 82.32
PRK08163396 salicylate hydroxylase; Provisional 82.26
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 82.16
KOG0404322 consensus Thioredoxin reductase [Posttranslational 82.12
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 82.11
PRK06184 502 hypothetical protein; Provisional 82.09
PRK06223307 malate dehydrogenase; Reviewed 81.98
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 81.89
TIGR02730493 carot_isom carotene isomerase. Members of this fam 81.83
PLN02572442 UDP-sulfoquinovose synthase 81.65
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 81.62
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 81.6
PRK06849389 hypothetical protein; Provisional 81.47
PRK06175433 L-aspartate oxidase; Provisional 81.46
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=4.1e-62  Score=485.79  Aligned_cols=360  Identities=36%  Similarity=0.552  Sum_probs=321.9

Q ss_pred             CCCeEEEECCCHHHHHHHHHhhhccccCCCCCeEEEEeCCCCcccCCchhhhhhccccCCcchHhHHHHhcCCC-eEEEE
Q 010331           78 KKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLANTG-VQFFK  156 (513)
Q Consensus        78 ~~~~VVIVGgG~AGl~aA~~L~~~~~~~~~~~~V~lIe~~~~~~~~p~~~~~~~g~~~~~~~~~~~~~~~~~~~-v~~~~  156 (513)
                      ++++||||||||||+.+|..|.+..    ++++|||||++++|.|+|++++++.|.++++++..++++++++.+ ++|++
T Consensus         2 ~~~~iVIlGgGfgGl~~a~~l~~~~----~~~~itLVd~~~~hl~~plL~eva~g~l~~~~i~~p~~~~~~~~~~v~~~~   77 (405)
T COG1252           2 MKKRIVILGGGFGGLSAAKRLARKL----PDVEITLVDRRDYHLFTPLLYEVATGTLSESEIAIPLRALLRKSGNVQFVQ   77 (405)
T ss_pred             CCceEEEECCcHHHHHHHHHhhhcC----CCCcEEEEeCCCccccchhhhhhhcCCCChhheeccHHHHhcccCceEEEE
Confidence            4689999999999999999999842    268999999999999999999999999999999999999998665 99999


Q ss_pred             EeEEEEeCCCCcCcCCCceeeccceEecCCceEEEecEEEEeCCCCCCCCCCCCccccCCCCCCHHHHHHHHHHHH-HHH
Q 010331          157 DRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTLEDACRVDRKLS-ELE  235 (513)
Q Consensus       157 ~~V~~id~~~~~~~~~~~v~~~~~~v~~~~g~~i~yD~LVlAtGs~~~~~~ipG~~~~~~~~~~~~~a~~l~~~l~-~~~  235 (513)
                      ++|++||++++             +|.++++.+++||+||||+|++++++++||+.||++++++++||.+++.++. .++
T Consensus        78 ~~V~~ID~~~k-------------~V~~~~~~~i~YD~LVvalGs~~~~fgi~G~~E~a~~lks~edA~~ir~~l~~~fe  144 (405)
T COG1252          78 GEVTDIDRDAK-------------KVTLADLGEISYDYLVVALGSETNYFGIPGAAEYAFGLKTLEDALRLRRHLLEAFE  144 (405)
T ss_pred             EEEEEEcccCC-------------EEEeCCCccccccEEEEecCCcCCcCCCCCHHHhCCCCCCHHHHHHHHHHHHHHHH
Confidence            99999999987             5888887789999999999999999999999999999999999999999874 222


Q ss_pred             hhh----------H-------------HHH----H---h-------cCcEEEEeccCeecCCCChhHHHHHHHHHHhCCc
Q 010331          236 RRN----------F-------------ERL----E---E-------KGIVQAINVETTICPTGTPGNREAALKVLSARKV  278 (513)
Q Consensus       236 ~~~----------v-------------~~l----~---~-------~~~vtli~~~~~ll~~~~~~~~~~~~~~l~~~gV  278 (513)
                      ...          +             .+|    .   .       .-+|++++..+++||.+++.+++++++.|+++||
T Consensus       145 ~a~~~~~~~~~lti~IvGgG~TGVElAgeL~~~~~~l~~~~~~~~~~~~V~LVea~p~ILp~~~~~l~~~a~~~L~~~GV  224 (405)
T COG1252         145 KASQEEDDRALLTIVIVGGGPTGVELAGELAERLHRLLKKFRVDPSELRVILVEAGPRILPMFPPKLSKYAERALEKLGV  224 (405)
T ss_pred             HhhccccccceeEEEEECCChhHHHHHHHHHHHHHHHhhhhcCCccccEEEEEccCchhccCCCHHHHHHHHHHHHHCCC
Confidence            111          1             111    1   1       1269999999999999999999999999999999


Q ss_pred             EEEcCceeeEEeccccccccccCCCcccccccccccCCCceEEEecccccCCcce-EEeeceEEEecCCCCCCCCCCCCC
Q 010331          279 QLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQ-IFEADLVLWTVGSKPLLPHVEPPN  357 (513)
Q Consensus       279 ~v~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~~~~g~-~i~aD~vi~a~G~~p~~~~l~~~~  357 (513)
                      +|++++.|+++++                         +++.+.        ++. +|+||++|||+|.+++ ++++.. 
T Consensus       225 ~v~l~~~Vt~v~~-------------------------~~v~~~--------~g~~~I~~~tvvWaaGv~a~-~~~~~l-  269 (405)
T COG1252         225 EVLLGTPVTEVTP-------------------------DGVTLK--------DGEEEIPADTVVWAAGVRAS-PLLKDL-  269 (405)
T ss_pred             EEEcCCceEEECC-------------------------CcEEEc--------cCCeeEecCEEEEcCCCcCC-hhhhhc-
Confidence            9999999999998                         455554        444 6999999999999999 666641 


Q ss_pred             CccCCCccCCCCCeEeCCCccccCCCCEEEEcccccccCCCCCCCCCchHHHHHHHHHHHHHHHHHHCCCCCCCcccCCc
Q 010331          358 NRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDRPLLPFRFQNL  437 (513)
Q Consensus       358 ~~~~~~~~~~~G~i~Vd~~l~~~~~p~VfaiGD~a~~~~~~g~~~~~~a~~A~~qg~~~a~ni~~~l~~~~~~~f~~~~~  437 (513)
                         .+.+.|..|++.||++||++++|+|||+|||+...++  +|.|++||.|+|||+++|+||.+.++|++++||+|+++
T Consensus       270 ---~~~e~dr~Grl~V~~~L~~~~~~~IFa~GD~A~~~~~--~p~P~tAQ~A~Qqg~~~a~ni~~~l~g~~l~~f~y~~~  344 (405)
T COG1252         270 ---SGLETDRRGRLVVNPTLQVPGHPDIFAAGDCAAVIDP--RPVPPTAQAAHQQGEYAAKNIKARLKGKPLKPFKYKDK  344 (405)
T ss_pred             ---ChhhhccCCCEEeCCCcccCCCCCeEEEeccccCCCC--CCCCChhHHHHHHHHHHHHHHHHHhcCCCCCCCcccce
Confidence               2577888999999999999999999999999999876  78999999999999999999999999999999999999


Q ss_pred             eeEEEecCCCeeecCCccCCeEEccHHHHHHHHHhHhhcCCCcchhhhhHHhhhhHHHHH
Q 010331          438 GEMMILGRNDAAVSPSFVEGVTLDGPIGHSARKLAYLIRLPTDEHRLKVGVSWLTKSAID  497 (513)
Q Consensus       438 g~~~~lG~~~~~~~~~~~~~~~~~G~~~~~~k~~~~~~~~~~~~~~~~~~~~w~~~~~~~  497 (513)
                      |+++++|.+.+++.   ++++.+.|.++|++|+.+|+++++.+++++++.++|++...+.
T Consensus       345 Gtl~~lG~~~av~~---~g~~~l~G~~a~~~k~~~~~~~l~~~~~~~~~~~~w~~~~~~~  401 (405)
T COG1252         345 GTLASLGDFSAVAD---LGGVKLKGFLAWLLKRAAYLYYLLGIRSRLAVALYWLTTYLTG  401 (405)
T ss_pred             EEEEEccCCceeEE---ecceeeccHHHHHHHHHHHHheecccCcHHHHHHHHhhhhhcc
Confidence            99999999999998   5578999999999999999999999999999999999887643

>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
3h8i_A409 The First X-Ray Structure Of A Sulfide:quinone Oxid 9e-05
4g6g_A502 Crystal Structure Of Ndh With Trt Length = 502 5e-04
4g9k_A471 Structure Of The Ndi1 Protein From Saccharomyces Ce 6e-04
>pdb|3H8I|A Chain A, The First X-Ray Structure Of A Sulfide:quinone Oxidoreductase: Insights Into Sulfide Oxidation Mechanism Length = 409 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 70/151 (46%), Gaps = 14/151 (9%)
Query: 81  RICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIA 140
           ++ +LGG FG L  A  L+ LV     K  V ++++S    F+P L  +  G  D  E+ 
Sbjct: 3   KVLVLGGRFGALTAAYTLKRLVGS---KADVKVINKSRFSYFRPALPHVAIGVRDVDELK 59
Query: 141 PRFADLLANTGVQFFKDRV-KLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLVLSL 199
              ++ L   G+QF +  V K+   S  +    P      G++  E     EYD++++ +
Sbjct: 60  VDLSEALPEKGIQFQEGTVEKIDAKSSMVYYTKP-----DGSMAEE-----EYDYVIVGI 109
Query: 200 GAEPKLDVVPGAAEFAFPFSTLEDACRVDRK 230
           GA    ++V G  ++ +     E A ++  K
Sbjct: 110 GAHLATELVKGWDKYGYSVCEPEFATKLREK 140
>pdb|4G6G|A Chain A, Crystal Structure Of Ndh With Trt Length = 502 Back     alignment and structure
>pdb|4G9K|A Chain A, Structure Of The Ndi1 Protein From Saccharomyces Cerevisiae Length = 471 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query513
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 7e-45
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 1e-41
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 5e-41
1fcd_A401 Flavocytochrome C sulfide dehydrogenase (flavin- b 1e-29
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 5e-10
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 8e-09
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 1e-08
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 6e-08
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 1e-07
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 9e-07
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 1e-05
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 2e-05
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 2e-05
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 2e-05
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 5e-05
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 2e-04
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 4e-04
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
 Score =  162 bits (412), Expect = 7e-45
 Identities = 66/415 (15%), Positives = 121/415 (29%), Gaps = 87/415 (20%)

Query: 77  KKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDA 136
           +    + ILG G GG+  A  ++  +       +V L+  ++ F F P    +  G  + 
Sbjct: 2   RGSAHVVILGAGTGGMPAAYEMKEAL---GSGHEVTLISANDYFQFVPSNPWVGVGWKER 58

Query: 137 WEIAPRFADLLANTGVQFFKDRVKLLCPSDHLGVNGPMACTHGGTVLLESGLIVEYDWLV 196
            +IA      +   G+ F     + +                   + L  G  V YD+L+
Sbjct: 59  DDIAFPIRHYVERKGIHFIAQSAEQIDAEAQ-------------NITLADGNTVHYDYLM 105

Query: 197 LSLGAEPKLDVVPGAAEFAFPFS---TLEDACRVDRKLSELER----------------- 236
           ++ G +   + VPG+     P     T++ A R   +   L R                 
Sbjct: 106 IATGPKLAFENVPGSDPHEGPVQSICTVDHAERAFAEYQALLREPGPIVIGAMAGASCFG 165

Query: 237 -------------RNFERLEEKGIVQAINVETTICPTGTPG---NREAALKVLSARKVQL 280
                        +     ++      I  E  I   G  G   ++    K L    ++ 
Sbjct: 166 PAYEYAMIVASDLKKRGMRDKIPSFTFITSEPYIGHLGIQGVGDSKGILTKGLKEEGIEA 225

Query: 281 VLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEADLV 340
                     +V + E +                    Y+ ++    + ++  +      
Sbjct: 226 YTN------CKVTKVEDNK------------------MYVTQVDEKGETIKEMVLPVKFG 261

Query: 341 LWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGR 400
           +      P       P     +   N  G    DE    K +  IFA G + A+      
Sbjct: 262 MMI----P--AFKGVPAVAGVEGLCNPGGFVLVDEHQRSKKYANIFAAGIAIAIPPVETT 315

Query: 401 PLPA----TAQVAFQQADFAGWNLWAAINDRPLLP-FRFQNLGEMMILGRNDAAV 450
           P+P     T  +       A  N+ A +  R         N      +G   AA 
Sbjct: 316 PVPTGAPKTGYMIESMVSAAVHNIKADLEGRKGEQTMGTWNAVAFADMGDRGAAF 370
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 100.0
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 100.0
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.98
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.98
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.98
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.98
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.98
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.97
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.97
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.97
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 99.97
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.97
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 99.97
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.97
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 99.97
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.97
1fec_A490 Trypanothione reductase; redox-active center, oxid 99.97
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.97
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 99.97
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.97
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 99.97
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.97
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.97
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.97
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 99.97
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.97
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.97
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.97
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.97
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.97
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.97
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.97
4dna_A463 Probable glutathione reductase; structural genomic 99.97
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.97
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.97
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 99.97
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 99.97
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.97
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 99.97
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.97
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.97
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.97
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.97
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.97
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.97
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.97
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.96
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.96
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.96
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 99.95
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.95
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.95
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.95
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.95
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.95
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.93
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.93
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.92
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.92
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.92
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.92
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.91
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.91
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.9
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.87
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.85
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.84
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.79
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.78
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.78
2cul_A232 Glucose-inhibited division protein A-related PROT 99.58
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.46
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.41
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.05
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.89
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.72
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.71
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.71
2bry_A497 NEDD9 interacting protein with calponin homology a 98.71
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.7
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.68
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.68
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.67
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.65
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.65
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.63
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.61
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.61
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.57
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.57
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.53
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.51
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.49
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.49
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.49
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.49
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.48
3dme_A369 Conserved exported protein; structural genomics, P 98.47
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.47
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.46
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.46
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.45
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.45
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.44
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.43
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.43
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.43
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.43
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.42
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.41
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.41
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.41
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.41
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.4
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.39
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.38
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.38
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.37
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.36
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.36
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.35
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.35
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.35
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.34
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.34
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.33
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.32
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.32
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.31
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.31
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.31
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.31
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.29
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.29
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.29
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.29
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.28
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.27
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.26
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.26
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.26
3atr_A453 Conserved archaeal protein; saturating double bond 98.25
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.25
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.25
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.25
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.25
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.25
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.25
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.24
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.24
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.24
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.23
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.23
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.23
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.22
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.2
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.19
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.18
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.18
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.18
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.17
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.17
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.17
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.17
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.14
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.13
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.12
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.12
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.12
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.11
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.1
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.1
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 98.09
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 98.09
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.08
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.08
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.07
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.05
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.05
4dna_A463 Probable glutathione reductase; structural genomic 98.03
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.02
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.01
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.0
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 97.99
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.98
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 97.98
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.98
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.98
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 97.98
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 97.97
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.97
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.95
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.94
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.93
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.93
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.92
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.92
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.92
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.91
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.9
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.9
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.88
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.86
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.85
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.85
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.84
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.84
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.84
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.83
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.81
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.79
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 97.78
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 97.77
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.76
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.74
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.74
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.73
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.73
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 97.73
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.65
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.63
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.6
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.52
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.5
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.5
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 97.47
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.46
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.45
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.42
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.4
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.4
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.37
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.35
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.33
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.31
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.3
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.29
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.29
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.27
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.26
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.23
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.22
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.21
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.19
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.14
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.13
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.12
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.12
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.11
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.1
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.1
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.02
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.99
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.97
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 96.96
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.95
4fk1_A304 Putative thioredoxin reductase; structural genomic 96.86
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.82
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 96.74
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 96.73
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 96.69
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 96.69
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 96.68
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.66
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 96.63
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.63
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.6
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.53
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.5
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.47
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.39
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 96.38
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 96.36
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.04
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 95.88
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 95.78
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.68
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.65
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 95.48
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 95.43
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.39
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 95.17
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 94.94
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.76
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.45
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 94.42
2bry_A 497 NEDD9 interacting protein with calponin homology a 94.31
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.1
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.92
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.45
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 93.31
2ywl_A180 Thioredoxin reductase related protein; uncharacter 93.1
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.04
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.81
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 92.74
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.52
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.43
3c85_A183 Putative glutathione-regulated potassium-efflux S 92.06
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 91.58
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 91.4
3dme_A369 Conserved exported protein; structural genomics, P 91.37
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 91.37
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 91.28
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 91.15
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 91.1
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.96
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 90.93
2cul_A232 Glucose-inhibited division protein A-related PROT 90.7
2gqf_A401 Hypothetical protein HI0933; structural genomics, 90.35
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 90.27
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 90.26
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 89.92
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 89.74
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 89.63
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 89.61
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 89.58
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 89.52
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 89.49
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 89.36
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 88.97
3ius_A286 Uncharacterized conserved protein; APC63810, silic 88.93
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 88.85
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 88.72
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 88.71
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 88.7
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 88.57
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.5
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 88.35
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 88.1
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 88.03
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 87.8
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 87.72
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 87.71
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 87.56
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 87.29
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 87.24
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 86.97
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 86.96
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 86.79
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 86.69
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 86.69
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 86.45
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 86.43
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 86.25
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 86.2
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 86.08
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 86.07
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 85.94
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 85.81
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 85.6
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 85.54
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 85.38
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 85.08
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 85.07
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 85.0
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 84.75
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 84.74
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 84.59
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 84.4
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 84.35
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 84.33
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 84.33
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 84.33
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 84.29
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 84.11
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 84.07
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 84.0
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 83.95
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 83.94
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 83.88
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 83.73
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 83.66
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 83.64
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 83.64
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 83.58
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 83.5
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 83.36
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 83.35
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 83.21
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 83.07
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 83.0
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 82.94
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 82.85
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 82.84
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 82.83
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 82.8
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 82.61
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 82.59
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 82.56
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 82.55
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 82.51
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 82.48
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 82.47
3tl2_A315 Malate dehydrogenase; center for structural genomi 82.44
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 82.4
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 82.08
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 82.0
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 81.89
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 81.88
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 81.79
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 81.74
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 81.66
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 81.63
3qha_A296 Putative oxidoreductase; seattle structural genomi 81.55
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 81.51
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 81.43
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 81.39
3atr_A 453 Conserved archaeal protein; saturating double bond 81.33
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 81.29
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 81.26
1vpd_A299 Tartronate semialdehyde reductase; structural geno 81.16
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 81.12
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 81.06
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 81.03
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 80.95
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 80.9
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 80.88
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 80.83
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 80.79
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 80.76
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 80.74
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 80.71
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 80.62
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 80.61
3on5_A362 BH1974 protein; structural genomics, joint center 80.57
4ezb_A317 Uncharacterized conserved protein; structural geno 80.51
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 80.44
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 80.41
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 80.27
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 80.21
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 80.18
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 80.14
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 80.12
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-60  Score=499.76  Aligned_cols=375  Identities=21%  Similarity=0.336  Sum_probs=304.1

Q ss_pred             CCCCeEEEECCCHHHHHHHHHhhhccccCCCCCeEEEEeCCCCcccCCchhhhhhccccCCcchHhHHHHhc--CCCeEE
Q 010331           77 KKKPRICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKPMLYELLSGEVDAWEIAPRFADLLA--NTGVQF  154 (513)
Q Consensus        77 ~~~~~VVIVGgG~AGl~aA~~L~~~~~~~~~~~~V~lIe~~~~~~~~p~~~~~~~g~~~~~~~~~~~~~~~~--~~~v~~  154 (513)
                      +.+++|||||||+||+++|+.|++      .+++|||||++++|+|+|++++++.|.++++++..++++++.  +.+++|
T Consensus        40 ~~KprVVIIGgG~AGl~~A~~L~~------~~~~VtLId~~~~~~~~PlL~~va~G~l~~~~i~~p~~~~~~~~~~~v~~  113 (502)
T 4g6h_A           40 SDKPNVLILGSGWGAISFLKHIDT------KKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTY  113 (502)
T ss_dssp             CSSCEEEEECSSHHHHHHHHHSCT------TTCEEEEEESSSEEECGGGGGGTTTTSSCGGGGEEEHHHHHTTCSSCEEE
T ss_pred             CCCCCEEEECCcHHHHHHHHHhhh------CCCcEEEECCCCCcccccchhHHhhccccHHHhhhhHHHHHHhhcCCeEE
Confidence            457899999999999999999987      567999999999999999999999999999999888887753  357999


Q ss_pred             EEEeEEEEeCCCCcCcCCCceeeccc-------------eEecCCceEEEecEEEEeCCCCCCCCCCCCccccCCCCCCH
Q 010331          155 FKDRVKLLCPSDHLGVNGPMACTHGG-------------TVLLESGLIVEYDWLVLSLGAEPKLDVVPGAAEFAFPFSTL  221 (513)
Q Consensus       155 ~~~~V~~id~~~~~~~~~~~v~~~~~-------------~v~~~~g~~i~yD~LVlAtGs~~~~~~ipG~~~~~~~~~~~  221 (513)
                      ++++|++||++.+.      |.+...             .+...++.+++||+||||||++++.+++||+.+++++++++
T Consensus       114 ~~~~v~~ID~~~k~------V~l~~~~~~~~~~~~~~~~~~~~~~~~~i~YD~LViAtGs~~~~~~ipG~~e~a~~l~t~  187 (502)
T 4g6h_A          114 YEAEATSINPDRNT------VTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEI  187 (502)
T ss_dssp             EEEEEEEEEGGGTE------EEEEEEEEEEECSSSCCCCCCCTTCCEEEECSEEEECCCCEECCTTCTTHHHHCEECSSH
T ss_pred             EEEEEEEEEhhhCE------EEEeecccceeecccccccccccCCceEEeCCEEEEcCCcccccCCccCcccccCCCCCH
Confidence            99999999987762      222110             01123466899999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHH-HHhh----------------hH-----------HHH---------------HhcCcEEEEeccCeec
Q 010331          222 EDACRVDRKLSE-LERR----------------NF-----------ERL---------------EEKGIVQAINVETTIC  258 (513)
Q Consensus       222 ~~a~~l~~~l~~-~~~~----------------~v-----------~~l---------------~~~~~vtli~~~~~ll  258 (513)
                      +++..+++.+.. ++..                ++           .++               .....|++++..++++
T Consensus       188 ~dA~~ir~~l~~~~e~a~~~~~~~~~~~~~~~vvVvGgG~tGvE~A~~l~~~~~~~l~~~~~~~~~~~~V~lve~~~~il  267 (502)
T 4g6h_A          188 PNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVL  267 (502)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCTTCHHHHHHTEEEEECCSHHHHHHHHHHHHHHHHTHHHHCHHHHHHCEEEEECSSSSSS
T ss_pred             HHHHHHHHHHHHHHHHHhcccccchhhccccceEEECCCcchhhhHHHHHHHHHHHHHhhcccccccceeEEeccccccc
Confidence            999999887632 1111                11           111               2234699999999999


Q ss_pred             CCCChhHHHHHHHHHHhCCcEEEcCceeeEEeccccccccccCCCcccccccccccCCCceEEEecccccCCcceEEeec
Q 010331          259 PTGTPGNREAALKVLSARKVQLVLGYFVRCIRRVGEFEASVKQPESGAIPNIAADKNSDKYILELQPAIKGLESQIFEAD  338 (513)
Q Consensus       259 ~~~~~~~~~~~~~~l~~~gV~v~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~~~~g~~i~aD  338 (513)
                      +.+++.+++++++.|+++||+|++++.|.+++++                         .+.+.....+....+++|+||
T Consensus       268 ~~~~~~~~~~~~~~L~~~GV~v~~~~~v~~v~~~-------------------------~~~~~~~~~dg~~~~~~i~ad  322 (502)
T 4g6h_A          268 NMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEK-------------------------QLLAKTKHEDGKITEETIPYG  322 (502)
T ss_dssp             TTSCHHHHHHHHHHHHHTTCEEETTEEEEEECSS-------------------------EEEEEEECTTSCEEEEEEECS
T ss_pred             cCCCHHHHHHHHHHHHhcceeeecCceEEEEeCC-------------------------ceEEEEEecCcccceeeeccC
Confidence            9999999999999999999999999999999873                         333332211111134679999


Q ss_pred             eEEEecCCCCCCCCCCCCCCccCCCccCCCCCeEeCCCccccCCCCEEEEcccccccCCCCCCCCCchHHHHHHHHHHHH
Q 010331          339 LVLWTVGSKPLLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALGDSSALRDSSGRPLPATAQVAFQQADFAGW  418 (513)
Q Consensus       339 ~vi~a~G~~p~~~~l~~~~~~~~~~~~~~~G~i~Vd~~l~~~~~p~VfaiGD~a~~~~~~g~~~~~~a~~A~~qg~~~a~  418 (513)
                      +||||+|.+|| ++..... ...+...+.+|+|.||++||++++|||||+|||+..      +.|++++.|++||+++|+
T Consensus       323 ~viwa~Gv~~~-~~~~~l~-~~~~~~~~~~g~I~Vd~~lq~~~~~~IfAiGD~a~~------~~p~~a~~A~qqg~~~A~  394 (502)
T 4g6h_A          323 TLIWATGNKAR-PVITDLF-KKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFA------GLPPTAQVAHQEAEYLAK  394 (502)
T ss_dssp             EEEECCCEECC-HHHHHHH-HHSGGGTTCCSSEEBCTTSBBTTCSSEEECGGGEES------SSCCCHHHHHHHHHHHHH
T ss_pred             EEEEccCCcCC-HHHHhHH-HhccccccCCCceeECCccccCCCCCEEEEEcccCC------CCCCchHHHHHHHHHHHH
Confidence            99999999998 3322110 022455678899999999999999999999999987      568999999999999999


Q ss_pred             HHHHH--------------------HCCCCCCCcccCCceeEEEecCCCeeecCCc--cCCeEEccHHHHHHHHHhHhhc
Q 010331          419 NLWAA--------------------INDRPLLPFRFQNLGEMMILGRNDAAVSPSF--VEGVTLDGPIGHSARKLAYLIR  476 (513)
Q Consensus       419 ni~~~--------------------l~~~~~~~f~~~~~g~~~~lG~~~~~~~~~~--~~~~~~~G~~~~~~k~~~~~~~  476 (513)
                      ||.+.                    +.+++++||+|.++|+|++||+++|+++...  ..++.++|+++|++|+++|+++
T Consensus       395 ni~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pF~y~~~G~~a~lG~~~av~~~~~~~~~~~~~~G~~a~~~w~~~yl~~  474 (502)
T 4g6h_A          395 NFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSM  474 (502)
T ss_dssp             HHHHHTTCHHHHHHTTSSSCCHHHHHHHTTCCCCCCCCCEEEEECSTTCEEEEEEETTEEEEEEEEHHHHHHHHHHHHHH
T ss_pred             HHHHHhccchhhhhhhhccchhhhhhcCCCCCCCEecCcceEEEEeCCceEEEccCCCccceecccHHHHHHHHHHHHHH
Confidence            99763                    4567889999999999999999999987421  1235678999999999999999


Q ss_pred             CCCcchhhhhHHhhhhHHHH
Q 010331          477 LPTDEHRLKVGVSWLTKSAI  496 (513)
Q Consensus       477 ~~~~~~~~~~~~~w~~~~~~  496 (513)
                      +|+|+||++++++|++.+.+
T Consensus       475 l~~~r~r~~v~~~W~~~~~f  494 (502)
T 4g6h_A          475 ILSARSRLKVFFDWIKLAFF  494 (502)
T ss_dssp             CSCHHHHHHHHHHHHHHHHS
T ss_pred             ccchhhhHHHHHHHHHHHhC
Confidence            99999999999999988764
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 513
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 5e-05
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 6e-05
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-04
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 6e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 6e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 8e-04
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 0.004
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit
species: Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]

 Score = 41.7 bits (96), Expect = 5e-05
 Identities = 16/98 (16%), Positives = 29/98 (29%), Gaps = 8/98 (8%)

Query: 333 QIFEADLVLWTVGSKP---LLPHVEPPNNRLHDLPLNARGQAETDETLCVKGHPRIFALG 389
             F  D  +   G +     +        ++  L  +A       +T     H  I  +G
Sbjct: 93  AEFGYDRCVVAPGIELIYDKIEQRAGKIAQIAGLTNDAGWCPVDIKTFESSIHKGIHVIG 152

Query: 390 DSSALRDSSGRPLPATAQVAFQQADFAGWNLWAAINDR 427
           D+S        P+P +   A  Q   A   +   +   
Sbjct: 153 DASI-----ANPMPKSGYSANSQGKVAAAAVVVLLKGE 185
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query513
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.83
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.82
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.79
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.78
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.78
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.78
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.75
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.73
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.73
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.73
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.7
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.68
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.67
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.64
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.63
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.63
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.62
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.61
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.58
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.5
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.49
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.45
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.33
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.29
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.26
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.26
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.23
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.21
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.2
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.17
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.17
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.15
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.13
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.12
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.11
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.1
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.09
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.07
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.03
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.03
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.03
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.02
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.95
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.94
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.94
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.93
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.93
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.91
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.91
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.89
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.89
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.88
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.87
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.85
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.85
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.84
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.82
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.82
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.8
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.79
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.75
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.75
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.75
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.73
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.7
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.69
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.68
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.65
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.61
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.58
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.56
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.53
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.49
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.49
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.45
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.42
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.41
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.4
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.39
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.38
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.36
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.35
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.35
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.32
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.28
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.27
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.24
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.17
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.17
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.16
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.11
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.1
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.04
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.03
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.96
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.93
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.92
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.88
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.69
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.67
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.65
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.64
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.58
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.54
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.5
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 97.47
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.35
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.27
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.18
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 97.16
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.15
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.95
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 96.93
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.85
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 96.79
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.78
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 96.73
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.72
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 96.57
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 96.33
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.25
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.09
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.83
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.81
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 95.68
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.49
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.38
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.36
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.24
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 95.24
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.12
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.0
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.92
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.9
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.79
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 94.77
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 94.48
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 94.36
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 94.24
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.78
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.72
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 93.62
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.61
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.58
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.12
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.09
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 92.81
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.71
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 92.56
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 92.49
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 92.45
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.4
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 91.91
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 91.73
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 91.64
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 91.5
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 91.49
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 91.32
d1id1a_153 Rck domain from putative potassium channel Kch {Es 91.29
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.21
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 91.19
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.03
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.89
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 90.47
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.44
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.21
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 89.41
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.07
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.99
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 88.98
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 88.83
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 88.67
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 88.49
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 88.41
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.3
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 88.24
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 88.09
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 88.05
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.97
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.38
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 86.83
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 86.78
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 86.56
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 86.36
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.27
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.07
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 85.98
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 85.92
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 85.9
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 85.17
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 85.14
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.11
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 84.97
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.73
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 84.69
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 84.52
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 84.27
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.83
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 83.5
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.04
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 82.79
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 82.48
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.46
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.26
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 82.13
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 81.8
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 81.72
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 81.04
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 80.56
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 80.3
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 80.06
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: NADH peroxidase
species: Enterococcus faecalis [TaxId: 1351]

Probab=99.83  E-value=5.4e-21  Score=174.28  Aligned_cols=110  Identities=23%  Similarity=0.374  Sum_probs=80.8

Q ss_pred             eEEEECCCHHHHHHHHHhhhccccCCCCCeEEEEeCCCCcccCC-chhhhhhcccc-CCcchHhHHHHhcCCCeEEEEE-
Q 010331           81 RICILGGGFGGLYTALRLESLVWQDDKKPQVLLVDQSERFVFKP-MLYELLSGEVD-AWEIAPRFADLLANTGVQFFKD-  157 (513)
Q Consensus        81 ~VVIVGgG~AGl~aA~~L~~~~~~~~~~~~V~lIe~~~~~~~~p-~~~~~~~g~~~-~~~~~~~~~~~~~~~~v~~~~~-  157 (513)
                      ||||||||++|+.+|..|++++    ++.+|+++|++++..|.+ .++.++.+... .+++.....+.+++.+++++.+ 
T Consensus         2 KVvIIGgG~~G~e~A~~l~~~~----~~~~V~v~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~gi~v~~~~   77 (198)
T d1nhpa1           2 KVIVLGSSHGGYEAVEELLNLH----PDAEIQWYEKGDFISFLSAGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNT   77 (198)
T ss_dssp             EEEEECSSHHHHHHHHHHHHHC----TTSEEEEEESSSSSSBCGGGHHHHHTTSSCCGGGSBSCCHHHHHHTTCEEEETE
T ss_pred             EEEEECCcHHHHHHHHHHHhcC----CCCeEEEEeCCCcccccccCcchhhcccccchHHHHHhhHHHHHHCCcEEEEee
Confidence            7999999999999999999863    577999999998776655 46666666543 3445555556677889998875 


Q ss_pred             eEEEEeCCCCcCcCCCceeeccceEecCCc--eEEEecEEEEeCCCCCC
Q 010331          158 RVKLLCPSDHLGVNGPMACTHGGTVLLESG--LIVEYDWLVLSLGAEPK  204 (513)
Q Consensus       158 ~V~~id~~~~~~~~~~~v~~~~~~v~~~~g--~~i~yD~LVlAtGs~~~  204 (513)
                      +|+.|+++++.      +.+    ..+.+|  .+++||+||+|+|+.++
T Consensus        78 ~V~~i~~~~~~------v~~----~~~~~g~~~~~~~D~li~a~G~~~~  116 (198)
T d1nhpa1          78 EITAIQPKEHQ------VTV----KDLVSGEERVENYDKLIISPGAVPF  116 (198)
T ss_dssp             EEEEEETTTTE------EEE----EETTTCCEEEEECSEEEECCCEEEC
T ss_pred             ceeeEeecccc------cee----eecccccccccccceeeEeecceee
Confidence            89999887652      111    012333  46889999999998653
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure