Citrus Sinensis ID: 011027

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MTSISSNNQSTNFTLQESVNVWGSRGRRQSCRTSAAFAFKSSFFGKKPLSLSVNKTRPGRALGPTGYSRLNPITASSRCHTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC
cccccccccccccccccEEEEcccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHcccccEEEEcccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccEEEEEccHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHcccccccccEEEEEcccccEEcHHHHHHHHHHHHHHccccccccEEEEccEEEEEEEcccccEEEEEcccccEEEccEEEEcccccHHHHHHHHHHccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEccccccccEEEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccc
ccEEccccccccccHHHHcHEEEcccccccccccHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHccccEEEEEcccccccccHHHcccHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccHHHHHHHHHHHHHHHHccccEEEccHHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEccEEEEEEEEccccEEEEEEcccccEEEccEEEEHccHHHHHHHHHHcccccccccEEEEEcccEEEEEccccccccccccccccccccccccccccEEEcccccEEEEEEcccccccEEEccccccccccccccHHHHHHHHHHHHHHcHHHHcccEEEEEccccccccccccccccccEEccccccccEEEEEccccccHEcccHHHHHHHHHHHccccccccccccHHHccc
mtsissnnqstnftLQESVnvwgsrgrrqscrTSAAFAfkssffgkkplslsvnktrpgralgptgysrlnpitassrchtfdVIIIGAGIIGLTIARQLLVGSDLSVAVVDkvvpcsgatgagqgYIWMVhrtpgseiwDLALRSNKLWKMLADSLrdqgldplqvigwkqtgslligrtPEELVMLKERVKQLCEAGLRAeylsssdllqaepelmvgedsraaflpydSQLDAMLAVAYIEKGNrhfaskgryaefyhdpvtcllrsnstgeveAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEivldipvkprkghlLVLENFNSlklnhasmeagyvghhdltlhpgqvnhgqILSISMTATTDVIGNlvlgssrqfagfNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFisnrkvriglrpympdgkpvigpvpglSKVFLATGHEGLGLSLALGTAELVADMVltnplkvdsapfavqgrcc
mtsissnnqstnftlQESVNVWGSRGRRQSCRTSAAFafkssffgkkplslsvnktrpgralgptgysrlnpiTASSRCHTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCsgatgagqgyiWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVqtskntlyskKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNplkvdsapfavqgrcc
MTSISSNNQSTNFTLQESVNVWGSRGRRQSCRTsaafafkssffgkkPLSLSVNKTRPGRALGPTGYSRLNPITASSRCHTFDViiigagiigLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC
*******************NVW*********RTSAAFAFKSSFFGK******************TGYSRLNPITASSRCHTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQA**ELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPF*******
*******************************RTSAAFAF*******************************************DVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC
***********NFTLQESVNV**********RTSAAFAFKSSFFGKKPLSLSVNKTRPGRALGPTGYSRLNPITASSRCHTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSN*********TSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC
**************LQESVNVWGSRGRRQSCRTSAAFAFKSSFFGKKPLSLSVNKTR********************RCHTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSISSNNQSTNFTLQESVNVWGSRGRRQSCRTSAAFAFKSSFFGKKPLSLSVNKTRPGRALGPTGYSRLNPITASSRCHTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query495 2.2.26 [Sep-21-2011]
O85228417 Hydrogen cyanide synthase no no 0.727 0.863 0.246 9e-17
G3XD12417 Hydrogen cyanide synthase no no 0.725 0.860 0.248 1e-16
C5B9W5417 D-amino acid dehydrogenas yes no 0.721 0.856 0.264 5e-16
B2VJ51433 D-amino acid dehydrogenas yes no 0.533 0.609 0.256 3e-14
P33642364 Probable D-amino acid oxi no no 0.365 0.497 0.293 5e-14
B7VMK8417 D-amino acid dehydrogenas yes no 0.527 0.625 0.253 7e-14
B1M860419 D-amino acid dehydrogenas no no 0.711 0.840 0.250 2e-13
Q39IE1428 D-amino acid dehydrogenas no no 0.527 0.609 0.259 2e-13
A4WBF2432 D-amino acid dehydrogenas yes no 0.523 0.599 0.246 3e-13
A8GFF7434 D-amino acid dehydrogenas no no 0.533 0.608 0.256 7e-13
>sp|O85228|HCNC_PSEFL Hydrogen cyanide synthase subunit HcnC OS=Pseudomonas fluorescens GN=hcnC PE=2 SV=1 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 109/443 (24%), Positives = 177/443 (39%), Gaps = 83/443 (18%)

Query: 82  FDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPG----- 136
           +DV+I G G+IG + A QL    DL VA++D   P   A+ A  G +W +  + G     
Sbjct: 5   YDVVIAGGGVIGASCAYQLSKRKDLKVALIDAKRP-GNASRASAGGLWAIGESVGLGCGV 63

Query: 137 ------------------------------SEIWDLALRSNKLWKMLADSLRDQGLDPLQ 166
                                            +D AL+SN+L+  L   L   GL  + 
Sbjct: 64  IFFRMMSANRKREAQGSAVVVDSSTPHILPQSFFDFALQSNELYPRLHREL--MGLHNMD 121

Query: 167 VIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAA 226
              ++QTG   +    E+ +  +  V  +     +  +L  + L  +EP +         
Sbjct: 122 -FKFEQTGLKFVIYDEEDRLYAEHIVGCIPHLSDQVRWLDQAALRASEPNVSHEAQGALE 180

Query: 227 FLPYDSQLDAM-LAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNT 285
           FL  D Q++   L  AY E      A +     +++  VT +L   +   V  V+T    
Sbjct: 181 FL-CDHQVNPFRLTDAYTEG-----ARQNGVDVYFNTNVTGVLHQGN--RVSGVKTDVAG 232

Query: 286 LYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAG 345
           L+    ++ AAG W+  L    L+ T I  +IPVKP KG +L+ E    L     +    
Sbjct: 233 LFRCTTLINAAGAWAAELS---LQATGI--EIPVKPVKGQILLTERMPKLLNGCLTTSDC 287

Query: 346 YVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKR 405
           Y+   D         +G+IL               +GS+ +  GF+       I+ + + 
Sbjct: 288 YMAQKD---------NGEIL---------------IGSTTEDKGFDVTTTYPEINGLVQG 323

Query: 406 AAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLA 465
           A    P+L  + L      ++   GLRP  PD  P++GP+ G+     A GH   G+  +
Sbjct: 324 AVRCVPELAHVNL------KRCWAGLRPGSPDELPILGPMDGVEGYLNACGHFRTGILTS 377

Query: 466 LGTAELVADMVLTNPLKVDSAPF 488
             T  L+  +V    L +D  PF
Sbjct: 378 AITGVLLDKLVNEEALPLDITPF 400
A three-component membrane-bound flavoenzyme that catalyzes the formation of hydrogen cyanide, a secondary metabolite, by transfer of electrons to a cyanide-resistant branch of the aerobic respiratory chain. Contributes to suppression of black root rot of tobacco.
Pseudomonas fluorescens (taxid: 294)
EC: 1EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 5
>sp|G3XD12|HCNC_PSEAE Hydrogen cyanide synthase subunit HcnC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hcnC PE=1 SV=1 Back     alignment and function description
>sp|C5B9W5|DADA_EDWI9 D-amino acid dehydrogenase small subunit OS=Edwardsiella ictaluri (strain 93-146) GN=dadA PE=3 SV=1 Back     alignment and function description
>sp|B2VJ51|DADA_ERWT9 D-amino acid dehydrogenase small subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dadA PE=3 SV=1 Back     alignment and function description
>sp|P33642|Y4548_PSEAE Probable D-amino acid oxidase PA4548 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA4548 PE=3 SV=3 Back     alignment and function description
>sp|B7VMK8|DADA_VIBSL D-amino acid dehydrogenase small subunit OS=Vibrio splendidus (strain LGP32) GN=dadA PE=3 SV=1 Back     alignment and function description
>sp|B1M860|DADA_METRJ D-amino acid dehydrogenase small subunit OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dadA PE=3 SV=1 Back     alignment and function description
>sp|Q39IE1|DADA_BURS3 D-amino acid dehydrogenase small subunit OS=Burkholderia sp. (strain 383) GN=dadA PE=3 SV=1 Back     alignment and function description
>sp|A4WBF2|DADA_ENT38 D-amino acid dehydrogenase small subunit OS=Enterobacter sp. (strain 638) GN=dadA PE=3 SV=1 Back     alignment and function description
>sp|A8GFF7|DADA_SERP5 D-amino acid dehydrogenase small subunit OS=Serratia proteamaculans (strain 568) GN=dadA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query495
255572664489 fad oxidoreductase, putative [Ricinus co 0.905 0.916 0.659 1e-177
449462437490 PREDICTED: D-amino acid dehydrogenase sm 0.860 0.869 0.663 1e-168
357504859469 D-amino acid dehydrogenase small subunit 0.862 0.910 0.651 1e-165
449522095491 PREDICTED: LOW QUALITY PROTEIN: D-amino 0.870 0.877 0.650 1e-164
388501610469 unknown [Medicago truncatula] 0.862 0.910 0.648 1e-163
297795501458 oxidoreductase [Arabidopsis lyrata subsp 0.848 0.917 0.667 1e-158
79531915459 FAD-dependent oxidoreductase [Arabidopsi 0.848 0.915 0.658 1e-155
356527281465 PREDICTED: D-amino acid dehydrogenase sm 0.802 0.853 0.650 1e-152
359494764442 PREDICTED: FAD-dependent oxidoreductase 0.816 0.914 0.621 1e-144
297742824442 unnamed protein product [Vitis vinifera] 0.816 0.914 0.619 1e-143
>gi|255572664|ref|XP_002527265.1| fad oxidoreductase, putative [Ricinus communis] gi|223533358|gb|EEF35109.1| fad oxidoreductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  627 bits (1618), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 308/467 (65%), Positives = 370/467 (79%), Gaps = 19/467 (4%)

Query: 39  FKSSFFGKK----PLSLSVNKTRPGRALGPTGYSRLNP-ITASSRCHTFDVIIIGAGIIG 93
            K++FFG K    P+S+S++     +        R  P ITAS+  HTFDV+I+GAGIIG
Sbjct: 32  IKTTFFGSKLPAKPISISLSHYNAPKL-------RREPLITAST--HTFDVVIVGAGIIG 82

Query: 94  LTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEIWDLALRSNKLWKML 153
           L IARQ L+GS+LSVAVVDK VPCSGATGAGQGYIWM H++P S+ W+L +RS+KLWKML
Sbjct: 83  LAIARQFLIGSNLSVAVVDKAVPCSGATGAGQGYIWMAHKSPESDTWELTMRSHKLWKML 142

Query: 154 ADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQA 213
           ADS+ DQGL+PL+V+GWK TGSLL+GRTPEE  +LK+RV+QL EAGLR EYLSS DL   
Sbjct: 143 ADSIHDQGLNPLEVLGWKMTGSLLVGRTPEESEVLKKRVQQLSEAGLRVEYLSSHDLHLQ 202

Query: 214 EPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNST 273
           EP + VGE   AAFLP D QLDA   VA+IEK NR+FA+KGRYAEFYHDPV  LLRS+S+
Sbjct: 203 EPAIQVGESGGAAFLPDDCQLDAHRTVAFIEKANRYFATKGRYAEFYHDPVISLLRSSSS 262

Query: 274 GEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLVLENFN 333
           GE+EAVQTSKNTLYSKKAIVVAAGCWSGSLMHDL RE +IV +IPVKPRKGHLLVLE+F 
Sbjct: 263 GEIEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLFREYDIVFNIPVKPRKGHLLVLESFG 322

Query: 334 SLKLNHASMEAGYVGHHDLTLH-----PGQVNHGQILSISMTATTDVIGNLVLGSSRQFA 388
           SL LNH  MEAGYV H    ++      G  +H + LS+SMTAT DV+GNLVLGSSR+F+
Sbjct: 323 SLTLNHGVMEAGYVDHQGAGVNCTSAVSGLFDHKKNLSVSMTATMDVMGNLVLGSSREFS 382

Query: 389 GFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGL 448
           GF+T+ +++I+  IW RA EF+PKL+++ L D  ++RK+RIGLRPYMPDGKPVIG +P  
Sbjct: 383 GFSTQADESIVGHIWNRAGEFFPKLKEVYLGDLTASRKLRIGLRPYMPDGKPVIGSIPDF 442

Query: 449 SKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQGRCC 495
             V +ATGHEG GLSLALGTAE+VADMVL NP  V+ APF+VQGRCC
Sbjct: 443 PNVLIATGHEGGGLSLALGTAEMVADMVLGNPGTVNYAPFSVQGRCC 489

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449462437|ref|XP_004148947.1| PREDICTED: D-amino acid dehydrogenase small subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357504859|ref|XP_003622718.1| D-amino acid dehydrogenase small subunit [Medicago truncatula] gi|355497733|gb|AES78936.1| D-amino acid dehydrogenase small subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|449522095|ref|XP_004168063.1| PREDICTED: LOW QUALITY PROTEIN: D-amino acid dehydrogenase small subunit-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388501610|gb|AFK38871.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297795501|ref|XP_002865635.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297311470|gb|EFH41894.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79531915|ref|NP_199655.3| FAD-dependent oxidoreductase [Arabidopsis thaliana] gi|8777374|dbj|BAA96964.1| unnamed protein product [Arabidopsis thaliana] gi|46518459|gb|AAS99711.1| At5g48440 [Arabidopsis thaliana] gi|51969724|dbj|BAD43554.1| putative protein [Arabidopsis thaliana] gi|332008287|gb|AED95670.1| FAD-dependent oxidoreductase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356527281|ref|XP_003532240.1| PREDICTED: D-amino acid dehydrogenase small subunit-like [Glycine max] Back     alignment and taxonomy information
>gi|359494764|ref|XP_003634835.1| PREDICTED: FAD-dependent oxidoreductase domain-containing protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742824|emb|CBI35578.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query495
TAIR|locus:2166076459 AT5G48440 [Arabidopsis thalian 0.848 0.915 0.647 6.8e-143
TIGR_CMR|BA_2835391 BA_2835 "glycine oxidase, puta 0.569 0.721 0.264 1.5e-20
UNIPROTKB|Q4KDJ7417 hcnC "Hydrogen cyanide synthas 0.470 0.558 0.267 1.7e-13
UNIPROTKB|Q9KTV1421 dadA "D-amino acid dehydrogena 0.206 0.242 0.318 3.1e-10
TIGR_CMR|VC_0786421 VC_0786 "D-amino acid dehydrog 0.206 0.242 0.318 3.1e-10
UNIPROTKB|P0A6J5432 dadA "D-amino acid dehydrogena 0.2 0.229 0.311 5.6e-09
TIGR_CMR|BA_0730369 BA_0730 "glycine oxidase" [Bac 0.428 0.574 0.248 4.1e-08
UNIPROTKB|F1PKA8 838 DMGDH "Uncharacterized protein 0.440 0.260 0.265 7.7e-08
UNIPROTKB|F1PK75 794 DMGDH "Uncharacterized protein 0.412 0.256 0.273 1.1e-07
ASPGD|ASPL0000068452393 AN7324 [Emericella nidulans (t 0.404 0.508 0.233 1.7e-07
TAIR|locus:2166076 AT5G48440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1397 (496.8 bits), Expect = 6.8e-143, P = 6.8e-143
 Identities = 275/425 (64%), Positives = 332/425 (78%)

Query:    73 ITASSRCHTFDVXXXXXXXXXLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVH 132
             +TAS    +FDV         LTIARQ L GSDLSVAVVDK VPCSGATGAGQGYIWM H
Sbjct:    38 VTASRS--SFDVVVVGGGIIGLTIARQFLTGSDLSVAVVDKAVPCSGATGAGQGYIWMTH 95

Query:   133 RTPGSEIWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERV 192
             + PGS++WDL LRS++LW  LA+SL D GLDP +++GWK+TGSLLIGRT EE V LK++V
Sbjct:    96 KKPGSDVWDLTLRSHELWHKLAESLTDDGLDPEELLGWKKTGSLLIGRTTEECVALKQKV 155

Query:   193 KQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFAS 252
              +L EAGLR EYLSS++LL  EP ++V +++ AAFLP DSQLDA  AVAYIEKGNR FA+
Sbjct:   156 HELSEAGLRTEYLSSAELLLKEPAILVNDNTGAAFLPDDSQLDAHRAVAYIEKGNRAFAT 215

Query:   253 KGRYAEFYHDPVTCLLRSNSTGEVEA-VQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRET 311
              GRYAEFY++PVT L+RS+   +V A V+T K  LY KKA +VAAGCWSGSLMH+LL++ 
Sbjct:   216 AGRYAEFYNEPVTGLIRSDGDSKVVAGVKTLKRNLYGKKATIVAAGCWSGSLMHELLKDC 275

Query:   312 EIVLDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTA 371
              I LD+PVKPRKGHLLV+ENF+S  LNH  MEAGY  H   ++    V+  ++LSISMTA
Sbjct:   276 NIPLDVPVKPRKGHLLVVENFDSFHLNHGIMEAGYSNHQSASVSGLDVDE-RMLSISMTA 334

Query:   372 TTDVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGL 431
             T D  GNLVLGSSR+F GF+TE ++ II  IW+RAAEF+PKLRD+ L DFI NRKVR+GL
Sbjct:   335 TMDTSGNLVLGSSREFVGFDTEADEFIIRCIWERAAEFFPKLRDISLEDFIRNRKVRVGL 394

Query:   432 RPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAVQ 491
             RPYMPDGKPVIG VPGL  ++LA GHEG GLS+AL TAE+V DMVL  P +VD++ F V+
Sbjct:   395 RPYMPDGKPVIGSVPGLQNMYLAAGHEGGGLSMALATAEMVTDMVLGKPSQVDTSTFGVK 454

Query:   492 GR-CC 495
             GR CC
Sbjct:   455 GRRCC 459
GO:0009507 "chloroplast" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
TIGR_CMR|BA_2835 BA_2835 "glycine oxidase, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KDJ7 hcnC "Hydrogen cyanide synthase HcnC" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KTV1 dadA "D-amino acid dehydrogenase small subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0786 VC_0786 "D-amino acid dehydrogenase, small subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6J5 dadA "D-amino acid dehydrogenase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0730 BA_0730 "glycine oxidase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKA8 DMGDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK75 DMGDH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ASPGD|ASPL0000068452 AN7324 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.8__714__AT5G48440.1
annotation not avaliable (458 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deam 5e-41
pfam01266234 pfam01266, DAO, FAD dependent oxidoreductase 1e-29
TIGR02352337 TIGR02352, thiamin_ThiO, glycine oxidase ThiO 8e-23
TIGR03364365 TIGR03364, HpnW_proposed, FAD dependent oxidoreduc 1e-16
PRK00711416 PRK00711, PRK00711, D-amino acid dehydrogenase sma 4e-14
COG0579429 COG0579, COG0579, Predicted dehydrogenase [General 7e-14
TIGR01377380 TIGR01377, soxA_mon, sarcosine oxidase, monomeric 3e-08
COG0578 532 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase 1e-07
PRK12409410 PRK12409, PRK12409, D-amino acid dehydrogenase sma 1e-06
pfam01946229 pfam01946, Thi4, Thi4 family 2e-05
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 2e-05
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 8e-05
PRK11259376 PRK11259, solA, N-methyltryptophan oxidase; Provis 1e-04
PRK08205 583 PRK08205, sdhA, succinate dehydrogenase flavoprote 1e-04
PRK11728393 PRK11728, PRK11728, hydroxyglutarate oxidase; Prov 2e-04
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 2e-04
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 2e-04
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl h 2e-04
TIGR01373407 TIGR01373, soxB, sarcosine oxidase, beta subunit f 2e-04
TIGR00292254 TIGR00292, TIGR00292, thiazole biosynthesis enzyme 4e-04
PRK12839 572 PRK12839, PRK12839, hypothetical protein; Provisio 4e-04
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 6e-04
PLN02661357 PLN02661, PLN02661, Putative thiazole synthesis 0.001
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 0.001
PRK07804 541 PRK07804, PRK07804, L-aspartate oxidase; Provision 0.001
PRK09077 536 PRK09077, PRK09077, L-aspartate oxidase; Provision 0.001
PRK07057 591 PRK07057, sdhA, succinate dehydrogenase flavoprote 0.002
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.002
>gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information 
 Score =  151 bits (382), Expect = 5e-41
 Identities = 111/416 (26%), Positives = 161/416 (38%), Gaps = 47/416 (11%)

Query: 81  TFDVIIIGAGIIGLTIARQLLV-GSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSEI 139
             DV+IIG GI+GL+ A  L   G+D  V V++      GA G   G I     +PG E+
Sbjct: 4   KMDVVIIGGGIVGLSAAYYLAERGAD--VTVLEAGEAGGGAAGRNAGGILAPWASPGGEL 61

Query: 140 WD--LALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPE--ELVMLKERVKQL 195
               LA  S  LW+ L++ L           G ++ G L +        L  L+    +L
Sbjct: 62  EVRPLADLSLALWRELSEELG-------TGAGLRRRGLLDLAAREGLKGLAQLERLAAEL 114

Query: 196 CEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGR 255
             AG  AE L +++  + EP L         F P    LD  L    +          G 
Sbjct: 115 EAAGEDAELLDAAEAAELEPALGPDFVCGGLFDPTGGHLDPRLLTRALAA---AAEELGV 171

Query: 256 YAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVL 315
                  PVT L R    G V  V+T   T      +V+AAG W+G L       T   L
Sbjct: 172 VIIEGGTPVTSLER---DGRVVGVETDGGT-IEADKVVLAAGAWAGELA-----ATLGEL 222

Query: 316 DIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDV 375
            +P++P +G  L  E    L  +  +     V      + P     G++           
Sbjct: 223 PLPLRPVRGQALTTEPPEGLLADGLAPVVLVVDDGGGYIRP--RGDGRLRVGGTDEEGGD 280

Query: 376 IGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYM 435
                          + E E  +I  + + A    P L D  +    +      GLRP  
Sbjct: 281 D------------PSDPEREDLVIAELLRVARALLPGLADAGIEAAWA------GLRPPT 322

Query: 436 -PDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDSAPFAV 490
            PDG PVIG    L  +++ATGH G G +LA     L+AD++L    ++D  P  +
Sbjct: 323 TPDGLPVIGRAAPLPNLYVATGHGGHGFTLAPALGRLLADLILGGEPELDLRPLLL 378

Length = 387
>gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|233831 TIGR02352, thiamin_ThiO, glycine oxidase ThiO Back     alignment and domain information
>gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>gnl|CDD|234819 PRK00711, PRK00711, D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>gnl|CDD|223652 COG0579, COG0579, Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|130444 TIGR01377, soxA_mon, sarcosine oxidase, monomeric form Back     alignment and domain information
>gnl|CDD|223651 COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237093 PRK12409, PRK12409, D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|145231 pfam01946, Thi4, Thi4 family Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236887 PRK11259, solA, N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236185 PRK08205, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183292 PRK11728, PRK11728, hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236001 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|233383 TIGR01373, soxB, sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme Back     alignment and domain information
>gnl|CDD|237223 PRK12839, PRK12839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178267 PLN02661, PLN02661, Putative thiazole synthesis Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236374 PRK09077, PRK09077, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 495
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 100.0
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 100.0
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 100.0
PRK11259376 solA N-methyltryptophan oxidase; Provisional 100.0
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 100.0
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 100.0
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 100.0
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 100.0
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 100.0
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 100.0
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 100.0
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 100.0
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 100.0
PRK11728393 hydroxyglutarate oxidase; Provisional 100.0
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 100.0
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 100.0
KOG2853509 consensus Possible oxidoreductase [General functio 100.0
COG0579429 Predicted dehydrogenase [General function predicti 100.0
PLN02464 627 glycerol-3-phosphate dehydrogenase 99.98
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 99.97
PRK13369 502 glycerol-3-phosphate dehydrogenase; Provisional 99.97
KOG2852380 consensus Possible oxidoreductase [General functio 99.97
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.97
PTZ00383497 malate:quinone oxidoreductase; Provisional 99.96
PRK13339497 malate:quinone oxidoreductase; Reviewed 99.96
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 99.95
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 99.95
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 99.95
PRK05257494 malate:quinone oxidoreductase; Validated 99.95
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 99.93
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 99.88
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 99.65
PRK06185407 hypothetical protein; Provisional 99.46
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.45
PRK07121492 hypothetical protein; Validated 99.44
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.44
PRK10157428 putative oxidoreductase FixC; Provisional 99.43
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.37
PRK08274466 tricarballylate dehydrogenase; Validated 99.36
COG2081408 Predicted flavoproteins [General function predicti 99.36
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.34
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.33
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.32
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.32
PLN02697529 lycopene epsilon cyclase 99.31
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.28
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.28
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.27
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 99.27
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.26
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.26
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.25
PRK06847375 hypothetical protein; Provisional 99.25
PRK08244493 hypothetical protein; Provisional 99.25
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.25
PRK07804 541 L-aspartate oxidase; Provisional 99.23
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 99.23
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.23
TIGR02730493 carot_isom carotene isomerase. Members of this fam 99.22
PRK07395 553 L-aspartate oxidase; Provisional 99.22
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.21
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.21
PRK10015429 oxidoreductase; Provisional 99.2
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.2
PRK08071 510 L-aspartate oxidase; Provisional 99.2
PLN02463447 lycopene beta cyclase 99.2
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.2
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.19
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.19
PRK06175433 L-aspartate oxidase; Provisional 99.19
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.18
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.18
PRK06834 488 hypothetical protein; Provisional 99.17
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.17
PRK12839 572 hypothetical protein; Provisional 99.17
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.16
PLN02815 594 L-aspartate oxidase 99.16
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.16
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.16
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK12842 574 putative succinate dehydrogenase; Reviewed 99.15
PRK08163396 salicylate hydroxylase; Provisional 99.15
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.15
PRK09126392 hypothetical protein; Provisional 99.15
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.15
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 99.13
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.13
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.13
PRK08401466 L-aspartate oxidase; Provisional 99.13
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.12
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.11
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 99.11
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 99.11
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.11
PRK07045388 putative monooxygenase; Reviewed 99.11
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.1
COG1233487 Phytoene dehydrogenase and related proteins [Secon 99.1
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.1
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.1
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.1
PRK07512 513 L-aspartate oxidase; Provisional 99.1
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 99.09
PRK07233434 hypothetical protein; Provisional 99.08
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 99.06
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 99.05
PRK09077 536 L-aspartate oxidase; Provisional 99.05
PRK08013400 oxidoreductase; Provisional 99.05
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.05
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.04
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 99.03
PRK06753373 hypothetical protein; Provisional 99.01
PRK08132 547 FAD-dependent oxidoreductase; Provisional 99.01
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.0
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.0
PRK06126 545 hypothetical protein; Provisional 99.0
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.99
PRK08275 554 putative oxidoreductase; Provisional 98.98
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.98
PRK07588391 hypothetical protein; Provisional 98.98
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.98
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.95
PRK11445351 putative oxidoreductase; Provisional 98.93
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.93
PRK06184 502 hypothetical protein; Provisional 98.93
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.92
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.91
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.91
PLN02985514 squalene monooxygenase 98.91
PRK13977576 myosin-cross-reactive antigen; Provisional 98.9
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.9
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 98.9
PRK05868372 hypothetical protein; Validated 98.89
PLN02661357 Putative thiazole synthesis 98.89
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.89
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.89
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.87
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.87
PRK08294 634 phenol 2-monooxygenase; Provisional 98.87
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.87
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.86
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.86
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.86
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.86
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.86
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.85
PLN02612567 phytoene desaturase 98.85
PRK07190 487 hypothetical protein; Provisional 98.84
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.84
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.84
KOG1298 509 consensus Squalene monooxygenase [Lipid transport 98.82
PRK06996398 hypothetical protein; Provisional 98.81
PRK02106 560 choline dehydrogenase; Validated 98.8
PRK07236386 hypothetical protein; Provisional 98.8
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.79
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.79
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.78
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 98.76
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.76
PLN02487569 zeta-carotene desaturase 98.73
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.72
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.72
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.71
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.71
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.69
PRK07208479 hypothetical protein; Provisional 98.66
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.56
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 98.56
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 98.55
PRK06475400 salicylate hydroxylase; Provisional 98.54
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.54
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.53
PRK07538413 hypothetical protein; Provisional 98.53
COG4121252 Uncharacterized conserved protein [Function unknow 98.53
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.52
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.5
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.5
PRK06116450 glutathione reductase; Validated 98.49
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.49
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.46
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.45
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.44
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.44
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.41
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 98.41
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.4
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 98.4
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.38
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.38
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.38
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.37
PLN02568539 polyamine oxidase 98.35
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.35
PLN02507499 glutathione reductase 98.34
PRK06370463 mercuric reductase; Validated 98.32
PLN02676487 polyamine oxidase 98.32
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.31
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 98.3
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.3
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.29
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.29
PLN02785 587 Protein HOTHEAD 98.26
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.26
PTZ00058 561 glutathione reductase; Provisional 98.25
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.21
PRK14694468 putative mercuric reductase; Provisional 98.21
PLN02546558 glutathione reductase 98.2
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 98.19
COG3573 552 Predicted oxidoreductase [General function predict 98.19
PRK09897 534 hypothetical protein; Provisional 98.14
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.1
PTZ00153 659 lipoamide dehydrogenase; Provisional 98.09
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.08
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.07
COG3349485 Uncharacterized conserved protein [Function unknow 98.06
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 98.05
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.03
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.02
PLN02576496 protoporphyrinogen oxidase 97.96
PLN02268435 probable polyamine oxidase 97.96
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.94
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.93
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.92
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.91
PTZ00052499 thioredoxin reductase; Provisional 97.9
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 97.9
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.9
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.86
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.82
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.82
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.8
PRK12416463 protoporphyrinogen oxidase; Provisional 97.79
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.78
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.77
PTZ00367 567 squalene epoxidase; Provisional 97.76
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.75
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.67
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.62
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.6
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.59
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.59
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.56
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.55
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 97.55
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.53
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.51
PRK07846451 mycothione reductase; Reviewed 97.51
TIGR02053463 MerA mercuric reductase. This model represents the 97.51
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.51
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.49
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.48
PRK10262321 thioredoxin reductase; Provisional 97.48
PRK12831464 putative oxidoreductase; Provisional 97.47
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.44
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.44
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.41
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.4
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.4
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.4
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.39
PLN02529 738 lysine-specific histone demethylase 1 97.38
PLN02852491 ferredoxin-NADP+ reductase 97.35
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 97.34
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.33
PRK13748561 putative mercuric reductase; Provisional 97.32
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.28
PTZ00188506 adrenodoxin reductase; Provisional 97.27
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.26
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.18
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.17
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.17
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.17
PRK14727479 putative mercuric reductase; Provisional 97.16
PRK12814652 putative NADPH-dependent glutamate synthase small 97.13
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.12
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.08
PLN03000 881 amine oxidase 97.05
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.04
KOG2960328 consensus Protein involved in thiamine biosynthesi 97.02
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 96.99
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.96
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.95
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.93
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 96.9
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.83
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.82
PLN02976 1713 amine oxidase 96.78
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.76
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 96.75
KOG4716503 consensus Thioredoxin reductase [Posttranslational 96.72
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.69
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.56
PRK13984604 putative oxidoreductase; Provisional 96.52
KOG0404322 consensus Thioredoxin reductase [Posttranslational 96.49
PRK06116450 glutathione reductase; Validated 96.47
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.33
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.25
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 96.21
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.18
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.1
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 96.02
KOG03992142 consensus Glutamate synthase [Amino acid transport 95.95
PRK13512438 coenzyme A disulfide reductase; Provisional 95.94
PRK14694468 putative mercuric reductase; Provisional 95.91
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 95.74
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.69
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 95.29
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.14
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 95.12
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.99
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.97
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 94.97
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.96
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 94.89
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 94.58
KOG2755334 consensus Oxidoreductase [General function predict 94.52
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.49
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.36
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.35
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.29
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.19
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 94.11
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.04
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 94.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 93.68
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 93.67
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 93.67
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 93.58
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.57
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 93.53
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 93.47
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.44
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.43
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 93.42
PRK06249313 2-dehydropantoate 2-reductase; Provisional 93.33
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 93.31
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 93.26
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 93.25
PRK07846451 mycothione reductase; Reviewed 93.18
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 93.18
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 93.17
PRK08229341 2-dehydropantoate 2-reductase; Provisional 93.11
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 93.1
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.03
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 92.92
TIGR02053463 MerA mercuric reductase. This model represents the 92.87
PRK12921305 2-dehydropantoate 2-reductase; Provisional 92.86
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 92.84
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 92.76
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 92.69
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 92.68
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 92.63
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 92.62
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 92.62
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 92.62
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 92.57
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 92.57
PRK13512438 coenzyme A disulfide reductase; Provisional 92.55
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 92.54
PRK06370463 mercuric reductase; Validated 92.39
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.38
PRK06719157 precorrin-2 dehydrogenase; Validated 92.37
PRK11730715 fadB multifunctional fatty acid oxidation complex 92.35
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 92.35
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 92.35
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.33
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 92.32
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 92.29
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 92.28
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.28
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.28
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.1
PRK06292460 dihydrolipoamide dehydrogenase; Validated 92.1
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 92.09
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 92.08
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 91.99
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 91.87
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 91.86
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.79
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 91.68
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.53
PRK06327475 dihydrolipoamide dehydrogenase; Validated 91.53
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 91.4
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 91.38
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 91.35
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 91.33
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.33
PTZ00153659 lipoamide dehydrogenase; Provisional 91.33
PTZ00082321 L-lactate dehydrogenase; Provisional 91.28
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 91.24
PTZ00058561 glutathione reductase; Provisional 91.19
PTZ00052499 thioredoxin reductase; Provisional 91.19
PRK11154708 fadJ multifunctional fatty acid oxidation complex 91.1
PRK07845466 flavoprotein disulfide reductase; Reviewed 91.03
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 91.02
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 90.97
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 90.94
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.9
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 90.84
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 90.8
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 90.79
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 90.76
PRK14727479 putative mercuric reductase; Provisional 90.75
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 90.61
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 90.58
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 90.58
PRK09564444 coenzyme A disulfide reductase; Reviewed 90.58
PRK10262321 thioredoxin reductase; Provisional 90.53
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 90.52
PLN02507499 glutathione reductase 90.47
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 90.47
PRK07417279 arogenate dehydrogenase; Reviewed 90.46
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 90.44
cd01483143 E1_enzyme_family Superfamily of activating enzymes 90.42
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 90.41
PRK13748561 putative mercuric reductase; Provisional 90.4
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 90.38
PRK06223307 malate dehydrogenase; Reviewed 90.16
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 90.15
PRK12831464 putative oxidoreductase; Provisional 90.07
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 90.01
PRK12549284 shikimate 5-dehydrogenase; Reviewed 89.89
PLN02546558 glutathione reductase 89.88
PRK04148134 hypothetical protein; Provisional 89.86
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 89.85
PRK14989 847 nitrite reductase subunit NirD; Provisional 89.78
PRK12770352 putative glutamate synthase subunit beta; Provisio 89.75
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 89.51
PLN02353473 probable UDP-glucose 6-dehydrogenase 89.45
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 89.42
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 89.19
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 89.07
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 88.89
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 88.87
PTZ00117319 malate dehydrogenase; Provisional 88.5
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 88.45
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 88.27
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 88.26
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 88.26
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 88.17
PRK08328231 hypothetical protein; Provisional 88.09
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 88.06
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 87.93
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 87.91
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 87.54
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 87.52
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 87.48
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 87.42
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 87.38
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 87.34
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 87.18
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 87.02
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 87.01
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 86.99
PRK08306296 dipicolinate synthase subunit A; Reviewed 86.9
PLN00112444 malate dehydrogenase (NADP); Provisional 86.89
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 86.82
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 86.71
PRK12548289 shikimate 5-dehydrogenase; Provisional 86.69
PTZ00318424 NADH dehydrogenase-like protein; Provisional 86.61
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 86.51
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 86.4
KOG1439440 consensus RAB proteins geranylgeranyltransferase c 86.32
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.09
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 86.01
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 85.86
PRK08223287 hypothetical protein; Validated 85.83
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 85.8
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 85.79
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 85.7
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 85.69
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.65
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 85.64
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 85.17
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.1
PRK09897534 hypothetical protein; Provisional 85.1
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 85.09
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 85.07
PRK07502307 cyclohexadienyl dehydrogenase; Validated 85.07
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.05
PRK05600370 thiamine biosynthesis protein ThiF; Validated 85.02
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 84.79
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 84.7
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.64
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 84.56
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 84.42
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 84.2
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 84.19
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 84.06
PRK12416463 protoporphyrinogen oxidase; Provisional 83.96
PRK09496453 trkA potassium transporter peripheral membrane com 83.82
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 83.78
PLN02695370 GDP-D-mannose-3',5'-epimerase 83.72
PRK08017256 oxidoreductase; Provisional 83.67
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 83.6
PRK05442326 malate dehydrogenase; Provisional 83.56
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.45
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 83.44
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information 
Probab=100.00  E-value=3.1e-59  Score=498.64  Aligned_cols=414  Identities=20%  Similarity=0.231  Sum_probs=325.1

Q ss_pred             eceeecccccccccccccccceee-eecCCCCCcccc-ccccCCCCCcCCCCCCCCCCCCCCCCCCCcccEEEECCCHHH
Q 011027           16 QESVNVWGSRGRRQSCRTSAAFAF-KSSFFGKKPLSL-SVNKTRPGRALGPTGYSRLNPITASSRCHTFDVIIIGAGIIG   93 (495)
Q Consensus        16 ~~~~~~~~~~~~~~~~l~~~gf~~-k~~g~g~kr~~l-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dVvIIGaGiaG   93 (495)
                      +.+++|||+||.||++|+.+||.| |+||||+||||| |++..-.....+.+|..+  +.++    ..+||+||||||+|
T Consensus       199 ~~~~~t~t~a~~vr~~l~~~GF~v~~~~~~g~kr~~~~~~~~~~~~~~~~~~w~~~--~~~~----~~~dVvIIGaGIaG  272 (662)
T PRK01747        199 GATLATFTSAGFVRRGLQEAGFTVRKVKGFGRKREMLVGELEQTLPAPLAAPWFAR--PGSP----KARDAAIIGGGIAG  272 (662)
T ss_pred             CCEEEEeehHHHHHHHHHHcCCeeeecCCCchhhhhhhehhccccCCCCCCCcccC--CCcC----CCCCEEEECccHHH
Confidence            678999999999999999999999 999999999999 876311111122345432  1111    14799999999999


Q ss_pred             HHHHHHHHhcCCccEEEEcCC-cCCCCcccCCcceeeeccCCCCchHHHHHH----HHHHHHHHHHHHHHhcCCCCcccc
Q 011027           94 LTIARQLLVGSDLSVAVVDKV-VPCSGATGAGQGYIWMVHRTPGSEIWDLAL----RSNKLWKMLADSLRDQGLDPLQVI  168 (495)
Q Consensus        94 ls~A~~La~~~G~~V~liE~~-~~~~gaS~~~~g~i~~~~~~~~~~~~~l~~----~~~~~~~~~~~~~~~~~~~~~~~~  168 (495)
                      +++||+|+ ++|++|+|||++ .++.|+|++++|++++..........++..    ++.++|+++. .   .+.+    +
T Consensus       273 ~s~A~~La-~~G~~V~VlE~~~~~~~gaSg~~~G~l~~~~~~~~~~~~~l~~~a~~~a~~~~~~l~-~---~~~~----~  343 (662)
T PRK01747        273 AALALALA-RRGWQVTLYEADEAPAQGASGNRQGALYPLLSKDDNALSRFFRAAFLFARRFYDALP-A---AGVA----F  343 (662)
T ss_pred             HHHHHHHH-HCCCeEEEEecCCCccccCCcCcccccccccCCCCCHHHHHHHHHHHHHHHHHHHHH-h---cCCC----C
Confidence            99999998 599999999998 478999999999999887655555556554    5667777665 2   2332    4


Q ss_pred             ceEeeeeEEEecCHHHHHHHHHHHHHHHHcCCceEEcChhhHHHhCCCCccCCcceEEEeCCCceecHHHHHHHHHHHhh
Q 011027          169 GWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNR  248 (495)
Q Consensus       169 ~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~p~l~~~~~~~~~~~~~~g~~~p~~~~~~l~~~~~  248 (495)
                      .+..+|.+.+..++++.+.+++..+.... +...++++++++.+.+|.   ....+++++|++|+++|..++..|.+.++
T Consensus       344 ~~~~~G~l~~a~~~~~~~~l~~~~~~~~~-~~~~~~l~~~e~~~~~~~---~~~~~g~~~p~~G~v~p~~l~~aL~~~a~  419 (662)
T PRK01747        344 DHDWCGVLQLAWDEKSAEKIAKMLALGLP-AELARALDAEEAEELAGL---PVPCGGIFYPQGGWLCPAELCRALLALAG  419 (662)
T ss_pred             CCCCCceEEeecCchHHHHHHHHHhccCc-hHhhhhCCHHHHHHHhCC---CCCCCcEEeCCCCeeCHHHHHHHHHHhcc
Confidence            57889999999887776666665543322 234678999999988752   34578999999999999999999999887


Q ss_pred             hhccCCceeEEecCceeEEEEecCCCcEEEEEcCCCeeeecCeEEEccCcchHHHHHHhhhccccccccceeecceeEEE
Q 011027          249 HFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKGHLLV  328 (495)
Q Consensus       249 ~~g~~~~~~~~~~~~V~~l~~~~~~~~~~~v~~~~g~~~~a~~VV~A~G~~s~~l~~~l~~~~~~~~~~~l~~~rgq~~~  328 (495)
                      + |    ++++++++|+++..+  ++ .|.|.+.+|..+.+|.||+|+|+|+..|.+.        ..+|+.|+|||++.
T Consensus       420 ~-G----v~i~~~~~V~~i~~~--~~-~~~v~t~~g~~~~ad~VV~A~G~~s~~l~~~--------~~lpl~p~RGqv~~  483 (662)
T PRK01747        420 Q-Q----LTIHFGHEVARLERE--DD-GWQLDFAGGTLASAPVVVLANGHDAARFAQT--------AHLPLYSVRGQVSH  483 (662)
T ss_pred             c-C----cEEEeCCEeeEEEEe--CC-EEEEEECCCcEEECCEEEECCCCCccccccc--------cCCCcccccceEEe
Confidence            7 6    688999999999875  33 4668888887776899999999999988663        25899999999998


Q ss_pred             EeecCcc-ccccccccccccccccCCCCCCCcccccceeeeeeeee-eccccEEecccccccCCCccccHHHHHHHHHHH
Q 011027          329 LENFNSL-KLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATT-DVIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRA  406 (495)
Q Consensus       329 ~~~~~~~-~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~g~~~iG~t~~~~~~~~~~~~~~~~~~~~~l  406 (495)
                      ++..... .++..++..+|                        ..| ..+|.+++|+|++.++.+..++.++++.+++.+
T Consensus       484 ~~~~~~~~~~~~~~~~~~Y------------------------~~p~~~~g~~~iGat~~~~~~~~~~~~~~~~~~~~~l  539 (662)
T PRK01747        484 LPTTPALSALKQVLCYDGY------------------------LTPQPANGTHCIGASYDRDDTDTAFREADHQENLERL  539 (662)
T ss_pred             ecCCccccccCceeECCce------------------------eCCCCCCCceEeCcccCCCCCCCCCCHHHHHHHHHHH
Confidence            8754321 11222222233                        224 456789999999888777788889999999999


Q ss_pred             HhhcCCc-----ccccccccccCceeeeeeccCCCCCCcEEee----------------------cCCCCcEEEEecCCC
Q 011027          407 AEFYPKL-----RDLCLADFISNRKVRIGLRPYMPDGKPVIGP----------------------VPGLSKVFLATGHEG  459 (495)
Q Consensus       407 ~~~~p~l-----~~~~~~~~~~~~~~~~g~r~~t~D~~Piig~----------------------~~~~~~l~~~~G~g~  459 (495)
                      .+++|.+     .+..+      ...|+|+|++|+|++|+||+                      +|..+|+|+++||||
T Consensus       540 ~~~~P~l~~~~~~~~~~------~~~~aG~R~~tpD~~PiIG~~~~~~~~~~~y~~l~~~~~~~~~~~~~gl~v~~G~gs  613 (662)
T PRK01747        540 AECLPQALWAKEVDVSA------LQGRVGFRCASRDRLPMVGNVPDEAATLAEYAALANQQPARDAPRLPGLYVAGALGS  613 (662)
T ss_pred             HHhCCCchhhhccCccc------cCceEEEeccCCCcccccCCCCCHHHHHHHHHhhhhccccccCCCCCCeEEEecccc
Confidence            9999976     22222      23699999999999999999                      556789999999999


Q ss_pred             CChhhhHHHHHHHHHHHhCCCCCCC---CCCCccCCcc
Q 011027          460 LGLSLALGTAELVADMVLTNPLKVD---SAPFAVQGRC  494 (495)
Q Consensus       460 ~G~~~ap~~a~~la~~i~g~~~~~~---~~~~~p~R~~  494 (495)
                      +||++||++|++||++|+|++.|++   +++|+|+||.
T Consensus       614 ~Gl~~ap~~a~~lA~li~g~~~p~~~~~~~~~~p~Rf~  651 (662)
T PRK01747        614 RGLCSAPLGAELLASQIEGEPLPLERDLLAALHPNRFW  651 (662)
T ss_pred             cHHHHHHHHHHHHHHHHhCCCCCCCHHHHHhhChHHHH
Confidence            9999999999999999999999987   5899999996

>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>COG4121 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
1ryi_A382 Structure Of Glycine Oxidase With Bound Inhibitor G 1e-10
1ng3_A390 Complex Of Thio (Glycine Oxidase) With Acetyl-Glyci 1e-10
3if9_A382 Crystal Structure Of Glycine Oxidase G51sA54RH244A 2e-10
1y56_B382 Crystal Structure Of L-Proline Dehydrogenase From P 2e-07
2uzz_A372 X-Ray Structure Of N-Methyl-L-Tryptophan Oxidase (M 1e-04
3m0o_A389 Crystal Structure Of The Lys265met Mutant Of Monome 3e-04
1l9c_A389 Role Of Histidine 269 In Catalysis By Monomeric Sar 4e-04
1el5_A389 Complex Of Monomeric Sarcosine Oxidase With The Inh 4e-04
3m12_A389 Crystal Structure Of The Lys265arg Phosphate-Crytsa 5e-04
3bhf_A390 Crystal Structure Of R49k Mutant Of Monomeric Sarco 6e-04
>pdb|1RYI|A Chain A, Structure Of Glycine Oxidase With Bound Inhibitor Glycolate Length = 382 Back     alignment and structure 
Iteration: 1

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 152/349 (43%), Gaps = 59/349 (16%)
Query: 139 IWDLALRSNKLWKMLADSLRD-QGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCE 197
            +D A+ S +L+K L + L    G+D  Q  G    G   +  + E+++ L++      +
Sbjct: 75  FFDFAMHSQRLYKGLGEELYALSGVDIRQHNG----GMFKLAFSEEDVLQLRQ-----MD 125
Query: 198 AGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAV-AYIEKGNRHFASKGRY 256
                 + S  ++L+ EP    G+   A+F+  D  ++      AY++      A+K   
Sbjct: 126 DLDSVSWYSKEEVLEKEP-YASGDIFGASFIQDDVHVEPYFVCKAYVK------AAKMLG 178
Query: 257 AE-FYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVL 315
           AE F H PV  + R    GE   ++T    +++   +VVA+G WSG          ++ L
Sbjct: 179 AEIFEHTPVLHVERD---GEALFIKTPSGDVWANH-VVVASGVWSGMFF------KQLGL 228
Query: 316 DIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDV 375
           +    P KG  L + N + + L           +HD         H  I+          
Sbjct: 229 NNAFLPVKGECLSVWN-DDIPLTKTL-------YHD---------HCYIVPRKS------ 265
Query: 376 IGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYM 435
            G LV+G++ +   ++   +   ++ + K+A    P ++++ +  F +      GLRP  
Sbjct: 266 -GRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWA------GLRPGT 318
Query: 436 PDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVD 484
            DGKP IG  P  S++  A GH   G+ LA  T  L++D+++   +  D
Sbjct: 319 KDGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKEVNQD 367
>pdb|1NG3|A Chain A, Complex Of Thio (Glycine Oxidase) With Acetyl-Glycine Length = 390 Back     alignment and structure
>pdb|3IF9|A Chain A, Crystal Structure Of Glycine Oxidase G51sA54RH244A MUTANT IN COMPLEX With Inhibitor Glycolate Length = 382 Back     alignment and structure
>pdb|1Y56|B Chain B, Crystal Structure Of L-Proline Dehydrogenase From P.Horikoshii Length = 382 Back     alignment and structure
>pdb|2UZZ|A Chain A, X-Ray Structure Of N-Methyl-L-Tryptophan Oxidase (Mtox) Length = 372 Back     alignment and structure
>pdb|3M0O|A Chain A, Crystal Structure Of The Lys265met Mutant Of Monomeric Sarcosine Oxidase Length = 389 Back     alignment and structure
>pdb|1L9C|A Chain A, Role Of Histidine 269 In Catalysis By Monomeric Sarcosine Oxidase Length = 389 Back     alignment and structure
>pdb|1EL5|A Chain A, Complex Of Monomeric Sarcosine Oxidase With The Inhibitor Dimethylglycine Length = 389 Back     alignment and structure
>pdb|3M12|A Chain A, Crystal Structure Of The Lys265arg Phosphate-Crytsallized Mu Monomeric Sarcosine Oxidase Length = 389 Back     alignment and structure
>pdb|3BHF|A Chain A, Crystal Structure Of R49k Mutant Of Monomeric Sarcosine Oxidase Crystallized In Peg As Precipitant Length = 390 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 9e-68
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 2e-44
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 4e-39
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 5e-39
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 2e-38
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 6e-38
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 5e-37
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 3e-36
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 7e-35
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 5e-25
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 1e-21
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 2e-16
3dme_A369 Conserved exported protein; structural genomics, P 2e-16
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 1e-15
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 4e-15
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 5e-06
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 5e-06
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 5e-06
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 7e-06
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 1e-05
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 1e-05
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 2e-05
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 4e-05
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 6e-05
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 8e-05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 1e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 1e-04
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 2e-04
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 2e-04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 3e-04
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 4e-04
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 5e-04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 5e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 6e-04
4fk1_A304 Putative thioredoxin reductase; structural genomic 7e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 7e-04
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 8e-04
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 9e-04
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 Back     alignment and structure
 Score =  221 bits (565), Expect = 9e-68
 Identities = 95/417 (22%), Positives = 171/417 (41%), Gaps = 66/417 (15%)

Query: 81  TFDVIIIGAGIIGLTIARQL-LVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTPGSE- 138
            ++ ++IG GIIG  IA  L       + A+ +        T A  G +         + 
Sbjct: 17  HYEAVVIGGGIIGSAIAYYLAKEN--KNTALFESGTMGGRTTSAAAGMLGAHAECEERDA 74

Query: 139 IWDLALRSNKLWKMLADSLRDQ-GLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCE 197
            +D A+ S +L+K L + L    G+D    I     G   +  + E+++ L++       
Sbjct: 75  FFDFAMHSQRLYKGLGEELYALSGVD----IRQHNGGMFKLAFSEEDVLQLRQMD----- 125

Query: 198 AGLRAEYLSSSDLLQAEPELMVGEDSRAA-FLPYDSQLDAM-LAVAYIEKGNRHFASKGR 255
                 + S  ++L+ EP      D   A F+  D  ++   +  AY++      A+K  
Sbjct: 126 DLDSVSWYSKEEVLEKEPYA--SGDIFGASFIQDDVHVEPYFVCKAYVK------AAKML 177

Query: 256 YAEFY-HDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIV 314
            AE + H PV  + R    GE   ++T    +++   +VVA+G WSG     L       
Sbjct: 178 GAEIFEHTPVLHVERD---GEALFIKTPSGDVWANH-VVVASGVWSGMFFKQLG------ 227

Query: 315 LDIPVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTD 374
           L+    P KG  L + N + + L         + H    + P +                
Sbjct: 228 LNNAFLPVKGECLSVWNDD-IPLTKT------LYHDHCYIVPRKS--------------- 265

Query: 375 VIGNLVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPY 434
             G LV+G++ +   ++   +   ++ + K+A    P ++++ +  F +      GLRP 
Sbjct: 266 --GRLVVGATMKPGDWSETPDLGGLESVMKKAKTMLPAIQNMKVDRFWA------GLRPG 317

Query: 435 MPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVLTNPLKVDS-APFAV 490
             DGKP IG  P  S++  A GH   G+ LA  T  L++D+++   +  D    F +
Sbjct: 318 TKDGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIMNKEVNQDWLHAFRI 374
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Length = 405 Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 382 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Length = 381 Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Length = 676 Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Length = 689 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Length = 830 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Length = 405 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query495
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 100.0
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 100.0
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 100.0
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 100.0
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 100.0
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 100.0
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 100.0
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 100.0
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 100.0
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 100.0
3dme_A369 Conserved exported protein; structural genomics, P 100.0
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 100.0
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 100.0
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 100.0
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 100.0
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 100.0
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 100.0
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 100.0
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.97
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.69
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.62
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.59
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.57
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.51
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 99.47
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.47
3atr_A453 Conserved archaeal protein; saturating double bond 99.47
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.46
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.42
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.42
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.42
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.39
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 99.38
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.38
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 99.38
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.37
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 99.37
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.37
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.36
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.35
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.34
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.34
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.34
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.34
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.33
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.32
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.32
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.28
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.27
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.27
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.25
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.25
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 99.24
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.23
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.22
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.21
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.18
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.13
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.12
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.09
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.09
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 99.08
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.07
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.04
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 99.03
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.03
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 99.03
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.0
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.0
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.99
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.99
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.97
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.97
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.95
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.94
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.92
2cul_A232 Glucose-inhibited division protein A-related PROT 98.91
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.88
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.86
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 98.84
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.84
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.84
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.83
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.81
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.8
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.8
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.79
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 98.79
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.79
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.79
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.79
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.78
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.76
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.76
2bry_A497 NEDD9 interacting protein with calponin homology a 98.75
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.75
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.75
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 98.75
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.73
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.72
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.72
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.71
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.71
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.71
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.71
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.7
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.68
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.68
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.68
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.67
4dna_A463 Probable glutathione reductase; structural genomic 98.63
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.62
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.6
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.59
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.58
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.58
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.58
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.57
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.57
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.55
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.54
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.53
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.53
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 98.52
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.5
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.49
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.47
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 98.46
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.45
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.45
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.43
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.43
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.42
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.42
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.42
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.41
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.4
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 98.4
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.4
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.37
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.37
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.37
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.37
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.34
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.33
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.31
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.31
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.3
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.29
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.28
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.27
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.25
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.21
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.21
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.2
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.19
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.18
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.18
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.16
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.14
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 98.12
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.12
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.08
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.06
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.06
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 98.04
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.02
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 98.02
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.01
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.01
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.97
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.97
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.95
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.92
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.92
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.9
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.86
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.83
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.8
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.76
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.74
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.72
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.72
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.67
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.61
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.59
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.58
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.57
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.55
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.52
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.49
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.48
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.47
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.44
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.44
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.41
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.41
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.38
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.31
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.3
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.29
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 97.27
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.26
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.25
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.23
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.18
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.18
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.16
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.12
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.1
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.09
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.09
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.07
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.05
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.03
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.02
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.02
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.01
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.0
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.0
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.97
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.95
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 96.92
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.9
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.88
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 96.85
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 96.81
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.75
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.75
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.74
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.72
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.63
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.55
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 96.55
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.38
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.26
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 96.22
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.18
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.17
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.14
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.1
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 96.05
3r9u_A315 Thioredoxin reductase; structural genomics, center 95.98
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.77
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.72
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.33
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.18
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.14
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 95.09
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.08
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 95.06
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 94.94
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.85
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.74
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.53
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 94.51
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 94.42
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 94.25
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.1
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.05
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.01
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.95
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 93.91
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 93.82
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 93.63
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.62
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.48
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 93.45
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 93.39
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 93.37
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 93.23
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 93.1
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 93.05
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.99
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 92.99
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 92.97
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.95
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.95
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 92.92
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.86
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 92.83
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.83
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 92.83
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.79
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 92.76
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 92.73
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 92.55
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.54
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 92.48
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 92.4
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 92.38
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 92.32
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.3
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 92.28
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 92.25
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.22
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 92.19
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 92.13
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.08
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.99
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 91.99
3tl2_A315 Malate dehydrogenase; center for structural genomi 91.94
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.94
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 91.93
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 91.91
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 91.85
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 91.85
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.84
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 91.83
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 91.8
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 91.77
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 91.74
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 91.63
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 91.58
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 91.58
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 91.58
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.4
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 91.35
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 91.35
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.34
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 91.34
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 91.33
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.27
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 91.26
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 91.24
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 91.15
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 91.14
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 91.13
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 91.07
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 91.03
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 91.03
3l6d_A306 Putative oxidoreductase; structural genomics, prot 90.98
4ezb_A317 Uncharacterized conserved protein; structural geno 90.97
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 90.86
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 90.84
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 90.82
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 90.81
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 90.75
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 90.72
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 90.69
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 90.68
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 90.68
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 90.65
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 90.62
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 90.58
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 90.58
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 90.52
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 90.51
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 90.45
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 90.42
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 90.37
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 90.37
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 90.36
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 90.36
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 90.35
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 90.28
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 90.27
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 90.25
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 90.23
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 90.22
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 90.22
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 90.18
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 90.18
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 90.06
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 90.04
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 89.97
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 89.94
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 89.91
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 89.88
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 89.81
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 89.77
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 89.71
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 89.68
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 89.64
1fec_A490 Trypanothione reductase; redox-active center, oxid 89.63
3ius_A286 Uncharacterized conserved protein; APC63810, silic 89.61
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 89.53
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 89.5
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 89.49
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 89.45
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 89.41
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 89.37
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 89.34
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 89.26
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 89.26
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 89.21
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 89.17
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 89.11
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 89.07
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 89.01
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 88.98
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 88.8
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 88.76
1vpd_A299 Tartronate semialdehyde reductase; structural geno 88.75
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 88.71
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 88.69
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 88.6
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 88.58
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 88.58
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 88.57
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 88.57
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 88.57
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 88.52
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 88.48
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 88.46
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 88.39
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 88.29
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 88.28
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 88.27
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 88.24
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.24
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 88.23
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 88.23
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 88.19
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.18
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 88.17
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 88.17
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 88.14
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 88.12
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 88.12
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 88.02
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 88.0
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 87.98
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 87.97
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 87.88
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 87.84
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 87.83
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 87.72
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 87.66
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 87.65
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 87.59
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 87.55
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 87.47
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 87.45
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 87.16
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 86.99
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 86.98
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 86.97
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 86.96
4dna_A463 Probable glutathione reductase; structural genomic 86.9
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 86.87
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 86.84
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 86.82
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 86.8
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 86.77
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 86.71
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 86.67
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 86.53
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 86.53
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 86.44
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 86.44
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 86.42
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 86.39
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 86.37
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 86.32
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 86.31
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 86.27
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 86.24
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 86.23
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 86.14
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 85.96
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 85.96
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 85.79
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 85.46
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 85.28
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 85.14
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 84.96
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 84.8
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 84.77
2rir_A300 Dipicolinate synthase, A chain; structural genomic 84.58
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 84.45
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 84.41
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 84.32
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 84.28
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 84.21
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 84.17
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 84.15
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 84.13
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 84.11
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 84.11
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 84.1
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 84.0
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 83.92
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 83.83
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 83.73
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 83.68
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 83.64
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 83.54
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 83.52
4gx0_A565 TRKA domain protein; membrane protein, ION channel 83.5
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 83.72
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 83.07
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 83.03
4g65_A461 TRK system potassium uptake protein TRKA; structur 82.91
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 82.9
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 82.81
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 82.79
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 82.66
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 82.61
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
Probab=100.00  E-value=3e-54  Score=463.49  Aligned_cols=416  Identities=18%  Similarity=0.207  Sum_probs=324.7

Q ss_pred             eceeecccccccccccccccceee-eecCCCCCcccc-ccccCCCCCcCCCCCCCCCCCCCCCCCCCcccEEEECCCHHH
Q 011027           16 QESVNVWGSRGRRQSCRTSAAFAF-KSSFFGKKPLSL-SVNKTRPGRALGPTGYSRLNPITASSRCHTFDVIIIGAGIIG   93 (495)
Q Consensus        16 ~~~~~~~~~~~~~~~~l~~~gf~~-k~~g~g~kr~~l-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dVvIIGaGiaG   93 (495)
                      +++++||++++.||++|.++||.+ |.|+||+||+|+ +....+.. ....+|.....+      ...+||+|||||++|
T Consensus       204 g~~~~t~~~~~~vr~~l~~aGf~~~~~~~~~~k~~~~~~~~~~~~~-~~~~~~~~~~~~------~~~~DVvIIGgGiaG  276 (689)
T 3pvc_A          204 GGTFSTFTAAGFVRRGLQQAGFNVTKVKGFGQKREMLTGTLPQQIH-APTAPWYHRPAA------TRCDDIAIIGGGIVS  276 (689)
T ss_dssp             EEEEEESCCCHHHHHHHHHTTCEEEEEECSSSSCEEEEEECCSCCC-CCCCGGGCCCCC------SCCSSEEEECCSHHH
T ss_pred             CCEEEeccCcHHHHHHHHhCCeEEEeccCCCccccccccccccccc-cccCCCccCccc------CCCCCEEEECCcHHH
Confidence            579999999999999999999999 999999999999 65431111 112334322211      125899999999999


Q ss_pred             HHHHHHHHhcCCccEEEEcCC-cCCCCcccCCcceeeeccCCCCchHHHHHH----HHHHHHHHHHHHHHhcCCCCcccc
Q 011027           94 LTIARQLLVGSDLSVAVVDKV-VPCSGATGAGQGYIWMVHRTPGSEIWDLAL----RSNKLWKMLADSLRDQGLDPLQVI  168 (495)
Q Consensus        94 ls~A~~La~~~G~~V~liE~~-~~~~gaS~~~~g~i~~~~~~~~~~~~~l~~----~~~~~~~~~~~~~~~~~~~~~~~~  168 (495)
                      +++|++|+ ++|++|+|||++ .++.|+|++++|.+++..........++..    .+.++|+++..    .+++    +
T Consensus       277 lsaA~~La-~~G~~V~vlEk~~~~g~gaS~~~~G~l~~~~~~~~~~~~~~~~~~~~~a~~~~~~l~~----~~~~----~  347 (689)
T 3pvc_A          277 ALTALALQ-RRGAVVTLYCADAQPAQGASGNRQGALYPLLNGKNDALETFFTSAFTFARRQYDQLLE----QGIA----F  347 (689)
T ss_dssp             HHHHHHHH-TTTCCEEEEESSSSTTCSGGGCSCEEECCCCCSSCSHHHHHHHHHHHHHHHHHHHHHH----TTCC----C
T ss_pred             HHHHHHHH-HCCCcEEEEeCCCccccccccccCCEEecCCCCCChHHHHHHHHHHHHHHHHHHHhhh----hccc----c
Confidence            99999998 599999999997 578899999999998876655444555543    35555555421    3433    5


Q ss_pred             ceEeeeeEEEecCHHHHHHHHHHHHHHHHcCCceE---EcChhhHHHhCCCCccCCcceEEEeCCCceecHHHHHHHHHH
Q 011027          169 GWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAE---YLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEK  245 (495)
Q Consensus       169 ~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~g~~~~---~~~~~~~~~~~p~l~~~~~~~~~~~~~~g~~~p~~~~~~l~~  245 (495)
                      .+..+|.+.+..++...+.+..    +...+++.+   +++.+++.+++| +  +...++++++.+++++|..+++.|.+
T Consensus       348 ~~~~~g~l~~~~~~~~~~~~~~----~~~~g~~~~~~~~l~~~~~~~~~~-l--~~~~gg~~~p~~g~v~p~~l~~aL~~  420 (689)
T 3pvc_A          348 DHQWCGVSQLAFDDKSRGKIEK----MLHTQWPVEFAEAMSREQLSELAG-L--DCAHDGIHYPAGGWLCPSDLTHALMM  420 (689)
T ss_dssp             CEECCCEEEECCSHHHHHHHHH----HTTSCCCTTTCEEECHHHHHHHHS-S--CCSSCEEEETTCEEECHHHHHHHHHH
T ss_pred             ccccCceEEeccCHHHHHHHHH----HHhcCCChHHhhccCHHHHHHhcC-C--CcccceEEecCCeEECHHHHHHHHHH
Confidence            6788999999888766554443    234566644   899999998887 4  44678999999999999999999999


Q ss_pred             HhhhhccCCceeEEecCceeEEEEecCCCcEEEEEcCCCe-eeecCeEEEccCcchHHHHHHhhhccccccccceeecce
Q 011027          246 GNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNT-LYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIPVKPRKG  324 (495)
Q Consensus       246 ~~~~~g~~~~~~~~~~~~V~~l~~~~~~~~~~~v~~~~g~-~~~a~~VV~A~G~~s~~l~~~l~~~~~~~~~~~l~~~rg  324 (495)
                      .+++.|    ++++++++|++|..+  +++ |.|.+.+|. .+.+|.||+|+|+|+..+.+.+        .+|+.|+||
T Consensus       421 ~a~~~G----v~i~~~t~V~~l~~~--~~~-v~V~t~~G~~~i~Ad~VVlAtG~~s~~l~~~~--------~lpl~p~rG  485 (689)
T 3pvc_A          421 LAQQNG----MTCHYQHELQRLKRI--DSQ-WQLTFGQSQAAKHHATVILATGHRLPEWEQTH--------HLPLSAVRG  485 (689)
T ss_dssp             HHHHTT----CEEEESCCEEEEEEC--SSS-EEEEEC-CCCCEEESEEEECCGGGTTCSTTTT--------TSCCEEEEE
T ss_pred             HHHhCC----CEEEeCCeEeEEEEe--CCe-EEEEeCCCcEEEECCEEEECCCcchhcccccc--------CCccccccC
Confidence            998876    689999999999886  343 688888875 5667999999999998887653        479999999


Q ss_pred             eEEEEeecCcc-ccccccccccccccccCCCCCCCcccccceeeeeeeeeec--cccEEecccccccCCCccccHHHHHH
Q 011027          325 HLLVLENFNSL-KLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDV--IGNLVLGSSRQFAGFNTEVEQTIIDR  401 (495)
Q Consensus       325 q~~~~~~~~~~-~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~g~~~iG~t~~~~~~~~~~~~~~~~~  401 (495)
                      |++.++..+.. .++..++..+|                        ..|..  +|.+++|++++.++.+..++.++.+.
T Consensus       486 q~~~~~~~~~~~~l~~v~~~~~Y------------------------l~P~~~~~g~~~iGat~~~~~~d~~~~~~~~~~  541 (689)
T 3pvc_A          486 QVSHIPTTPVLSQLQQVLCYDGY------------------------LTPVNPANQHHCIGASYQRGDIATDFRLTEQQE  541 (689)
T ss_dssp             EEEEEECCTTGGGCCSEEESSSE------------------------ECCCBTTTTEEEEECCCEETBCCCCCCHHHHHH
T ss_pred             cEEEECCCCccccCCeeEeCCce------------------------EccccCCCCeEEEEEeccCCCCCCCCCHHHHHH
Confidence            99999865432 22233332222                        22444  67899999998888888889999999


Q ss_pred             HHHHHHhhcCCcccccccccccCceeeeeeccCCCCCCcEEeecCC-------------------------------CCc
Q 011027          402 IWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPG-------------------------------LSK  450 (495)
Q Consensus       402 ~~~~l~~~~p~l~~~~~~~~~~~~~~~~g~r~~t~D~~Piig~~~~-------------------------------~~~  450 (495)
                      +++.+.+++|.+......+.. ..+.|+|+|++|+|++|+||++|+                               .+|
T Consensus       542 ll~~l~~~~P~l~~~~~~~~~-~~~~w~G~R~~t~D~lPiiG~~p~~~~~~~~y~~l~~~~~~~~~~~~~~~~~~~~~~~  620 (689)
T 3pvc_A          542 NRERLLRCLPQVSWPQQVDVS-DNQARCGVRCAIRDHLPMVGAVPDYAATLAQYQDLSRRIQHGGESEVNDIAVAPVWPE  620 (689)
T ss_dssp             HHHHHHHHCTTCSGGGGCCCT-TCCEEEEEEEECTTSCCEEEEEECHHHHHHHSTTHHHHC--------CCCCCCCEEEE
T ss_pred             HHHHHHHhCCCcccccccccc-ccceeEEEeeecCCCCcccCcCCCHHHHHHHHHhhhccccccccccccccccCCCCCC
Confidence            999999999997621100100 134799999999999999999986                               689


Q ss_pred             EEEEecCCCCChhhhHHHHHHHHHHHhCCCCCCC---CCCCccCCcc
Q 011027          451 VFLATGHEGLGLSLALGTAELVADMVLTNPLKVD---SAPFAVQGRC  494 (495)
Q Consensus       451 l~~~~G~g~~G~~~ap~~a~~la~~i~g~~~~~~---~~~~~p~R~~  494 (495)
                      +|+++||||+||++||++|++||++|+|++.|+|   ++.|+|+||+
T Consensus       621 l~~a~G~g~~Gl~~ap~~ae~lA~~i~g~~~p~~~~~l~~~~p~Rf~  667 (689)
T 3pvc_A          621 LFMVGGLGSRGLCSAPLVAEILAAQMFGEPLPLDAKTLAALNPNRFW  667 (689)
T ss_dssp             EEEEECCTTCHHHHHHHHHHHHHHHHTTCCCSSCHHHHHTTCTTHHH
T ss_pred             hHHhhcccccHHHHHHHHHHHHHHHHcCCCCCCCHHHHhhcChhHHH
Confidence            9999999999999999999999999999999999   8999999996
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 495
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 1e-13
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 4e-13
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 0.001
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 4e-10
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 5e-07
d1kifa1246 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N 4e-09
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-08
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 3e-06
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-07
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 1e-07
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 3e-07
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 5e-07
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 9e-07
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 1e-06
d1kifa293 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus 3e-06
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 1e-05
d1c0pa295 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodot 1e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-05
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 2e-05
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 3e-05
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 3e-05
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 4e-05
d1ryia288 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillu 7e-05
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 8e-05
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 1e-04
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-04
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 4e-04
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 4e-04
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 5e-04
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 5e-04
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 6e-04
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 7e-04
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 8e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 0.001
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 0.001
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 0.001
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 0.002
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 0.002
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.002
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 0.002
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 0.003
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 0.003
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 0.003
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.004
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 0.004
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 0.004
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 0.004
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: N,N-dimethylglycine oxidase
species: Arthrobacter globiformis [TaxId: 1665]

 Score = 69.0 bits (167), Expect = 1e-13
 Identities = 58/362 (16%), Positives = 107/362 (29%), Gaps = 59/362 (16%)

Query: 81  TFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDK--VVPCSGATGAGQGYIWMVHRTPGSE 138
           T  ++IIGAGI+G  +A +L+     ++ V+D+  +    G+T    G ++     P   
Sbjct: 1   TPRIVIIGAGIVGTNLADELVTRGWNNITVLDQGPLNMPGGSTSHAPGLVF--QTNPSKT 58

Query: 139 IWDLALRSNKLWKMLADSLRDQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEA 198
           +   A  + +             L    V  + Q G L +  T   L  LK ++      
Sbjct: 59  MASFAKYTVEKLLS---------LTEDGVSCFNQVGGLEVATTETRLADLKRKLGYAAAW 109

Query: 199 GLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAMLAVAYIEKGNRHFASKGRYAE 258
           G+    LS ++  +  P L          +P D    A  AV  + K             
Sbjct: 110 GIEGRLLSPAECQELYPLLDGENILGGLHVPSDGLASAARAVQLLIKRTESA----GVTY 165

Query: 259 FYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDIP 318
                VT + +S   G V  VQT+   + +   +V  AG W   +               
Sbjct: 166 RGSTTVTGIEQSG--GRVTGVQTADGVIPADI-VVSCAGFWGAKIGAM------------ 210

Query: 319 VKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGN 378
                             +  A    G     +     G      +           +  
Sbjct: 211 ------------------IGMAVPPDGGPLLGESKELDGFYVAEAVWVTHSAGVAKAMAE 252

Query: 379 LVLGSSRQFAGFNTEVEQTIIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDG 438
           L+     +      ++ +   + +     E+  +             ++   L P  P  
Sbjct: 253 LLTTGRSETDLGECDITR--FEDVQL-TPEYVSETSQQNFV------EIYDVLHPLQPRL 303

Query: 439 KP 440
            P
Sbjct: 304 SP 305
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Length = 93 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Length = 95 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 88 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query495
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 100.0
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 100.0
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.98
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 99.79
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 99.72
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.65
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.59
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.57
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.55
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.41
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.35
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.34
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.33
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.32
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.18
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.17
d1ryia288 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.07
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.03
d1kifa293 D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823 98.99
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.95
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.93
d1c0pa295 D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 98.91
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.91
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.91
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.87
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.84
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.84
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.76
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.75
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.72
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.66
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.64
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.54
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.5
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.5
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.48
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 98.45
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.44
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.43
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.39
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.39
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.34
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.32
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.32
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.29
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.27
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.27
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.25
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.25
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.22
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.22
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.17
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.17
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.17
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.17
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.17
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.15
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.12
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.11
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.11
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 98.1
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.05
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.04
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.04
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.01
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.94
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.91
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.91
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.9
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.89
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.86
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.83
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.73
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.72
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.62
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.54
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.41
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.36
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 97.33
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.3
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.22
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.17
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.13
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.05
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.02
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.96
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.92
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.76
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 96.69
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.65
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.61
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.61
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.47
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.34
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.33
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.15
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.04
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 95.98
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.88
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.53
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 95.43
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 95.38
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.25
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.15
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.93
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.73
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.43
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.37
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.2
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.18
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.01
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.76
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.72
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.47
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 93.44
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 93.26
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 93.16
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.16
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 93.14
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.08
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 92.98
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.95
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 92.8
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.8
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 92.34
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.16
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.15
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.02
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.85
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.84
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 91.26
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.11
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.07
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.05
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.88
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 90.85
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.84
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.71
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.5
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.82
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.68
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.62
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.58
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 89.52
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.37
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 89.22
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 89.21
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 89.19
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 88.83
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 88.74
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 88.68
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 88.61
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 88.3
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.25
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 88.2
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.09
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 87.88
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 87.79
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 87.58
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.43
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 87.41
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 87.4
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 87.22
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 87.21
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.04
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 87.02
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 86.98
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 86.97
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.55
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 86.51
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 85.72
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 85.7
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.2
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 84.46
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.64
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 83.08
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 82.91
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 82.4
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.95
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 81.91
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 81.83
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 81.3
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 81.22
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 81.05
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 80.14
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glycine oxidase ThiO
species: Bacillus sp. [TaxId: 1409]

Probab=100.00  E-value=3.2e-34  Score=271.94  Aligned_cols=270  Identities=26%  Similarity=0.436  Sum_probs=222.3

Q ss_pred             CcccEEEECCCHHHHHHHHHHHhcCCccEEEEcCCcCCCCcccCCcceeeeccCCC-CchHHHHHHHHHHHHHHHHHHHH
Q 011027           80 HTFDVIIIGAGIIGLTIARQLLVGSDLSVAVVDKVVPCSGATGAGQGYIWMVHRTP-GSEIWDLALRSNKLWKMLADSLR  158 (495)
Q Consensus        80 ~~~dVvIIGaGiaGls~A~~La~~~G~~V~liE~~~~~~gaS~~~~g~i~~~~~~~-~~~~~~l~~~~~~~~~~~~~~~~  158 (495)
                      .++||+||||||+|+++||+|+ ++|++|+||||+.+++|+|++++|++++..... .....++..++.++|+++.....
T Consensus         3 ~~~DvvIIGaGi~Gls~A~~La-~~G~~V~vlE~~~~~~gaS~~~~G~l~~~~~~~~~~~~~~l~~~s~~~~~~l~~~~~   81 (276)
T d1ryia1           3 RHYEAVVIGGGIIGSAIAYYLA-KENKNTALFESGTMGGRTTSAAAGMLGAHAECEERDAFFDFAMHSQRLYKGLGEELY   81 (276)
T ss_dssp             SEEEEEEECCSHHHHHHHHHHH-HTTCCEEEECSSSTTTTHHHHCCCBCCGGGSCSSCSHHHHHHHHHHHHTTTHHHHHH
T ss_pred             ccCCEEEECcCHHHHHHHHHHH-HCCCcEEEEeCCCCCCCcccccccccccccccccccccchhhhhhhhhccccccccc
Confidence            4699999999999999999998 599999999999999999999999998775543 34567888899999988765543


Q ss_pred             -hcCCCCccccceEeeeeEEEecCHHHHHHHHHHHHHHHHcCCceEEcChhhHHHhCCCCccCCcceEEEeCCCceecHH
Q 011027          159 -DQGLDPLQVIGWKQTGSLLIGRTPEELVMLKERVKQLCEAGLRAEYLSSSDLLQAEPELMVGEDSRAAFLPYDSQLDAM  237 (495)
Q Consensus       159 -~~~~~~~~~~~~~~~g~l~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~p~l~~~~~~~~~~~~~~g~~~p~  237 (495)
                       ..+++    +.+..+|.+.+..++.+...++...     .....+.++.+++.+.+|.+. ....+++|.|.+++++|.
T Consensus        82 ~~~g~~----~~~~~~g~l~l~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~p~~~-~~~~g~~~~~~~g~i~~~  151 (276)
T d1ryia1          82 ALSGVD----IRQHNGGMFKLAFSEEDVLQLRQMD-----DLDSVSWYSKEEVLEKEPYAS-GDIFGASFIQDDVHVEPY  151 (276)
T ss_dssp             HHHCCC----CCCBCCCEEEEESSHHHHHHHHTTT-----TSTTEEEEEHHHHHHHCTTSC-TTCCEEEEETTCCBCCHH
T ss_pred             cccccc----cccccccceeeeeeccccccccccc-----ccccccccccccccccCcccc-cceeEEEEeccceeeecc
Confidence             24443    5688899999998876655433211     123578899999999999876 456789999999999999


Q ss_pred             HHHHHHHHHhhhhccCCceeEEecCceeEEEEecCCCcEEEEEcCCCeeeecCeEEEccCcchHHHHHHhhhcccccccc
Q 011027          238 LAVAYIEKGNRHFASKGRYAEFYHDPVTCLLRSNSTGEVEAVQTSKNTLYSKKAIVVAAGCWSGSLMHDLLRETEIVLDI  317 (495)
Q Consensus       238 ~~~~~l~~~~~~~g~~~~~~~~~~~~V~~l~~~~~~~~~~~v~~~~g~~~~a~~VV~A~G~~s~~l~~~l~~~~~~~~~~  317 (495)
                      ++++.|.+.+++.|    ++++++++|++|.++   +++|.|.|++|++. ||.||+|+|+|+..|++.+      +   
T Consensus       152 ~~~~~l~~~~~~~G----v~i~~~~~V~~i~~~---~~~~~V~t~~g~i~-a~~vV~AaG~~s~~l~~~~------G---  214 (276)
T d1ryia1         152 FVCKAYVKAAKMLG----AEIFEHTPVLHVERD---GEALFIKTPSGDVW-ANHVVVASGVWSGMFFKQL------G---  214 (276)
T ss_dssp             HHHHHHHHHHHHTT----CEEETTCCCCEEECS---SSSEEEEETTEEEE-EEEEEECCGGGTHHHHHHT------T---
T ss_pred             cchhHHHHHHHHcC----CEEecceEEEeEEee---cceEEEecCCeEEE-cCEEEECCCccHHHHHhhc------C---
Confidence            99999999999887    689999999999863   55689999998765 5999999999999887752      1   


Q ss_pred             ceeecceeEEEEeecCccccccccccccccccccCCCCCCCcccccceeeeeeeeeeccccEEecccccccCCCccccHH
Q 011027          318 PVKPRKGHLLVLENFNSLKLNHASMEAGYVGHHDLTLHPGQVNHGQILSISMTATTDVIGNLVLGSSRQFAGFNTEVEQT  397 (495)
Q Consensus       318 ~l~~~rgq~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~iG~t~~~~~~~~~~~~~  397 (495)
                       +                                                      .                       
T Consensus       215 -~------------------------------------------------------~-----------------------  216 (276)
T d1ryia1         215 -L------------------------------------------------------N-----------------------  216 (276)
T ss_dssp             -C------------------------------------------------------C-----------------------
T ss_pred             -C------------------------------------------------------C-----------------------
Confidence             0                                                      0                       


Q ss_pred             HHHHHHHHHHhhcCCcccccccccccCceeeeeeccCCCCCCcEEeecCCCCcEEEEecCCCCChhhhHHHHHHHHHHHh
Q 011027          398 IIDRIWKRAAEFYPKLRDLCLADFISNRKVRIGLRPYMPDGKPVIGPVPGLSKVFLATGHEGLGLSLALGTAELVADMVL  477 (495)
Q Consensus       398 ~~~~~~~~l~~~~p~l~~~~~~~~~~~~~~~~g~r~~t~D~~Piig~~~~~~~l~~~~G~g~~G~~~ap~~a~~la~~i~  477 (495)
                                                           ++|..|+++..|...++++++|+.++|+..+|..|++++++++
T Consensus       217 -------------------------------------~~~~~p~~~~~p~~~~~~~~~g~~~~gi~~~p~~g~~i~~~~~  259 (276)
T d1ryia1         217 -------------------------------------NADGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALISDLIM  259 (276)
T ss_dssp             -------------------------------------CCSSCCEEEEETTEEEEEEEECCSSCTTTTHHHHHHHHHHHHT
T ss_pred             -------------------------------------cccccceeccccCCCCEEECCCCCCCeEEECccHHHHHHHHHh
Confidence                                                 1345578888888888999999999999999999999999999


Q ss_pred             CCCCCCC-CCCCccCC
Q 011027          478 TNPLKVD-SAPFAVQG  492 (495)
Q Consensus       478 g~~~~~~-~~~~~p~R  492 (495)
                      +...+.+ +++|+|+|
T Consensus       260 ~~~~~~~~l~~f~~dr  275 (276)
T d1ryia1         260 NKEVNQDWLHAFRIDR  275 (276)
T ss_dssp             TCCCCHHHHHHTCSCC
T ss_pred             cCCCCcccccCCCCCC
Confidence            8887765 79999998
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia2 d.16.1.3 (A:219-306) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1kifa2 d.16.1.3 (A:195-287) D-aminoacid oxidase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c0pa2 d.16.1.3 (A:1194-1288) D-aminoacid oxidase {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure