Citrus Sinensis ID: 011963

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470----

MTKGDDAVMRRRNKAKIKKLNNKNTSSNVSARVAAVIAAKKRRKSGKRRQCQGMCFSLPTLDDPFNDRYDKRETETKATKKRNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNR

cccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHcHHHHHcccHHHHccccccccHHHccccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHccccccccccccccccccccccccHHHHcHHHHHHHHHHcccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHcccccEEEEcccHHHHHHHcccccccccEEEEEEccccccccccHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEcccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHHHHcccEEEcccHHHHHHHccc

cccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccEcccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHHHHHHHHccccccEEEEcccccccccccccccccccccccHEEEEHHHHHHHHHHccccccccccccccccEHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcccEEEEEccHHHHHHHHccccccccEEEEEEcHHHHHHHcccHHHHHHHccccccEEEEEccccHHHHHHHHHHHccccEEEEEccccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHccccccccEEEEEEccHHHHHHHHHHHHHcccEEEcccccccHccccc

MTKGDDAVMRRRNKAKIKklnnkntssNVSARVAAVIAAKKRrksgkrrqcqgmcfslptlddpfndrydkretetkatkkrnslqldknknafvkgksavskketkrdnnekpghleQTKEKAINlknsqdkslLFIDGVekrtgnveraevhlngkscanghhgqacekldcpsKFLILCLNAIENAmrhdgveqdnplfvnswgIEFWKCYSSAKdiletsgssstIVQIAWIVATAADSIArkekegfsftgpFLLFLVSSQEKAAKVRSVCKplkafgihtvslhpgaaidhqitglrscepeflvstpERLLKLVSLKAIDVSGVSLLVVDRldslskgdtlSLIRqsisgkphtvvfndcltytsvpaVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLdhaygdhfhsepLKVLYIVGKDSKFQNLVSTLKCkgysistgsncIVSHIKNR

mtkgddavmrrrnkakikklnnkntssnvsaRVAAVIAakkrrksgkrrqcqgmcfslptlddpfndrydkretetkatkkrnslqldknknafvkgksavskketkrdnnekpghleqtkekainlknsqdkslLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTlslirqsisgkpHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLkckgysistgsncivshiknr

MTKGDDAVMrrrnkakikklnnknTssnvsarvaaviaakkrrksgkrrQCQGMCFSLPTLDDPFNDRYDkretetkatkkrNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIdvsgvsllvvdrldslsKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNR

*****************************************************MCFS*****************************************************************************LLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSH****

**************************************************************************************************************************************LLFIDG********************A****GQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAAD**************PFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYG****SEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSN*********

********MRRRNKAKIKKLNNKNTSSNVSARVAAVI*************CQGMCFSLPTLDDPFNDRYDKRETETKATKKRNSLQLDKNKNAFV********************HLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNR

*********************************************GKRRQC*GMCFSLPTLDDPFN*R***************************************************************DKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTG***********

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		474	2.2.26 [Sep-21-2011]
Q54CD6		697	Probable ATP-dependent RN	no	no	0.324	0.220	0.305	7e-10
Q5BDW4		1173	Pre-mRNA-processing ATP-d	yes	no	0.436	0.176	0.270	5e-07
Q4WT99		1211	Pre-mRNA-processing ATP-d	yes	no	0.542	0.212	0.255	1e-06
A1D373		1193	Pre-mRNA-processing ATP-d	N/A	no	0.542	0.215	0.255	2e-06
Q1DHB2		1197	Pre-mRNA-processing ATP-d	N/A	no	0.559	0.221	0.25	2e-06
A7ENE0		1114	Pre-mRNA-processing ATP-d	N/A	no	0.432	0.184	0.256	3e-06
A6RW79		1151	Pre-mRNA-processing ATP-d	N/A	no	0.432	0.178	0.256	3e-06
A1CQA9		1192	Pre-mRNA-processing ATP-d	N/A	no	0.436	0.173	0.270	4e-06
A2QQA8		1180	Pre-mRNA-processing ATP-d	yes	no	0.436	0.175	0.265	5e-06
Q4IP34		1207	Pre-mRNA-processing ATP-d	yes	no	0.428	0.168	0.241	6e-06

>sp\|Q54CD6\|DDX5_DICDI Probable ATP-dependent RNA helicase ddx5 OS=Dictyostelium discoideum GN=ddx5 PE=3 SV=1	Back alignment and function desciption

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 83/167 (49%), Gaps = 13/167 (7%)

Query: 211 WKCYSSAKDILETS--GSSSTIVQIAWIVATAADSIARK-------EKEGFSFTGPFLLF 261
           W    +  DI+ TS  GS  T+  +A ++      + R        EK    +TG  +L 
Sbjct: 237 WPAILTGHDIIGTSLPGSGKTLGYLAPMIPHCLARVDRGGKNKITGEKAPKQYTGILVLV 296

Query: 262 LVSSQEKAAKVRSVCKPL-KAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKL 320
           LV ++E   +V S    + + FGI T  ++ G + + QI  L   +P+ L+STP RL+++
Sbjct: 297 LVPTRELGLQVHSNTLIITQLFGIKTSVIYGGISKNLQIEQLEKEKPQILISTPGRLIEM 356

Query: 321 VSLKAIDVSGVSLLVVDRLDS-LSKG--DTLSLIRQSISGKPHTVVF 364
           +    +D+S V++LV+D  D  LSKG    L  IR  I      ++F
Sbjct: 357 IENGHVDLSSVTMLVLDEADKMLSKGLIPQLKQIRGQIRPDSQNILF 403

Probable ATP-dependent RNA helicase.
Dictyostelium discoideum (taxid: 44689)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q5BDW4\|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|Q4WT99\|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|A1D373\|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|Q1DHB2\|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1	Back alignment and function description

>sp\|A7ENE0\|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|A6RW79\|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|A1CQA9\|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|A2QQA8\|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2	Back alignment and function description

>sp\|Q4IP34\|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		474
449441810		562	PREDICTED: pre-mRNA-processing ATP-depen	0.962	0.811	0.554	1e-138
224109924		491	predicted protein [Populus trichocarpa]	0.820	0.792	0.508	1e-113
225449714		407	PREDICTED: uncharacterized protein LOC10	0.841	0.980	0.575	1e-109
356500419		563	PREDICTED: pre-mRNA-processing ATP-depen	0.843	0.710	0.494	1e-106
357439969		532	DEAD-box ATP-dependent RNA helicase [Med	0.883	0.787	0.505	1e-105
255580126		493	dead box ATP-dependent RNA helicase, put	0.656	0.630	0.612	1e-104
296090406		370	unnamed protein product [Vitis vinifera]	0.763	0.978	0.546	1e-102
20259502		522	putative ATP-dependent RNA helicase [Ara	0.833	0.756	0.450	3e-95
15226904		502	P-loop containing nucleoside triphosphat	0.833	0.786	0.450	5e-95
297822571		505	ATP binding protein [Arabidopsis lyrata	0.622	0.584	0.523	6e-84

>gi\|449441810\|ref\|XP_004138675.1\| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase prp5-like [Cucumis sativus] gi\|449517699\|ref\|XP_004165882.1\| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase prp5-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 265/478 (55%), Positives = 334/478 (69%), Gaps = 22/478 (4%)

Query: 1   MTKGDDAVMRRRNKAKIKKLNNKN-TSSNVSARVAAVIAAKKRRKSGKRRQCQGMCFSLP 59
           M KGDDA+ R+RNKA  KKL +K+  SS VSARVA++IAAKKRR SGKRRQCQGMCFSLP
Sbjct: 1   MAKGDDALTRKRNKASRKKLRSKSGDSSAVSARVASIIAAKKRRMSGKRRQCQGMCFSLP 60

Query: 60  TLDDPFNDRYDKRETETKATKKRNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQ 119
           T DDP+NDR  K++T+ K +K         +K  F K KS  +   T RD          
Sbjct: 61  TPDDPYNDRNGKKDTKVKPSKS--------SKREFPKEKSTSAPNGTLRD---------V 103

Query: 120 TKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFL 179
             E A + K     +L      ++   + ER + + N K    G   +  E    PSKFL
Sbjct: 104 CFENARSSKEGSGGTLPSGRVAKRSKTDPERTKEYGNAKGSVQGFQEEDSESSVAPSKFL 163

Query: 180 ILCLNAIENAMRHDGVEQDN-PLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVA 238
           ILCL+AIENA+ HD ++  N PLF ++WGIEFWKCYSS KDIL+TSG SST  +IAW+V+
Sbjct: 164 ILCLSAIENALYHDSIKSINKPLFADTWGIEFWKCYSSGKDILDTSGLSSTDEKIAWVVS 223

Query: 239 TAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQ 298
           +AADSIARKEKEG SF+ PFLLFLV +QEKA ++RS+CKPLKA G+HTVS+HPGA++ HQ
Sbjct: 224 SAADSIARKEKEGSSFSSPFLLFLVPNQEKATQIRSMCKPLKALGVHTVSIHPGASLGHQ 283

Query: 299 ITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSL---IRQSI 355
           I GL+SCEPEFLVSTPERLL+LV+++AID+SGVSLLVVD L+SLS+G  L +   IR+SI
Sbjct: 284 IQGLKSCEPEFLVSTPERLLELVAMQAIDISGVSLLVVDGLESLSRGGYLDMTQSIRKSI 343

Query: 356 SGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKIL 415
           S K HT+VF+D  +   VP +Q+LL G I RLSLN SVA QSACIIQS+N   S++EK+ 
Sbjct: 344 SSKLHTIVFSDSFSCAYVPFIQSLLGGPIRRLSLNTSVACQSACIIQSINFYTSEKEKLS 403

Query: 416 KGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKN 473
           K IQ LD A G     +PLK+L+I+GK+    +L + LK KG+ I  G+ C V  IKN
Sbjct: 404 KVIQALDRANGSQIRPQPLKMLFILGKECNVHDLAAALKFKGHDIVAGALCGVPEIKN 461

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224109924\|ref\|XP_002315356.1\| predicted protein [Populus trichocarpa] gi\|222864396\|gb\|EEF01527.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225449714\|ref\|XP_002268926.1\| PREDICTED: uncharacterized protein LOC100260841 isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356500419\|ref\|XP_003519029.1\| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase prp5-like [Glycine max]	Back alignment and taxonomy information

>gi\|357439969\|ref\|XP_003590262.1\| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi\|355479310\|gb\|AES60513.1\| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255580126\|ref\|XP_002530895.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223529548\|gb\|EEF31501.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|296090406\|emb\|CBI40225.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|20259502\|gb\|AAM13871.1\| putative ATP-dependent RNA helicase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|15226904|ref|NP_180427.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|4580397|gb|AAD24375.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana] gi|29824179|gb|AAP04050.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana] gi|330253053|gb|AEC08147.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297822571\|ref\|XP_002879168.1\| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297325007\|gb\|EFH55427.1\| ATP binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		474
TAIR\|locus:2065494		502	AT2G28600 [Arabidopsis thalian	0.628	0.593	0.5	1.6e-87
DICTYBASE\|DDB_G0292010		777	DDB_G0292010 [Dictyostelium di	0.316	0.193	0.259	4.1e-05

TAIR\|locus:2065494 AT2G28600 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 751 (269.4 bits), Expect = 1.6e-87, Sum P(3) = 1.6e-87
 Identities = 159/318 (50%), Positives = 215/318 (67%)

Query:   167 QACEKLDCPSKFLILCLNAIENAMRHD---GVEQDNPLFVNSWGIEFWKCYSSAKDILET 223
             +  EK+D P KFL+L LN IE++ R D     + D  LF +SWGIEFWKCYSS  DIL+T
Sbjct:    98 EGVEKMDGPPKFLMLNLNEIESSFRKDITYSEQHDKSLFTSSWGIEFWKCYSSGNDILDT 157

Query:   224 SGSSSTIVQIAWIVATAADSIARKEK----EGFSFTG--PFLLFLVSSQEKAAKVRSVCK 277
             SG SST+ QIAWIV+TAAD+IAR+EK    E     G  PFLL+LV SQ KA++VRSVCK
Sbjct:   158 SGMSSTVEQIAWIVSTAADAIARREKDEVEEEEELLGNSPFLLYLVPSQSKASQVRSVCK 217

Query:   278 PLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIXXXXXXXXXXX 337
              LK  GIHTVSLH GA +DHQI+GL+S EPEF+V+TPERLL++V+LK +           
Sbjct:   218 ALKGIGIHTVSLHQGAPLDHQISGLKSVEPEFIVATPERLLEIVTLKGVDISNVSLLVID 277

Query:   338 XXXXXXKGDTLSL---IRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVA 394
                    G  L+    I+Q+IS K  T+VFN+  + + +PAVQ+ L GS+NR+++N+SVA
Sbjct:   278 ELGSLCSGGYLNAVKSIKQAISSKHQTIVFNNSFSASIIPAVQSFLGGSVNRVTVNESVA 337

Query:   395 SQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLK 454
             SQ +CI Q+V+VCAS+E+K+ K        +  H  S   K++YIV K+  F+ +++ LK
Sbjct:   338 SQGSCITQTVSVCASEEKKLQK--------FAKHLDSSSSKLIYIVTKEESFKKIMAILK 389

Query:   455 CKGYSISTGSNCIVSHIK 472
              KG S+ST S+  +S +K
Sbjct:   390 LKGISVSTSSDSKLSEVK 407

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008026 "ATP-dependent helicase activity" evidence=IEA

GO:0000741 "karyogamy" evidence=RCA

GO:0001510 "RNA methylation" evidence=RCA

GO:0009560 "embryo sac egg cell differentiation" evidence=RCA

DICTYBASE\|DDB_G0292010 DDB_G0292010 [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.X.3007.1	hypothetical protein (487 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		474
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	4e-07
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	3e-06
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	7e-06
cd00268		203	cd00268, DEADc, DEAD-box helicases	1e-05
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	4e-04
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	4e-04
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	7e-04
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	0.004

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

 Score = 50.2 bits (120), Expect = 4e-07
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 272 VRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGV 331
              + K   + G+  V L+ G +   Q+  L S + + LV+TP RLL L+    + +S V
Sbjct: 71  AEELKKLGPSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDKLSLSNV 130

Query: 332 SLLVVD---RLDSLSKGDTLSLIRQSISGKPHTVVF 364
            L+++D   RL     GD L  + + +      ++ 
Sbjct: 131 DLVILDEAHRLLDGGFGDQLEKLLKLLPKNVQLLLL 166

Length = 201

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		474
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00110		545	helicase; Provisional	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0334		997	consensus RNA helicase [RNA processing and modific	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG4284		980	consensus DEAD box protein [Transcription]	100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0327		397	consensus Translation initiation factor 4F, helica	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK09401		1176	reverse gyrase; Reviewed	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
PRK14701		1638	reverse gyrase; Provisional	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	99.98
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	99.98
PRK02362		737	ski2-like helicase; Provisional	99.98
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.98
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	99.97
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	99.97
PRK01172		674	ski2-like helicase; Provisional	99.97
PRK10689		1147	transcription-repair coupling factor; Provisional	99.96
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	99.96
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	99.95
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	99.95
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.95
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	99.95
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.95
COG1205		851	Distinct helicase family with a unique C-terminal	99.94
PHA02653		675	RNA helicase NPH-II; Provisional	99.94
COG1204		766	Superfamily II helicase [General function predicti	99.94
COG1202		830	Superfamily II helicase, archaea-specific [General	99.93
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	99.93
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.93
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.93
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.92
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	99.92
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.91
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.91
PHA02558		501	uvsW UvsW helicase; Provisional	99.91
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.9
PRK13766		773	Hef nuclease; Provisional	99.89
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.89
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.88
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.88
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.88
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.86
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.86
PRK05580		679	primosome assembly protein PriA; Validated	99.84
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.83
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.83
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.83
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.82
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.81
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.8
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.8
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	99.8
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.77
PRK09694		878	helicase Cas3; Provisional	99.75
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.73
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.72
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.72
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.71
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.69
KOG0354		746	consensus DEAD-box like helicase [General function	99.68
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.68
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.67
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.66
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.64
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.63
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.57
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.52
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.45
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.44
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.39
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.39
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.38
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.36
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.35
COG4096		875	HsdR Type I site-specific restriction-modification	99.28
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.26
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.24
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.19
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.19
PRK04914		956	ATP-dependent helicase HepA; Validated	99.19
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.17
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.16
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.11
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	99.08
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	99.08
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	99.05
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	98.95
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	98.94
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	98.94
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	98.91
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.86
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	98.78
KOG1123		776	consensus RNA polymerase II transcription initiati	98.78
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.77
KOG2340		698	consensus Uncharacterized conserved protein [Funct	98.74
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	98.72
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	98.72
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	98.59
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	98.58
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	98.51
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	98.5
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.49
PRK14873		665	primosome assembly protein PriA; Provisional	98.48
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	98.47
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	98.46
PRK15483		986	type III restriction-modification system StyLTI en	98.45
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	98.35
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	98.35
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	98.32
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	98.25
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	98.22
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	98.13
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.11
KOG0387		923	consensus Transcription-coupled repair protein CSB	98.11
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	98.06
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	98.06
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	98.02
COG4889		1518	Predicted helicase [General function prediction on	97.99
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.9
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	97.79
COG0610		962	Type I site-specific restriction-modification syst	97.78
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	97.76
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	97.75
PRK10875		615	recD exonuclease V subunit alpha; Provisional	97.74
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.7
TIGR00376		637	DNA helicase, putative. The gene product may repre	97.6
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	97.58
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	97.49
PRK10536		262	hypothetical protein; Provisional	97.39
KOG4439		901	consensus RNA polymerase II transcription terminat	97.38
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.35
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	97.34
PRK13889		988	conjugal transfer relaxase TraA; Provisional	97.33
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	97.32
COG3587		985	Restriction endonuclease [Defense mechanisms]	97.27
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.13
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.07
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	97.07
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	97.07
PF13245		76	AAA_19: Part of AAA domain	96.97
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	96.95
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	96.83
PRK04296		190	thymidine kinase; Provisional	96.63
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	96.62
PHA02533		534	17 large terminase protein; Provisional	96.56
PRK14974		336	cell division protein FtsY; Provisional	96.54
PRK05298		652	excinuclease ABC subunit B; Provisional	96.48
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	96.45
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	96.43
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	96.43
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.4
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	96.39
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.32
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.28
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.24
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	96.24
KOG1803		649	consensus DNA helicase [Replication, recombination	96.23
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.21
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	96.18
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	96.16
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	96.05
PRK13826		1102	Dtr system oriT relaxase; Provisional	95.95
PRK08181		269	transposase; Validated	95.9
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	95.87
PRK06526		254	transposase; Provisional	95.86
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	95.77
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	95.7
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	95.51
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	95.46
PRK07952		244	DNA replication protein DnaC; Validated	95.37
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	95.26
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	95.24
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	95.18
PRK08903		227	DnaA regulatory inactivator Hda; Validated	95.17
PRK05642		234	DNA replication initiation factor; Validated	95.13
smart00382		148	AAA ATPases associated with a variety of cellular	95.12
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	95.1
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	95.01
PRK05707		328	DNA polymerase III subunit delta'; Validated	94.97
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.95
PRK14087		450	dnaA chromosomal replication initiation protein; P	94.91
PTZ00112		1164	origin recognition complex 1 protein; Provisional	94.89
PRK13833		323	conjugal transfer protein TrbB; Provisional	94.86
PRK08769		319	DNA polymerase III subunit delta'; Validated	94.81
PRK06893		229	DNA replication initiation factor; Validated	94.8
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	94.78
PRK12377		248	putative replication protein; Provisional	94.71
PRK08084		235	DNA replication initiation factor; Provisional	94.71
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.69
PRK00149		450	dnaA chromosomal replication initiation protein; R	94.66
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	94.64
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	94.6
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	94.59
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	94.53
PRK08727		233	hypothetical protein; Validated	94.46
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	94.45
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.38
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	94.38
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	94.38
KOG3089		271	consensus Predicted DEAD-box-containing helicase [	94.32
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	94.3
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	94.29
KOG1805		1100	consensus DNA replication helicase [Replication, r	94.27
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	94.26
PRK10689		1147	transcription-repair coupling factor; Provisional	94.12
PRK12422		445	chromosomal replication initiation protein; Provis	94.11
PRK06921		266	hypothetical protein; Provisional	94.09
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	94.07
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	94.03
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	93.98
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	93.93
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	93.92
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	93.91
PRK00771		437	signal recognition particle protein Srp54; Provisi	93.9
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	93.83
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	93.82
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	93.77
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	93.7
PRK12402		337	replication factor C small subunit 2; Reviewed	93.52
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	93.42
PRK00411		394	cdc6 cell division control protein 6; Reviewed	93.38
PRK14088		440	dnaA chromosomal replication initiation protein; P	93.36
PRK11054		684	helD DNA helicase IV; Provisional	93.36
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	93.32
PLN03025		319	replication factor C subunit; Provisional	93.26
PRK05298		652	excinuclease ABC subunit B; Provisional	93.24
PRK08116		268	hypothetical protein; Validated	93.22
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	93.2
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	93.19
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	93.18
PF03668		284	ATP_bind_2: P-loop ATPase protein family; InterPro	93.18
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	93.12
PRK06835		329	DNA replication protein DnaC; Validated	93.11
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	92.94
PF05729		166	NACHT: NACHT domain	92.9
PRK06871		325	DNA polymerase III subunit delta'; Validated	92.85
PRK08699		325	DNA polymerase III subunit delta'; Validated	92.8
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	92.74
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	92.74
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	92.73
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	92.7
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	92.69
TIGR00064		272	ftsY signal recognition particle-docking protein F	92.69
COG1484		254	DnaC DNA replication protein [DNA replication, rec	92.68
PHA03333		752	putative ATPase subunit of terminase; Provisional	92.66
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	92.64
PRK06964		342	DNA polymerase III subunit delta'; Validated	92.62
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	92.56
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	92.52
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	92.5
PRK14086		617	dnaA chromosomal replication initiation protein; P	92.43
PTZ00110		545	helicase; Provisional	92.41
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	92.41
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	92.41
PRK13851		344	type IV secretion system protein VirB11; Provision	92.4
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	92.29
PRK07471		365	DNA polymerase III subunit delta'; Validated	92.28
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	92.28
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	92.16
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	92.1
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	92.1
COG4626		546	Phage terminase-like protein, large subunit [Gener	92.06
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	92.05
PRK08533		230	flagellar accessory protein FlaH; Reviewed	92.04
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	91.96
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	91.94
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	91.94
PRK06904		472	replicative DNA helicase; Validated	91.94
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	91.92
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	91.91
PHA03368		738	DNA packaging terminase subunit 1; Provisional	91.87
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	91.78
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	91.76
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	91.74
PRK09112		351	DNA polymerase III subunit delta'; Validated	91.73
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	91.73
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	91.7
CHL00181		287	cbbX CbbX; Provisional	91.68
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	91.66
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	91.63
cd03115		173	SRP The signal recognition particle (SRP) mediates	91.61
PRK00440		319	rfc replication factor C small subunit; Reviewed	91.59
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	91.57
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	91.55
PRK07993		334	DNA polymerase III subunit delta'; Validated	91.53
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	91.45
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	91.36
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	91.33
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	91.27
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	91.24
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	91.08
PRK11823		446	DNA repair protein RadA; Provisional	91.07
PF13173		128	AAA_14: AAA domain	91.06
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	91.05
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	91.05
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	91.02
PRK07004		460	replicative DNA helicase; Provisional	90.91
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	90.85
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	90.73
KOG0354		746	consensus DEAD-box like helicase [General function	90.69
PTZ00424		401	helicase 45; Provisional	90.61
PRK13897		606	type IV secretion system component VirD4; Provisio	90.59
PRK06090		319	DNA polymerase III subunit delta'; Validated	90.44
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	90.37
PRK08006		471	replicative DNA helicase; Provisional	90.32
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	90.24
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	90.17
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	90.1
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	90.08
PRK10867		433	signal recognition particle protein; Provisional	90.07
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	90.02
PRK08506		472	replicative DNA helicase; Provisional	89.92
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	89.85
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	89.83
PHA02544		316	44 clamp loader, small subunit; Provisional	89.73
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	89.62
TIGR02533		486	type_II_gspE general secretory pathway protein E.	89.5
KOG1001		674	consensus Helicase-like transcription factor HLTF/	89.48
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	89.42
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	89.42
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	89.28
PRK13850		670	type IV secretion system protein VirD4; Provisiona	89.24
PRK09435		332	membrane ATPase/protein kinase; Provisional	89.21
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	89.2
PRK08840		464	replicative DNA helicase; Provisional	89.18
PRK10436		462	hypothetical protein; Provisional	89.17
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	89.12
TIGR00595		505	priA primosomal protein N'. All proteins in this f	88.96
PRK05748		448	replicative DNA helicase; Provisional	88.93
PF00004		132	AAA: ATPase family associated with various cellula	88.89
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	88.87
COG1609		333	PurR Transcriptional regulators [Transcription]	88.83
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	88.82
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	88.69
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	88.64
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	88.41
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	88.41
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	88.37
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	88.36
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	88.27
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	88.22
TIGR00665		434	DnaB replicative DNA helicase. This model describe	88.21
PRK05416		288	glmZ(sRNA)-inactivating NTPase; Provisional	88.19
PHA00729		226	NTP-binding motif containing protein	88.07
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	88.06
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	88.04
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	88.02
PRK08760		476	replicative DNA helicase; Provisional	88.01
PRK13767		876	ATP-dependent helicase; Provisional	87.98
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	87.98
PRK13342		413	recombination factor protein RarA; Reviewed	87.89
PHA02244		383	ATPase-like protein	87.82
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	87.73
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	87.68
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	87.65
PRK09401		1176	reverse gyrase; Reviewed	87.59
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	87.59
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	87.53
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	87.5
PHA03372		668	DNA packaging terminase subunit 1; Provisional	87.44
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	87.36
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	87.32
PRK06321		472	replicative DNA helicase; Provisional	87.28
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	87.24
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	87.21
PRK09183		259	transposase/IS protein; Provisional	87.11
PRK04328		249	hypothetical protein; Provisional	87.07
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	87.02
TIGR00959		428	ffh signal recognition particle protein. This mode	87.0
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	86.95
PRK04195		482	replication factor C large subunit; Provisional	86.94
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	86.92
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	86.79
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	86.69
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	86.68
PRK07940		394	DNA polymerase III subunit delta'; Validated	86.58
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	86.57
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	86.46
PRK05595		444	replicative DNA helicase; Provisional	86.41
PHA02542		473	41 41 helicase; Provisional	86.41
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	86.33
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	86.31
PRK07399		314	DNA polymerase III subunit delta'; Validated	86.0
TIGR02237		209	recomb_radB DNA repair and recombination protein R	85.95
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	85.93
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	85.89
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	85.85
PRK05973		237	replicative DNA helicase; Provisional	85.73
PRK08939		306	primosomal protein DnaI; Reviewed	85.65
COG3973		747	Superfamily I DNA and RNA helicases [General funct	85.45
PRK13822		641	conjugal transfer coupling protein TraG; Provision	85.42
KOG2036		1011	consensus Predicted P-loop ATPase fused to an acet	84.96
TIGR02767		623	TraG-Ti Ti-type conjugative transfer system protie	84.93
PTZ00293		211	thymidine kinase; Provisional	84.79
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	84.77
COG2256		436	MGS1 ATPase related to the helicase subunit of the	84.52
PHA02653		675	RNA helicase NPH-II; Provisional	84.51
PRK09694		878	helicase Cas3; Provisional	84.45
PRK06067		234	flagellar accessory protein FlaH; Validated	84.4
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	84.32
PRK05636		505	replicative DNA helicase; Provisional	84.26
PRK10416		318	signal recognition particle-docking protein FtsY;	84.12
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	83.81
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	83.76
PRK04841		903	transcriptional regulator MalT; Provisional	83.72
KOG0298		1394	consensus DEAD box-containing helicase-like transc	83.66
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	83.4
PF12846		304	AAA_10: AAA-like domain	83.33
cd01127		410	TrwB Bacterial conjugation protein TrwB, ATP bindi	83.3
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	83.23
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	83.2
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	83.19
PRK13876		663	conjugal transfer coupling protein TraG; Provision	83.05
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	83.02
PRK05580		679	primosome assembly protein PriA; Validated	83.01
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	82.97
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	82.97
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	82.9
PRK13880		636	conjugal transfer coupling protein TraG; Provision	82.81
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	82.74
cd01128		249	rho_factor Transcription termination factor rho is	82.59
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	82.17
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	82.09
PRK14701		1638	reverse gyrase; Provisional	82.02
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	81.95
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	81.78
PRK09165		497	replicative DNA helicase; Provisional	81.76
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	81.67
PF10412		386	TrwB_AAD_bind: Type IV secretion-system coupling p	81.58
PRK13341		725	recombination factor protein RarA/unknown domain f	81.49
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	81.48
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	81.26
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	81.25
PRK10865		857	protein disaggregation chaperone; Provisional	80.97
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	80.91
COG2842		297	Uncharacterized ATPase, putative transposase [Gene	80.74
PF14516		331	AAA_35: AAA-like domain	80.59
COG2109		198	BtuR ATP:corrinoid adenosyltransferase [Coenzyme m	80.43
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	80.24
TIGR00073		207	hypB hydrogenase accessory protein HypB. HypB is i	80.14
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	80.1
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	80.07
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	80.02

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=6.2e-58  Score=458.38  Aligned_cols=401  Identities=23%  Similarity=0.304  Sum_probs=326.0

Q ss_pred             CCCCchHHHHhhhHHHHHhhhccCC-----CCchhHHHHHHHHhhhhcc---cCCcc----cccccccCCCCCCCccccc
Q 011963            1 MTKGDDAVMRRRNKAKIKKLNNKNT-----SSNVSARVAAVIAAKKRRK---SGKRR----QCQGMCFSLPTLDDPFNDR   68 (474)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~k~~~k---~~~~~----~~~~~~~~~~~~~~~~~~~   68 (474)
                      |||++|..++++++..+|++.+.++     .-.++++++.+++.+.++|   .+++.    +|++||+..++.++|++..
T Consensus        84 MA~~~d~~~sd~~~~e~kk~eRkn~dd~~p~~~vr~dI~~e~aae~~~kym~e~k~~~~~~e~~~~~leydsd~nPi~~~  163 (731)
T KOG0339|consen   84 MAKIEDQAQSDKKPLEQKKKERKNDDDDDPTATVRADIDEEDAAEALFKYMSENKRAGAAKECDDMCLEYDSDGNPIAPD  163 (731)
T ss_pred             hhhhhhhhhccCCccchHHHhhhccCCCccchhhhcchhhHHhHHHHHHHhhhcccchhhhhcccceeecCCCCCccCcc
Confidence            9999999999999999999988872     3468999999999999999   88887    8999999999999999983


Q ss_pred             c--chhhhhhhhhhhhhhhcccccccccccccccccccccccCCCCCCCcchhhHHHHhhhccccccccccccccccccc
Q 011963           69 Y--DKRETETKATKKRNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTG  146 (474)
Q Consensus        69 ~--~~~~~~~~~~kk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  146 (474)
                      +  .++....+.++....                      +...+..+.                   ..+|.++.....
T Consensus       164 kr~idpl~~idhs~i~y~----------------------p~~kdfy~e-------------------~esI~gl~~~d~  202 (731)
T KOG0339|consen  164 KRQIDPLPPIDHSEIDYE----------------------PFNKDFYEE-------------------HESIEGLTKMDV  202 (731)
T ss_pred             cccCCCCCCcchhhcccc----------------------ccccccccC-------------------hhhhhccccccc
Confidence            2  221111111111000                      000000000                   011222221111


Q ss_pred             ccc--ccccccCCCCCCCCCCCCcccccCCChhHHhh----hHHHHHHHHHhCCCCccccCCCchhhHHHHHHHhcCCcE
Q 011963          147 NVE--RAEVHLNGKSCANGHHGQACEKLDCPSKFLIL----CLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDI  220 (474)
Q Consensus       147 ~~e--~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~----l~~~i~~~l~~~g~~~ptpi~~~~~Q~~~i~~~l~g~dv  220 (474)
                      -.-  ..++.+.|              ++.|.+...|    +.+.|+.+++..-|.+||||     |.+++|..++|+||
T Consensus       203 ~~~r~~Lnlrv~g--------------~s~~rpvtsfeh~gfDkqLm~airk~Ey~kptpi-----q~qalptalsgrdv  263 (731)
T KOG0339|consen  203 IDLRLTLNLRVSG--------------SSPPRPVTSFEHFGFDKQLMTAIRKSEYEKPTPI-----QCQALPTALSGRDV  263 (731)
T ss_pred             hhhHhhhcceecc--------------CCCCCCcchhhhcCchHHHHHHHhhhhcccCCcc-----cccccccccccccc
Confidence            000  01111111              2333333333    68999999999999999999     99999999999999


Q ss_pred             EEEcCCCcchhHHHHHHHHHHHHHHhhhhcCCCCCCcEEEEEeccHHHHHHHHHHHHhc-ccCCcEEEEEecCCCHHHHH
Q 011963          221 LETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPL-KAFGIHTVSLHPGAAIDHQI  299 (474)
Q Consensus       221 l~~A~TG~SGKTlaf~lp~l~~l~~~~~~~~~~~~~~~alil~PtreLa~Qi~~~~~~l-~~~~i~v~~~~gg~~~~~q~  299 (474)
                      +.+|.|| ||||.||+.|++.+++.+++-..  ..+|.+|||+||||||.||+.+|++| +.+||+++++|||.+..+|.
T Consensus       264 igIAktg-SgktaAfi~pm~~himdq~eL~~--g~gPi~vilvPTrela~Qi~~eaKkf~K~ygl~~v~~ygGgsk~eQ~  340 (731)
T KOG0339|consen  264 IGIAKTG-SGKTAAFIWPMIVHIMDQPELKP--GEGPIGVILVPTRELASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQS  340 (731)
T ss_pred             hheeecc-CcchhHHHHHHHHHhcchhhhcC--CCCCeEEEEeccHHHHHHHHHHHHHhhhhccceEEEeecCCcHHHHH
Confidence            9999999 99999999999999999876553  37999999999999999999999999 66799999999999999999


Q ss_pred             HHHhcCCCcEEEEChHHHHHHHHcCCCCCCCcceEEeccccccCC---hhHHHHHHhhCCCCCcEEEEEccCCccHHHHH
Q 011963          300 TGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSK---GDTLSLIRQSISGKPHTVVFNDCLTYTSVPAV  376 (474)
Q Consensus       300 ~~l~~~~~~IlV~TP~rL~~ll~~~~~~l~~l~~lViDEad~ll~---~~~l~~Il~~l~~~~q~llfSAT~~~~v~~l~  376 (474)
                      ..|.. +|+|||||||||++++..+..++.++.||||||||+|++   ..+++.|..++.+++|+|+|||||+..++.++
T Consensus       341 k~Lk~-g~EivVaTPgRlid~VkmKatn~~rvS~LV~DEadrmfdmGfe~qVrSI~~hirpdrQtllFsaTf~~kIe~la  419 (731)
T KOG0339|consen  341 KELKE-GAEIVVATPGRLIDMVKMKATNLSRVSYLVLDEADRMFDMGFEPQVRSIKQHIRPDRQTLLFSATFKKKIEKLA  419 (731)
T ss_pred             Hhhhc-CCeEEEechHHHHHHHHhhcccceeeeEEEEechhhhhccccHHHHHHHHhhcCCcceEEEeeccchHHHHHHH
Confidence            99997 999999999999999999999999999999999999999   99999999999999999999999999999999


Q ss_pred             HHhhcCCceEEEccCCcccccCCcEEEEEEcCCchhHHHHHHHHHHHHhhccCCCCCCcEEEEEccchhHHHHHHHHhhC
Q 011963          377 QNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCK  456 (474)
Q Consensus       377 ~~~l~~p~~~v~v~~~~~~~~~~i~q~~~~~~~~~~K~~~l~~lL~~ll~~~~~~~~~k~LVF~~s~~~a~~l~~~L~~~  456 (474)
                      +.+|.+|+ .|..+.. ...+..|+|.+.+|++...|+.+|+..|..+.      ..+++||||.-...++.++..|...
T Consensus       420 rd~L~dpV-rvVqg~v-gean~dITQ~V~V~~s~~~Kl~wl~~~L~~f~------S~gkvlifVTKk~~~e~i~a~Lklk  491 (731)
T KOG0339|consen  420 RDILSDPV-RVVQGEV-GEANEDITQTVSVCPSEEKKLNWLLRHLVEFS------SEGKVLIFVTKKADAEEIAANLKLK  491 (731)
T ss_pred             HHHhcCCe-eEEEeeh-hccccchhheeeeccCcHHHHHHHHHHhhhhc------cCCcEEEEEeccCCHHHHHHHhccc
Confidence            99999998 5555433 67888999999999999999987777666653      2469999999999999999999999


Q ss_pred             CCccc--------chHHHHHHHhhc
Q 011963          457 GYSIS--------TGSNCIVSHIKN  473 (474)
Q Consensus       457 gi~v~--------~~r~~~i~~Fk~  473 (474)
                      ||+|.        .+|+.++.+||.
T Consensus       492 ~~~v~llhgdkdqa~rn~~ls~fKk  516 (731)
T KOG0339|consen  492 GFNVSLLHGDKDQAERNEVLSKFKK  516 (731)
T ss_pred             cceeeeecCchhhHHHHHHHHHHhh
Confidence            99998        788889999974

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only]	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13850 type IV secretion system protein VirD4; Provisional	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1609 PurR Transcriptional regulators [Transcription]	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PHA03372 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PHA02542 41 41 helicase; Provisional	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK13822 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK13876 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13880 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only]	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism]	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00073 hypB hydrogenase accessory protein HypB	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		474
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-05
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	6e-07
3bor_A		237	Human initiation factor 4A-II; translation initiat	8e-06
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	1e-05
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	1e-05
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	1e-05
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	3e-05
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	3e-05
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	4e-05
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	5e-05
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	6e-05
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	8e-05
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	9e-05
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	9e-05
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	1e-04
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	4e-04
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	8e-04
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 64.1 bits (155), Expect = 5e-11
 Identities = 69/454 (15%), Positives = 150/454 (33%), Gaps = 112/454 (24%)

Query: 58  LPTLDDPFNDRYDKRETE--TKA--TKK--RNSLQLDKNKNA----F----VKGKSAVSK 103
           L   +D F D +D ++ +   K+  +K+   + +      +     F     K +  V K
Sbjct: 22  LSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQK 81

Query: 104 --KETKRDNNE---KPGHLEQTKEKAINLKN-SQDKSLLFIDGVEKRTGNVERAEVHLNG 157
             +E  R N +    P    + ++ ++  +   + +  L+ D       NV R + +L  
Sbjct: 82  FVEEVLRINYKFLMSPIK-TEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKL 140

Query: 158 KSCANGHHGQACEKLDCPSKFLIL---------CLNAIENAMRHDGVEQDNPLFVNSWGI 208
           +        QA  +L  P+K +++          + A++       V+         + I
Sbjct: 141 R--------QALLELR-PAKNVLIDGVLGSGKTWV-ALD-VCLSYKVQCKMD-----FKI 184

Query: 209 EFW---KCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSS 265
            FW   K  +S + +LE       + QI     + +D  +  +    S        L S 
Sbjct: 185 -FWLNLKNCNSPETVLEM--LQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK 241

Query: 266 QEKAA--KVRSVCKP--LKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLV 321
             +     + +V       AF +                    C  + L++T  R  ++ 
Sbjct: 242 PYENCLLVLLNVQNAKAWNAFNLS-------------------C--KILLTT--RFKQVT 278

Query: 322 -SLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGK----PHTVVFNDCLTYTSVPAV 376
             L A   + +SL       +L+  +  SL+ + +  +    P  V+  +    + +   
Sbjct: 279 DFLSAATTTHISL--DHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAE- 335

Query: 377 QNLLLGSINRLS-LNQSVASQSACIIQ-SVNVCASDEEK-------IL-KGIQVLDHAYG 426
              +   +            +   II+ S+NV    E +       +      +      
Sbjct: 336 --SIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHI------ 387

Query: 427 DHFHSEPLKVLYIVGKDSKFQNLVSTL-KCKGYS 459
                 P  +L ++  D    +++  + K   YS
Sbjct: 388 ------PTILLSLIWFDVIKSDVMVVVNKLHKYS 415

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		474
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	100.0
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	100.0
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	100.0
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	100.0
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	100.0
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	100.0
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	100.0
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	100.0
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	100.0
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	100.0
3fmo_B		300	ATP-dependent RNA helicase DDX19B; nuclear porin,	100.0
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	100.0
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	100.0
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	100.0
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	100.0
1wrb_A		253	DJVLGB; RNA helicase, DEAD BOX, VASA, structural g	100.0
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	100.0
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	100.0
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	100.0
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	100.0
3bor_A		237	Human initiation factor 4A-II; translation initiat	100.0
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	100.0
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	100.0
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	100.0
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	100.0
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	100.0
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	100.0
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	100.0
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	100.0
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	100.0
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	100.0
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	100.0
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	100.0
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	100.0
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	100.0
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	100.0
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	99.98
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	99.98
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	99.97
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	99.97
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	99.97
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	99.97
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	99.97
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	99.97
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	99.97
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	99.96
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	99.96
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	99.96
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	99.96
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	99.96
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	99.96
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	99.95
4gl2_A		699	Interferon-induced helicase C domain-containing P;	99.95
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	99.94
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	99.94
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	99.94
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	99.93
3b6e_A		216	Interferon-induced helicase C domain-containing P;	99.92
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	99.92
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	99.92
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	99.92
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	99.92
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	99.91
3h1t_A		590	Type I site-specific restriction-modification syst	99.91
1yks_A		440	Genome polyprotein [contains: flavivirin protease	99.91
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	99.91
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	99.9
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	99.89
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	99.89
1rif_A		282	DAR protein, DNA helicase UVSW; bacteriophage, REC	99.86
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	99.85
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	99.8
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	99.79
2fz4_A		237	DNA repair protein RAD25; RECA-like domain, DNA da	99.79
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	99.69
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	99.69
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	99.68
3jux_A		822	Protein translocase subunit SECA; protein transloc	99.66
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	99.66
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	99.57
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	99.35
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	99.19
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	99.13
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	99.03
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	98.33
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	98.12
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	98.07
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	98.0
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	97.97
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	97.92
3lfu_A		647	DNA helicase II; SF1 helicase, ATP-binding, DNA da	97.9
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	97.85
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	97.77
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	97.76
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	97.74
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	97.63
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	97.45
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	96.5
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	97.28
2o0j_A		385	Terminase, DNA packaging protein GP17; nucleotide-	97.25
1uaa_A		673	REP helicase, protein (ATP-dependent DNA helicase	97.21
1pjr_A		724	PCRA; DNA repair, DNA replication, SOS response, h	97.13
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	97.11
3cpe_A		592	Terminase, DNA packaging protein GP17; large termi	96.92
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	96.37
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	96.08
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	95.94
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	95.48
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	95.43
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	95.42
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	95.2
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	95.06
3bos_A		242	Putative DNA replication factor; P-loop containing	95.03
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	94.97
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	94.96
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	94.79
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	94.71
2chg_A		226	Replication factor C small subunit; DNA-binding pr	94.57
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	94.45
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	94.4
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	94.37
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	94.04
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	93.86
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	93.83
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	93.71
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	93.64
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	93.62
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	93.51
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	93.39
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	92.91
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	92.9
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	92.71
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	92.67
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	92.54
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	92.5
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	92.45
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	92.45
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	92.36
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	92.31
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	92.27
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	92.19
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	91.97
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	91.95
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	91.73
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	91.72
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	91.59
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	91.32
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	91.25
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	91.19
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	91.17
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	91.15
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	91.03
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	90.88
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	90.71
2qgz_A		308	Helicase loader, putative primosome component; str	90.54
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	90.26
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	90.22
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	90.21
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	90.2
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	90.07
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	89.67
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	89.62
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	89.59
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	89.12
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	89.28
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	89.08
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	88.81
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	88.78
1yks_A		440	Genome polyprotein [contains: flavivirin protease	88.78
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	88.74
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	88.36
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	88.34
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	88.09
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	87.93
2r6a_A		454	DNAB helicase, replicative helicase; replication,	87.87
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	87.79
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	87.78
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	87.24
3hjh_A		483	Transcription-repair-coupling factor; MFD, mutatio	87.09
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	85.77
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	85.71
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	85.64
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	85.55
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	85.41
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	85.33
3pvs_A		447	Replication-associated recombination protein A; ma	85.2
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	84.88
3h75_A		350	Periplasmic sugar-binding domain protein; protein	84.77
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	84.53
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	84.42
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	84.01
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	83.96
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	83.73
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	83.02
2cvh_A		220	DNA repair and recombination protein RADB; filamen	82.83
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	82.43
4gl2_A		699	Interferon-induced helicase C domain-containing P;	82.12
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	82.03
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	82.01
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	81.55
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	81.53
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	81.18
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	81.13
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	81.11
1e9r_A		437	Conjugal transfer protein TRWB; coupling protein,	80.71

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

Probab=100.00  E-value=3.7e-45  Score=382.30  Aligned_cols=272  Identities=14%  Similarity=0.200  Sum_probs=240.6

Q ss_pred             hHHHHHHHHHhCCCCccccCCCchhhHHHHHHHhcCCcEEEEcCCCcchhHHHHHHHHHHHHHHhhhhcCCCCCCcEEEE
Q 011963          182 CLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLF  261 (474)
Q Consensus       182 l~~~i~~~l~~~g~~~ptpi~~~~~Q~~~i~~~l~g~dvl~~A~TG~SGKTlaf~lp~l~~l~~~~~~~~~~~~~~~ali  261 (474)
                      |++.++++|..+||..|||+     |.++||.+++|+|++++|||| ||||+||++|+++.+......  ....++++||
T Consensus        63 l~~~l~~~l~~~g~~~pt~i-----Q~~ai~~i~~g~d~i~~a~TG-sGKT~a~~lpil~~l~~~~~~--~~~~~~~~li  134 (434)
T 2db3_A           63 LRDIIIDNVNKSGYKIPTPI-----QKCSIPVISSGRDLMACAQTG-SGKTAAFLLPILSKLLEDPHE--LELGRPQVVI  134 (434)
T ss_dssp             CCHHHHHHHHHTTCCSCCHH-----HHHHHHHHHTTCCEEEECCTT-SSHHHHHHHHHHHHHHHSCCC--CCTTCCSEEE
T ss_pred             CCHHHHHHHHHcCCCCCCHH-----HHHHHHHHhcCCCEEEECCCC-CCchHHHHHHHHHHHHhcccc--cccCCccEEE
Confidence            88999999999999999999     999999999999999999999 999999999999999875422  1125789999


Q ss_pred             EeccHHHHHHHHHHHHhcc-cCCcEEEEEecCCCHHHHHHHHhcCCCcEEEEChHHHHHHHHcCCCCCCCcceEEecccc
Q 011963          262 LVSSQEKAAKVRSVCKPLK-AFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLD  340 (474)
Q Consensus       262 l~PtreLa~Qi~~~~~~l~-~~~i~v~~~~gg~~~~~q~~~l~~~~~~IlV~TP~rL~~ll~~~~~~l~~l~~lViDEad  340 (474)
                      |+||||||.|+++++..+. ..++++++++||.+...+...+.. +++|+|+|||+|++++..+.+.++++++|||||||
T Consensus       135 l~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~-~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah  213 (434)
T 2db3_A          135 VSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITR-GCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEAD  213 (434)
T ss_dssp             ECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTT-CCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHH
T ss_pred             EecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhc-CCCEEEEChHHHHHHHHhCCcccccCCeEEEccHh
Confidence            9999999999999999984 458999999999999998888887 89999999999999999988999999999999999


Q ss_pred             ccCC---hhHHHHHHhhC--CCCCcEEEEEccCCccHHHHHHHhhcCCceEEEccCCcccccCCcEEEEEEcCCchhHHH
Q 011963          341 SLSK---GDTLSLIRQSI--SGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKIL  415 (474)
Q Consensus       341 ~ll~---~~~l~~Il~~l--~~~~q~llfSAT~~~~v~~l~~~~l~~p~~~v~v~~~~~~~~~~i~q~~~~~~~~~~K~~  415 (474)
                      +|++   ..++..|+..+  +..+|+++||||+|..+..++..++.++. .+.++.. .....++.|.++.+. ...|..
T Consensus       214 ~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~-~i~~~~~-~~~~~~i~~~~~~~~-~~~k~~  290 (434)
T 2db3_A          214 RMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYV-FVAIGIV-GGACSDVKQTIYEVN-KYAKRS  290 (434)
T ss_dssp             HHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCE-EEEESST-TCCCTTEEEEEEECC-GGGHHH
T ss_pred             hhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCE-EEEeccc-cccccccceEEEEeC-cHHHHH
Confidence            9998   78899999875  57899999999999999999999999887 7777654 456678999999996 566876


Q ss_pred             HHHHHHHHHhhccCCCCCCcEEEEEccchhHHHHHHHHhhCCCccc--------chHHHHHHHhhc
Q 011963          416 KGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSIS--------TGSNCIVSHIKN  473 (474)
Q Consensus       416 ~l~~lL~~ll~~~~~~~~~k~LVF~~s~~~a~~l~~~L~~~gi~v~--------~~r~~~i~~Fk~  473 (474)
                      .|..+|..    .    ..++||||+|+..|+.++..|...|+++.        .+|+.++++|++
T Consensus       291 ~l~~~l~~----~----~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~  348 (434)
T 2db3_A          291 KLIEILSE----Q----ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKN  348 (434)
T ss_dssp             HHHHHHHH----C----CTTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHT
T ss_pred             HHHHHHHh----C----CCCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHc
Confidence            55555544    2    34599999999999999999999999876        678899999985

PyMOL of 2db3

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens}	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens}	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A*	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A*	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A*	Back alignment and structure

>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B*	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5}	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		474
d1hv8a1		208	c.37.1.19 (A:3-210) Putative DEAD box RNA helicase	4e-08
d1t6na_		207	c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5	0.002

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 51.2 bits (122), Expect = 4e-08
 Identities = 25/145 (17%), Positives = 54/145 (37%), Gaps = 6/145 (4%)

Query: 224 SGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAF- 282
           +   + + Q        A       +      G   + L  ++E A +V    + LK   
Sbjct: 40  NDEYNIVAQARTGSGKTASFAIPLIELVNENNGIEAIILTPTRELAIQVADEIESLKGNK 99

Query: 283 GIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSL 342
            +    ++ G AI  QI  L++     +V TP R+L  ++   +++  V   ++D  D +
Sbjct: 100 NLKIAKIYGGKAIYPQIKALKN--ANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEM 157

Query: 343 ---SKGDTLSLIRQSISGKPHTVVF 364
                   +  I  + +     ++F
Sbjct: 158 LNMGFIKDVEKILNACNKDKRILLF 182

PyMOL of d1hv8a1

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		474
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	100.0
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	100.0
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	100.0
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	100.0
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	100.0
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	100.0
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	100.0
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	100.0
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	100.0
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.95
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	99.95
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	99.95
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.91
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	99.89
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	99.68
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	99.68
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	99.67
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.67
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	99.62
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	99.52
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	98.97
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.55
d1tf5a3		273	Translocation ATPase SecA, nucleotide-binding doma	98.52
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	98.44
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	98.42
d1nkta3		288	Translocation ATPase SecA, nucleotide-binding doma	98.39
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	98.35
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	98.34
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	98.31
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	98.22
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	97.77
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	97.45
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	97.24
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	97.08
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	96.9
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	96.75
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	96.36
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	96.28
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	96.27
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	96.05
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	96.0
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	95.94
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	95.77
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	95.32
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	95.31
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	95.27
d1ls1a2		207	GTPase domain of the signal sequence recognition p	95.27
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	95.17
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	95.14
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	95.08
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	95.03
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	94.31
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	94.27
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	94.21
d1a1va2		299	HCV helicase domain {Human hepatitis C virus (HCV)	94.06
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	93.66
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	93.58
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	93.42
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	92.69
d2fwra1		200	DNA repair protein RAD25 {Archaeoglobus fulgidus [	92.6
d2qy9a2		211	GTPase domain of the signal recognition particle r	92.36
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	92.06
d1tf5a4		175	Translocation ATPase SecA, nucleotide-binding doma	91.59
d1vmaa2		213	GTPase domain of the signal recognition particle r	91.55
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	91.55
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	91.36
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	90.71
d1j8yf2		211	GTPase domain of the signal sequence recognition p	89.5
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	89.1
d2b8ta1		139	Thymidine kinase, TK1, N-terminal domain {Ureaplas	89.06
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	89.01
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	88.97
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	88.96
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	88.76
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	88.38
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	88.37
d1okkd2		207	GTPase domain of the signal recognition particle r	88.06
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	87.74
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	87.65
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	86.76
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	86.66
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	86.11
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	85.87
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	85.28
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	85.01
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	83.82
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	83.62
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	83.53
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	82.79
d1xx6a1		141	Thymidine kinase, TK1, N-terminal domain {Clostrid	81.86
d1nkta4		219	Translocation ATPase SecA, nucleotide-binding doma	80.65

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.5e-47  Score=358.58  Aligned_cols=194  Identities=13%  Similarity=0.207  Sum_probs=183.9

Q ss_pred             hHHHHHHHHHhCCCCccccCCCchhhHHHHHHHhcCCcEEEEcCCCcchhHHHHHHHHHHHHHHhhhhcCCCCCCcEEEE
Q 011963          182 CLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLF  261 (474)
Q Consensus       182 l~~~i~~~l~~~g~~~ptpi~~~~~Q~~~i~~~l~g~dvl~~A~TG~SGKTlaf~lp~l~~l~~~~~~~~~~~~~~~ali  261 (474)
                      |++.++++|.++||..||||     |.++||.++.|+|++++|||| ||||+||++|+++.+....       ..+++||
T Consensus        24 L~~~l~~~L~~~g~~~pt~I-----Q~~aIp~il~g~dvi~~a~TG-SGKTlayllPil~~l~~~~-------~~~~~li   90 (222)
T d2j0sa1          24 LREDLLRGIYAYGFEKPSAI-----QQRAIKQIIKGRDVIAQSQSG-TGKTATFSISVLQCLDIQV-------RETQALI   90 (222)
T ss_dssp             CCHHHHHHHHHHTCCSCCHH-----HHHHHHHHHTTCCEEEECCTT-SSHHHHHHHHHHHTCCTTS-------CSCCEEE
T ss_pred             CCHHHHHHHHHCCCCCCCHH-----HHHHHHHHHCCCCeEEEcCcc-hhhhhhhcccccccccccc-------cCceeEE
Confidence            99999999999999999999     999999999999999999999 9999999999998876532       5789999


Q ss_pred             EeccHHHHHHHHHHHHhcc-cCCcEEEEEecCCCHHHHHHHHhcCCCcEEEEChHHHHHHHHcCCCCCCCcceEEecccc
Q 011963          262 LVSSQEKAAKVRSVCKPLK-AFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLD  340 (474)
Q Consensus       262 l~PtreLa~Qi~~~~~~l~-~~~i~v~~~~gg~~~~~q~~~l~~~~~~IlV~TP~rL~~ll~~~~~~l~~l~~lViDEad  340 (474)
                      ++||||||.|+++++..+. +.++++.+++||.....+...+.. +++|||+|||||++++..+.+.++++++|||||||
T Consensus        91 l~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~-~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDEaD  169 (222)
T d2j0sa1          91 LAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDY-GQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEAD  169 (222)
T ss_dssp             ECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHH-CCSEEEECHHHHHHHHHTTSSCCTTCCEEEEETHH
T ss_pred             ecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhcc-CCeEEeCCCCcHHhcccccccccccceeeeecchh
Confidence            9999999999999999994 559999999999999999999988 89999999999999999999999999999999999


Q ss_pred             ccCC---hhHHHHHHhhCCCCCcEEEEEccCCccHHHHHHHhhcCCceEEEcc
Q 011963          341 SLSK---GDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLN  390 (474)
Q Consensus       341 ~ll~---~~~l~~Il~~l~~~~q~llfSAT~~~~v~~l~~~~l~~p~~~v~v~  390 (474)
                      +|++   .+++..|++.++.++|+++||||+|+.+.++++.+|++|+ .|.++
T Consensus       170 ~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv-~I~V~  221 (222)
T d2j0sa1         170 EMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPI-RILVK  221 (222)
T ss_dssp             HHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCE-EECCC
T ss_pred             HhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCE-EEEEe
Confidence            9999   8899999999999999999999999999999999999998 77765

PyMOL of d2j0sa1

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure