Citrus Sinensis ID: 015013

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410----

MALAVTSSNSISSSSFALTSSSNDIKVSQIGSFRLVDRAHVASTSLSQRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPELAFV

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHcccccccccccHHHHccccccHHHHHHHccccEEEEccccccccccccccccEEEcccccccccccccEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHHHcccccccccccHHHHHHHHccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccc

ccEEEEEEccccccccccccccccccccEEcccccccccccccccHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccccEEEEEEcccEcHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccHHHHHcccHHHHcHcEccHHHHHHHcccEEEEcccccccccccccccEEEEcccccccccccccEEEEcccccccHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccEEEccccccccccccccccHHHHHccccccccccccccHHHHcccccEEEcccHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHccccccccEEEEc

malavtssnsissssfaltsssndikvsqigsfrlvdrahvastSLSQRrslvrplnaepkrndsvvplaatlatpevaekvegEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHltgrpfrvfsldtgrlnpetyRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKglfsfyedghqeccrvrkvRPLRRALKGLRAWitgqrkdqspgtrseipvvqvdpvfegleggvgslvkwnpvanvkgndiwnflrtmdvpinslhsqgyisigcepctrpvlpgqheregrwwwedakakecglhkgnikqedaavngngngagnaSEAVADIFNSQNLVTLNRTGMENLarldhrqepwLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGfkpelafv

malavtssnsissssfaltsssndiKVSQIGSFRLVDRAHVastslsqrrslvrplnaepkrndsvvpLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFsfyedghqeccrvrkvrplrralkglrawitgqrkdqspgtrseipvvQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPELAFV

MALAVTssnsissssfaltsssNDIKVSQIGSFRLVDRAHVASTSLSQRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDaavngngngagnaSEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPELAFV

*******************************SFRLV****************************************************************LEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITG************IPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNI*******************AVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPE****

**********************************************************************************EGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSP**RSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPG*HEREGRWWWEDAKAKECGLH************************************************DHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPELAFV

*********************SNDIKVSQIGSFRLVDRAHVASTSLSQRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITG***********EIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPELAFV

**********************************LVDRAHV**********************************PEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQE****************AVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIRFQIIALVMGFKPELAFV

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		414	2.2.26 [Sep-21-2011]
P92979		465	5'-adenylylsulfate reduct	yes	no	0.869	0.774	0.776	1e-172
P92980		458	5'-adenylylsulfate reduct	no	no	0.920	0.831	0.734	1e-170
P92981		454	5'-adenylylsulfate reduct	no	no	0.915	0.834	0.732	1e-162
Q6Z4A7		475	Probable 5'-adenylylsulfa	yes	no	0.736	0.642	0.773	1e-144
O05927		267	Phosphoadenosine phosphos	yes	no	0.567	0.880	0.554	5e-80
Q02KP7		267	Phosphoadenosine phosphos	yes	no	0.567	0.880	0.554	6e-80
B7VBC3		267	Phosphoadenosine phosphos	yes	no	0.567	0.880	0.554	6e-80
Q9JUD5		244	Phosphoadenosine phosphos	yes	no	0.463	0.786	0.416	1e-40
Q9JRT1		246	Phosphoadenosine phosphos	yes	no	0.461	0.776	0.413	1e-39
P56891		265	Phosphoadenosine phosphos	yes	no	0.420	0.656	0.432	6e-38

>sp\|P92979\|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2	Back alignment and function desciption

 Score =  604 bits (1558), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 289/372 (77%), Positives = 325/372 (87%), Gaps = 12/372 (3%)

Query: 26  KVSQIGSFRLVDRAHVASTSLS---QRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKV 82
           KVSQIGS RL+DR HVA  SL+   +R S V+PLNAEPK  DS++PLAAT+      E  
Sbjct: 27  KVSQIGSLRLLDRVHVAPVSLNLSGKRSSSVKPLNAEPKTKDSMIPLAATMVAEIAEEVE 86

Query: 83  EGEEDFEQ-FAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVF 141
             E +  +  AK+LENASPLEIMD+ALEK+GNDIAIAFSGAEDVALIEYAHLTGRPFRVF
Sbjct: 87  VVEIEDFEELAKKLENASPLEIMDKALEKYGNDIAIAFSGAEDVALIEYAHLTGRPFRVF 146

Query: 142 SLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVR 201
           SLDTGRLNPETYRFFD VEKH+GIRIEYMFPD+VEVQ LVRSKGLFSFYEDGHQECCRVR
Sbjct: 147 SLDTGRLNPETYRFFDAVEKHYGIRIEYMFPDSVEVQGLVRSKGLFSFYEDGHQECCRVR 206

Query: 202 KVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVK 261
           KVRPLRRALKGL+AWITGQRKDQSPGTRSEIPVVQVDPVFEGL+GGVGSLVKWNPVANV+
Sbjct: 207 KVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVVQVDPVFEGLDGGVGSLVKWNPVANVE 266

Query: 262 GNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHK 321
           GND+WNFLRTMDVP+N+LH+ GYISIGCEPCT+ VLPGQHEREGRWWWEDAKAKECGLHK
Sbjct: 267 GNDVWNFLRTMDVPVNTLHAAGYISIGCEPCTKAVLPGQHEREGRWWWEDAKAKECGLHK 326

Query: 322 GNIKQ--EDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVL 379
           GN+K+  +DA VN      G +  AVADIF S+NLVTL+R G+ENL +L++R+EPW+VVL
Sbjct: 327 GNVKENSDDAKVN------GESKSAVADIFKSENLVTLSRQGIENLMKLENRKEPWIVVL 380

Query: 380 YAPWCQFCQVID 391
           YAPWC FCQ ++
Sbjct: 381 YAPWCPFCQAME 392

Reduces sulfate for Cys biosynthesis. Substrate preference is adenosine-5'-phosphosulfate (APS) >> 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Uses glutathione or DTT as source of protons.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 4EC: .EC: 9

>sp\|P92980\|APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2	Back alignment and function description

>sp\|P92981\|APR2_ARATH 5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=1 SV=2	Back alignment and function description

>sp\|Q6Z4A7\|APR1_ORYSJ Probable 5'-adenylylsulfate reductase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=APR1 PE=2 SV=1	Back alignment and function description

>sp\|O05927\|CYSH_PSEAE Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysH PE=1 SV=2	Back alignment and function description

>sp\|Q02KP7\|CYSH_PSEAB Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysH PE=3 SV=1	Back alignment and function description

>sp\|B7VBC3\|CYSH_PSEA8 Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysH PE=3 SV=1	Back alignment and function description

>sp\|Q9JUD5\|CYSH_NEIMA Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysH PE=3 SV=1	Back alignment and function description

>sp\|Q9JRT1\|CYSH_NEIMB Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysH1 PE=3 SV=1	Back alignment and function description

>sp\|P56891\|CYSH_RHIME Phosphoadenosine phosphosulfate reductase OS=Rhizobium meliloti (strain 1021) GN=cysH PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		414
359483358		460	PREDICTED: 5'-adenylylsulfate reductase	0.929	0.836	0.786	0.0
356555676		472	PREDICTED: 5'-adenylylsulfate reductase	0.888	0.779	0.812	0.0
359483360		454	PREDICTED: 5'-adenylylsulfate reductase	0.915	0.834	0.773	0.0
255554863		471	5'-adenylylsulfate reductase 1, chloropl	0.908	0.798	0.790	0.0
351727060		470	adenosine 5'-phosphosulfate reductase [G	0.888	0.782	0.812	1e-178
350538397		461	adenylyl-sulfate reductase [Solanum lyco	0.932	0.837	0.753	1e-177
34099827		465	adenosine 5' phosphosulfate reductase [P	0.896	0.797	0.802	1e-177
118485828		465	unknown [Populus trichocarpa]	0.896	0.797	0.799	1e-176
356521997		466	PREDICTED: 5'-adenylylsulfate reductase	0.929	0.826	0.758	1e-176
12831474		464	PAPS-reductase-like protein [Catharanthu	0.932	0.831	0.757	1e-174

>gi\|359483358\|ref\|XP_003632943.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/393 (78%), Positives = 354/393 (90%), Gaps = 8/393 (2%)

Query: 1   MALAVTSSNSISSSSFALTSSSNDIKVSQIGSFRLVDRAHV--ASTSLSQRRSLVRPLNA 58
           MALAVTSS++IS     ++ +S++ K  QIGSFR VDR++V  A+ + S+R+S V+P+NA
Sbjct: 1   MALAVTSSSAISGP---ISYASSENKAPQIGSFRPVDRSNVSLATVTFSRRQSAVKPVNA 57

Query: 59  EPKRNDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIA 118
           EPKRNDS+VPLAAT++ PEVAEKVE  ED+EQ A++L NASPLEIMD+AL KFGNDIAIA
Sbjct: 58  EPKRNDSIVPLAATVSAPEVAEKVE-VEDYEQLARDLANASPLEIMDKALAKFGNDIAIA 116

Query: 119 FSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQ 178
           FSGAED+ALIEYA LTGRPFRVFSLDTGRLNPETY+FFD VEKH+GIRIEYMFPDAVEVQ
Sbjct: 117 FSGAEDIALIEYARLTGRPFRVFSLDTGRLNPETYQFFDTVEKHYGIRIEYMFPDAVEVQ 176

Query: 179 ALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVD 238
            LVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR+E+PVVQVD
Sbjct: 177 GLVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRAEVPVVQVD 236

Query: 239 PVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLP 298
           P FEGL+GGVGSLVKWNPVANV+G DIWNFLR M+VP+NSLHS+GYISIGCEPCTRPVLP
Sbjct: 237 PAFEGLDGGVGSLVKWNPVANVQGMDIWNFLRAMNVPVNSLHSKGYISIGCEPCTRPVLP 296

Query: 299 GQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLN 358
           GQHEREGRWWWEDAKAKECGLHKGN+KQED   N NGNG  N +  V+D+F++Q+LVTL 
Sbjct: 297 GQHEREGRWWWEDAKAKECGLHKGNLKQEDG--NKNGNGHANGTATVSDLFDTQSLVTLT 354

Query: 359 RTGMENLARLDHRQEPWLVVLYAPWCQFCQVID 391
           RTGMENLA+L++R+EPWLVVLYAPWC FCQ ++
Sbjct: 355 RTGMENLAKLENRKEPWLVVLYAPWCPFCQAME 387

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356555676\|ref\|XP_003546156.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|359483360\|ref\|XP_003632944.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255554863\|ref\|XP_002518469.1\| 5'-adenylylsulfate reductase 1, chloroplast precursor, putative [Ricinus communis] gi\|223542314\|gb\|EEF43856.1\| 5'-adenylylsulfate reductase 1, chloroplast precursor, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|351727060\|ref\|NP_001235612.1\| adenosine 5'-phosphosulfate reductase [Glycine max] gi\|18252504\|gb\|AAL66290.1\|AF452450_1 adenosine 5'-phosphosulfate reductase [Glycine max]	Back alignment and taxonomy information

>gi\|350538397\|ref\|NP_001233829.1\| adenylyl-sulfate reductase [Solanum lycopersicum] gi\|51457940\|gb\|AAU03359.1\| adenylyl-sulfate reductase [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|34099827\|gb\|AAQ57202.1\| adenosine 5' phosphosulfate reductase [Populus tremula x Populus alba]	Back alignment and taxonomy information

>gi\|118485828\|gb\|ABK94761.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356521997\|ref\|XP_003529636.1\| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|12831474\|gb\|AAB05871.2\| PAPS-reductase-like protein [Catharanthus roseus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		414
TAIR\|locus:2125786		465	APR1 "APS reductase 1" [Arabid	0.871	0.776	0.784	2.5e-159
TAIR\|locus:2120628		458	APR3 "APS reductase 3" [Arabid	0.925	0.836	0.715	5.2e-152
TAIR\|locus:2018097		454	APR2 "5'adenylylphosphosulfate	0.915	0.834	0.715	2.3e-149
TIGR_CMR\|GSU_1716		235	GSU_1716 "phosphoadenosine pho	0.526	0.927	0.423	1.8e-46
TIGR_CMR\|SPO_2635		253	SPO_2635 "phosophoadenylyl-sul	0.502	0.822	0.354	1.5e-26
UNIPROTKB\|P65668		254	cysH "Probable phosphoadenosin	0.458	0.748	0.360	5.9e-25
TIGR_CMR\|BA_1440		226	BA_1440 "phosphoadenosine phos	0.514	0.942	0.318	2.6e-24
UNIPROTKB\|Q9KUX2		253	cysH "Phosphoadenosine phospho	0.572	0.936	0.277	9.3e-18
TIGR_CMR\|VC_0386		253	VC_0386 "phosphoadenosine phos	0.572	0.936	0.277	9.3e-18
TIGR_CMR\|SO_3736		245	SO_3736 "phosphoadenosine phos	0.565	0.955	0.274	9.5e-17

TAIR\|locus:2125786 APR1 "APS reductase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1552 (551.4 bits), Expect = 2.5e-159, P = 2.5e-159
 Identities = 291/371 (78%), Positives = 326/371 (87%)

Query:    26 KVSQIGSFRLVDRAHVASTSLS---QRRSLVRPLNAEPKRNDSVVPLAATLATPEVAEKV 82
             KVSQIGS RL+DR HVA  SL+   +R S V+PLNAEPK  DS++PLAAT+   E+AE+V
Sbjct:    27 KVSQIGSLRLLDRVHVAPVSLNLSGKRSSSVKPLNAEPKTKDSMIPLAATMVA-EIAEEV 85

Query:    83 EGEE--DFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRV 140
             E  E  DFE+ AK+LENASPLEIMD+ALEK+GNDIAIAFSGAEDVALIEYAHLTGRPFRV
Sbjct:    86 EVVEIEDFEELAKKLENASPLEIMDKALEKYGNDIAIAFSGAEDVALIEYAHLTGRPFRV 145

Query:   141 FSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRV 200
             FSLDTGRLNPETYRFFD VEKH+GIRIEYMFPD+VEVQ LVRSKGLFSFYEDGHQECCRV
Sbjct:   146 FSLDTGRLNPETYRFFDAVEKHYGIRIEYMFPDSVEVQGLVRSKGLFSFYEDGHQECCRV 205

Query:   201 RKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANV 260
             RKVRPLRRALKGL+AWITGQRKDQSPGTRSEIPVVQVDPVFEGL+GGVGSLVKWNPVANV
Sbjct:   206 RKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVVQVDPVFEGLDGGVGSLVKWNPVANV 265

Query:   261 KGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLH 320
             +GND+WNFLRTMDVP+N+LH+ GYISIGCEPCT+ VLPGQHEREGRWWWEDAKAKECGLH
Sbjct:   266 EGNDVWNFLRTMDVPVNTLHAAGYISIGCEPCTKAVLPGQHEREGRWWWEDAKAKECGLH 325

Query:   321 KGNIKQEDXXXXXXXXXXXXXSEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLY 380
             KGN+K+                 AVADIF S+NLVTL+R G+ENL +L++R+EPW+VVLY
Sbjct:   326 KGNVKENSDDAKVNGES----KSAVADIFKSENLVTLSRQGIENLMKLENRKEPWIVVLY 381

Query:   381 APWCQFCQVID 391
             APWC FCQ ++
Sbjct:   382 APWCPFCQAME 392

GO:0003824 "catalytic activity" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;ISS

GO:0016671 "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor" evidence=IEA

GO:0019419 "sulfate reduction" evidence=IEA;IDA

GO:0045454 "cell redox homeostasis" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0009973 "adenylyl-sulfate reductase activity" evidence=IDA

GO:0009536 "plastid" evidence=TAS

GO:0009534 "chloroplast thylakoid" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0019761 "glucosinolate biosynthetic process" evidence=RCA

GO:0000103 "sulfate assimilation" evidence=IGI;IDA

TAIR\|locus:2120628 APR3 "APS reductase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2018097 APR2 "5'adenylylphosphosulfate reductase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_1716 GSU_1716 "phosphoadenosine phosphosulfate reductase, putative" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|SPO_2635 SPO_2635 "phosophoadenylyl-sulfate reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)]	Back alignment and assigned GO terms

UNIPROTKB\|P65668 cysH "Probable phosphoadenosine phosphosulfate reductase" [Mycobacterium tuberculosis (taxid:1773)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_1440 BA_1440 "phosphoadenosine phosphosulfate reductase" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KUX2 cysH "Phosphoadenosine phosphosulfate reductase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_0386 VC_0386 "phosphoadenosine phosphosulfate reductase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_3736 SO_3736 "phosphoadenosine phosphosulfate reductase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6Z4A7	APR1_ORYSJ	1, ., 8, ., 4, ., 9	0.7734	0.7367	0.6421	yes	no
P92980	APR3_ARATH	1, ., 8, ., 4, ., 9	0.7341	0.9202	0.8318	no	no
P92981	APR2_ARATH	1, ., 8, ., 4, ., 9	0.7328	0.9154	0.8348	no	no
P92979	APR1_ARATH	1, ., 8, ., 4, ., 9	0.7768	0.8695	0.7741	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.8.4	LOW CONFIDENCE prediction!
4th Layer	1.8.4.8	0.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		414
PLN02309		457	PLN02309, PLN02309, 5'-adenylylsulfate reductase	0.0
TIGR00424		463	TIGR00424, APS_reduc, 5'-adenylylsulfate reductase	0.0
PRK02090		241	PRK02090, PRK02090, phosphoadenosine phosphosulfat	8e-96
TIGR02055		191	TIGR02055, APS_reductase, thioredoxin-dependent ad	6e-83
COG0175		261	COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfa	3e-68
pfam01507		173	pfam01507, PAPS_reduct, Phosphoadenosine phosphosu	1e-59
cd01713		173	cd01713, PAPS_reductase, This domain is found in p	2e-52
TIGR00434		212	TIGR00434, cysH, phosophoadenylyl-sulfate reductas	3e-45
TIGR02057		226	TIGR02057, PAPS_reductase, phosphoadenosine phosph	2e-38
cd02993		109	cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden	1e-13
PRK13795		636	PRK13795, PRK13795, hypothetical protein; Provisio	2e-07
PRK13794		479	PRK13794, PRK13794, hypothetical protein; Provisio	1e-06
PRK08557		417	PRK08557, PRK08557, hypothetical protein; Provisio	1e-06
PRK08576		438	PRK08576, PRK08576, hypothetical protein; Provisio	1e-04
cd02961		101	cd02961, PDI_a_family, Protein Disulfide Isomerase	0.002

>gnl\|CDD\|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase	Back alignment and domain information

 Score =  712 bits (1840), Expect = 0.0
 Identities = 292/389 (75%), Positives = 336/389 (86%), Gaps = 9/389 (2%)

Query: 6   TSSNSISSSSFALTSSSNDIKVSQIGSFRLVDRAHVASTSLS---QRRSLVRPLNAEPKR 62
           +SS++ISSS  + + +S++ K  QIGS RL+DR  +++ + S   +R S  +PLNA+P  
Sbjct: 2   SSSSAISSSGSSRSGASSESKAKQIGSLRLLDRGGLSARAYSLSGKRSSAAKPLNAQPAA 61

Query: 63  NDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGA 122
             +++P AAT    EV E+    EDFE+ AKELENASPLEIMD+ALEKFGNDIAIAFSGA
Sbjct: 62  RQAMIPSAATAV-AEVPEEEGEVEDFEKLAKELENASPLEIMDKALEKFGNDIAIAFSGA 120

Query: 123 EDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVR 182
           EDVALIEYAHLTGRPFRVFSLDTGRLNPETYR FD VEKH+GIRIEYMFPDAVEVQALVR
Sbjct: 121 EDVALIEYAHLTGRPFRVFSLDTGRLNPETYRLFDAVEKHYGIRIEYMFPDAVEVQALVR 180

Query: 183 SKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFE 242
           +KGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTR+E+PVVQVDPVFE
Sbjct: 181 NKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRAEVPVVQVDPVFE 240

Query: 243 GLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHE 302
           GL+GG GSLVKWNP+ANV GN++WNFLRTMDVP+NSLH+QGY+SIGCEPCTRPVLPGQHE
Sbjct: 241 GLDGGPGSLVKWNPLANVTGNEVWNFLRTMDVPVNSLHAQGYVSIGCEPCTRPVLPGQHE 300

Query: 303 REGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGM 362
           REGRWWWEDAKAKECGLHKGNIK+ED     NG    N + AVADIFNSQN+V L+R G+
Sbjct: 301 REGRWWWEDAKAKECGLHKGNIKEED-----NGAANDNGNAAVADIFNSQNVVALSRAGI 355

Query: 363 ENLARLDHRQEPWLVVLYAPWCQFCQVID 391
           ENL +L++R+EPWLVVLYAPWC FCQ ++
Sbjct: 356 ENLLKLENRKEPWLVVLYAPWCPFCQAME 384

Length = 457

>gnl\|CDD\|232970 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>gnl\|CDD\|234997 PRK02090, PRK02090, phosphoadenosine phosphosulfate reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|233701 TIGR02055, APS_reductase, thioredoxin-dependent adenylylsulfate APS reductase	Back alignment and domain information

>gnl\|CDD\|223253 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|201832 pfam01507, PAPS_reduct, Phosphoadenosine phosphosulfate reductase family	Back alignment and domain information

>gnl\|CDD\|238846 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>gnl\|CDD\|129526 TIGR00434, cysH, phosophoadenylyl-sulfate reductase (thioredoxin)	Back alignment and domain information

>gnl\|CDD\|131112 TIGR02057, PAPS_reductase, phosphoadenosine phosphosulfate reductase, thioredoxin dependent	Back alignment and domain information

>gnl\|CDD\|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>gnl\|CDD\|237510 PRK13795, PRK13795, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237509 PRK13794, PRK13794, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|181465 PRK08557, PRK08557, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236300 PRK08576, PRK08576, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		414
TIGR00424		463	APS_reduc 5'-adenylylsulfate reductase, thioredoxi	100.0
PLN02309		457	5'-adenylylsulfate reductase	100.0
KOG0189		261	consensus Phosphoadenosine phosphosulfate reductas	100.0
TIGR02057		226	PAPS_reductase phosphoadenosine phosphosulfate red	100.0
PRK02090		241	phosphoadenosine phosphosulfate reductase; Provisi	100.0
TIGR00434		212	cysH phosophoadenylyl-sulfate reductase (thioredox	100.0
COG0175		261	CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr	100.0
TIGR02055		191	APS_reductase thioredoxin-dependent adenylylsulfat	100.0
PRK12563		312	sulfate adenylyltransferase subunit 2; Provisional	100.0
TIGR02039		294	CysD sulfate adenylyltransferase, small subunit. I	100.0
PRK08557		417	hypothetical protein; Provisional	100.0
PRK13794		479	hypothetical protein; Provisional	100.0
PF01507		174	PAPS_reduct: Phosphoadenosine phosphosulfate reduc	100.0
PRK05253		301	sulfate adenylyltransferase subunit 2; Provisional	100.0
PRK13795		636	hypothetical protein; Provisional	100.0
PRK08576		438	hypothetical protein; Provisional	100.0
cd01713		173	PAPS_reductase This domain is found in phosphoaden	100.0
TIGR03183		447	DNA_S_dndC putative sulfurtransferase DndC. Member	99.97
PRK06850		507	hypothetical protein; Provisional	99.96
COG3969		407	Predicted phosphoadenosine phosphosulfate sulfotra	99.85
cd01992		185	PP-ATPase N-terminal domain of predicted ATPase of	99.53
TIGR02432		189	lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t	99.43
cd01993		185	Alpha_ANH_like_II This is a subfamily of Adenine n	99.43
PRK10696		258	tRNA 2-thiocytidine biosynthesis protein TtcA; Pro	99.29
cd01990		202	Alpha_ANH_like_I This is a subfamily of Adenine nu	99.18
PF01171		182	ATP_bind_3: PP-loop family; InterPro: IPR011063 Th	99.15
TIGR00268		252	conserved hypothetical protein TIGR00268. The N-te	99.14
COG0037		298	MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle	99.11
cd03006		113	PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil	99.1
KOG2644		282	consensus 3'-phosphoadenosine 5'-phosphosulfate su	99.09
COG1606		269	ATP-utilizing enzymes of the PP-loop superfamily [	99.08
PRK00074		511	guaA GMP synthase; Reviewed	99.05
cd01995		169	ExsB ExsB is a transcription regulator related pro	98.99
PRK00919		307	GMP synthase subunit B; Validated	98.99
cd01712		177	ThiI ThiI is required for thiazole synthesis in th	98.99
cd01997		295	GMP_synthase_C The C-terminal domain of GMP synthe	98.98
TIGR00884		311	guaA_Cterm GMP synthase (glutamine-hydrolyzing), C	98.95
PRK00143		346	mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed	98.92
cd03003		101	PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam	98.91
cd02993		109	PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat	98.9
PRK14561		194	hypothetical protein; Provisional	98.88
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	98.86
PRK14665		360	mnmA tRNA-specific 2-thiouridylase MnmA; Provision	98.86
cd03004		104	PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam	98.84
KOG0910		150	consensus Thioredoxin-like protein [Posttranslatio	98.82
TIGR00420		352	trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me	98.82
PRK10660		436	tilS tRNA(Ile)-lysidine synthetase; Provisional	98.81
PRK08349		198	hypothetical protein; Validated	98.8
PHA02278		103	thioredoxin-like protein	98.79
cd02996		108	PDI_a_ERp44 PDIa family, endoplasmic reticulum pro	98.79
cd01998		349	tRNA_Me_trans tRNA methyl transferase. This family	98.77
cd02954		114	DIM1 Dim1 family; Dim1 is also referred to as U5 s	98.75
cd03002		109	PDI_a_MPD1_like PDI family, MPD1-like subfamily; c	98.73
cd02992		114	PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas	98.72
cd02985		103	TRX_CDSP32 TRX family, chloroplastic drought-induc	98.71
KOG0907		106	consensus Thioredoxin [Posttranslational modificat	98.7
TIGR00364		201	exsB protein. This protein family is represented b	98.69
cd02995		104	PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain	98.68
cd02999		100	PDI_a_ERp44_like PDIa family, endoplasmic reticulu	98.68
TIGR00032		394	argG argininosuccinate synthase. argG in bacteria,	98.68
PRK09381		109	trxA thioredoxin; Provisional	98.68
cd01996		154	Alpha_ANH_like_III This is a subfamily of Adenine	98.68
cd02994		101	PDI_a_TMX PDIa family, TMX subfamily; composed of	98.67
PLN02347		536	GMP synthetase	98.66
TIGR00552		250	nadE NAD+ synthetase. NAD+ synthetase is a nearly	98.66
cd02957		113	Phd_like Phosducin (Phd)-like family; composed of	98.65
cd01999		385	Argininosuccinate_Synthase Argininosuccinate synth	98.64
PRK13980		265	NAD synthetase; Provisional	98.63
cd00553		248	NAD_synthase NAD+ synthase is a homodimer, which c	98.63
PRK08384		381	thiamine biosynthesis protein ThiI; Provisional	98.63
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	98.62
PRK13820		394	argininosuccinate synthase; Provisional	98.61
KOG0190		493	consensus Protein disulfide isomerase (prolyl 4-hy	98.61
cd02962		152	TMX2 TMX2 family; composed of proteins similar to	98.61
TIGR00342		371	thiazole biosynthesis/tRNA modification protein Th	98.6
cd02948		102	TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus	98.6
cd02963		111	TRX_DnaJ TRX domain, DnaJ domain containing protei	98.59
COG3118		304	Thioredoxin domain-containing protein [Posttransla	98.58
PTZ00443		224	Thioredoxin domain-containing protein; Provisional	98.57
cd03001		103	PDI_a_P5 PDIa family, P5 subfamily; composed of eu	98.56
cd02986		114	DLP Dim1 family, Dim1-like protein (DLP) subfamily	98.56
PLN00410		142	U5 snRNP protein, DIM1 family; Provisional	98.56
cd03005		102	PDI_a_ERp46 PDIa family, endoplasmic reticulum pro	98.55
cd02997		104	PDI_a_PDIR PDIa family, PDIR subfamily; composed o	98.53
cd02989		113	Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior	98.53
cd02987		175	Phd_like_Phd Phosducin (Phd)-like family, Phd subf	98.53
PRK01565		394	thiamine biosynthesis protein ThiI; Provisional	98.52
PRK11106		231	queuosine biosynthesis protein QueC; Provisional	98.52
PRK00509		399	argininosuccinate synthase; Provisional	98.51
PRK04527		400	argininosuccinate synthase; Provisional	98.49
cd02956		96	ybbN ybbN protein family; ybbN is a hypothetical p	98.49
PLN00200		404	argininosuccinate synthase; Provisional	98.48
cd02998		105	PDI_a_ERp38 PDIa family, endoplasmic reticulum pro	98.47
cd02988		192	Phd_like_VIAF Phosducin (Phd)-like family, Viral i	98.43
TIGR03573		343	WbuX N-acetyl sugar amidotransferase. This enzyme	98.4
PRK14664		362	tRNA-specific 2-thiouridylase MnmA; Provisional	98.38
PRK10996		139	thioredoxin 2; Provisional	98.37
cd02950		142	TxlA TRX-like protein A (TxlA) family; TxlA was or	98.33
cd03000		104	PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o	98.32
cd02959		117	ERp19 Endoplasmic reticulum protein 19 (ERp19) fam	98.31
KOG0908		288	consensus Thioredoxin-like protein [Posttranslatio	98.28
cd02952		119	TRP14_like Human TRX-related protein 14 (TRP14)-li	98.28
cd02984		97	TRX_PICOT TRX domain, PICOT (for PKC-interacting c	98.24
PTZ00102		477	disulphide isomerase; Provisional	98.24
cd03065		120	PDI_b_Calsequestrin_N PDIb family, Calsequestrin s	98.23
PF06508		209	QueC: Queuosine biosynthesis protein QueC; InterPr	98.22
TIGR01295		122	PedC_BrcD bacteriocin transport accessory protein,	98.22
PTZ00051		98	thioredoxin; Provisional	98.22
cd02953		104	DsbDgamma DsbD gamma family; DsbD gamma is the C-t	98.2
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	98.19
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	98.14
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	98.13
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	98.12
cd03007		116	PDI_a_ERp29_N PDIa family, endoplasmic reticulum p	98.12
PRK01269		482	tRNA s(4)U8 sulfurtransferase; Provisional	98.1
PTZ00102		477	disulphide isomerase; Provisional	98.08
PF03054		356	tRNA_Me_trans: tRNA methyl transferase; InterPro:	98.06
TIGR01068		101	thioredoxin thioredoxin. Several proteins, such as	98.06
cd01994		194	Alpha_ANH_like_IV This is a subfamily of Adenine n	98.02
cd02965		111	HyaE HyaE family; HyaE is also called HupG and Hox	98.02
cd02951		125	SoxW SoxW family; SoxW is a bacterial periplasmic	97.98
cd03008		146	TryX_like_RdCVF Tryparedoxin (TryX)-like family, R	97.97
cd01986		103	Alpha_ANH_like Adenine nucleotide alpha hydrolases	97.91
COG2117		198	Predicted subunit of tRNA(5-methylaminomethyl-2-th	97.91
PF02540		242	NAD_synthase: NAD synthase; InterPro: IPR022310 NA	97.88
KOG4277		468	consensus Uncharacterized conserved protein, conta	97.87
COG0482		356	TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid	97.85
cd02967		114	mauD Methylamine utilization (mau) D family; mauD	97.84
PF02568		197	ThiI: Thiamine biosynthesis protein (ThiI); InterP	97.81
cd02975		113	PfPDO_like_N Pyrococcus furiosus protein disulfide	97.8
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	97.78
COG0603		222	Predicted PP-loop superfamily ATPase [General func	97.78
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	97.78
cd02964		132	TryX_like_family Tryparedoxin (TryX)-like family;	97.76
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	97.74
cd03009		131	TryX_like_TryX_NRX Tryparedoxin (TryX)-like family	97.73
PF13905		95	Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_	97.67
cd02947		93	TRX_family TRX family; composed of two groups: Gro	97.66
PTZ00323		294	NAD+ synthase; Provisional	97.64
KOG1731		606	consensus FAD-dependent sulfhydryl oxidase/quiesci	97.6
PHA02125		75	thioredoxin-like protein	97.6
TIGR03679		218	arCOG00187 arCOG00187 universal archaeal metal-bin	97.59
TIGR00412		76	redox_disulf_2 small redox-active disulfide protei	97.57
PRK15412		185	thiol:disulfide interchange protein DsbE; Provisio	97.54
KOG2805		377	consensus tRNA (5-methylaminomethyl-2-thiouridylat	97.53
cd03010		127	TlpA_like_DsbE TlpA-like family, DsbE (also known	97.53
cd01991		269	Asn_Synthase_B_C The C-terminal domain of Asparagi	97.5
PRK00876		326	nadE NAD synthetase; Reviewed	97.49
PF13899		82	Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_	97.46
cd03011		123	TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso	97.39
PRK14018		521	trifunctional thioredoxin/methionine sulfoxide red	97.39
TIGR00385		173	dsbE periplasmic protein thiol:disulfide oxidoredu	97.39
cd03012		126	TlpA_like_DipZ_like TlpA-like family, DipZ-like su	97.37
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	97.37
cd02955		124	SSP411 TRX domain, SSP411 protein family; members	97.35
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	97.32
PRK05370		447	argininosuccinate synthase; Validated	97.31
PRK00293		571	dipZ thiol:disulfide interchange protein precursor	97.25
PRK13728		181	conjugal transfer protein TrbB; Provisional	97.23
cd02960		130	AGR Anterior Gradient (AGR) family; members of thi	97.22
PRK02628		679	nadE NAD synthetase; Reviewed	97.21
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	97.19
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	97.15
TIGR02661		189	MauD methylamine dehydrogenase accessory protein M	97.15
PF08534		146	Redoxin: Redoxin; InterPro: IPR013740 This redoxin	97.13
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	97.12
PTZ00056		199	glutathione peroxidase; Provisional	97.08
COG0526		127	TrxA Thiol-disulfide isomerase and thioredoxins [P	97.05
PRK13981		540	NAD synthetase; Provisional	97.03
cd00340		152	GSH_Peroxidase Glutathione (GSH) peroxidase family	97.03
PRK03147		173	thiol-disulfide oxidoreductase; Provisional	97.02
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	96.99
TIGR02540		153	gpx7 putative glutathione peroxidase Gpx7. This mo	96.98
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	96.97
COG0519		315	GuaA GMP synthase, PP-ATPase domain/subunit [Nucle	96.92
PLN02399		236	phospholipid hydroperoxide glutathione peroxidase	96.87
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	96.85
PF00764		388	Arginosuc_synth: Arginosuccinate synthase; InterPr	96.82
PF00733		255	Asn_synthase: Asparagine synthase; InterPro: IPR00	96.81
PRK00768		268	nadE NAD synthetase; Reviewed	96.76
PLN02412		167	probable glutathione peroxidase	96.75
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	96.68
TIGR00290		223	MJ0570_dom MJ0570-related uncharacterized domain.	96.58
COG0137		403	ArgG Argininosuccinate synthase [Amino acid transp	96.47
cd01984		86	AANH_like Adenine nucleotide alpha hydrolases supe	96.37
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	96.23
TIGR01536		467	asn_synth_AEB asparagine synthase (glutamine-hydro	96.19
TIGR01626		184	ytfJ_HI0045 conserved hypothetical protein YtfJ-fa	96.17
COG0301		383	ThiI Thiamine biosynthesis ATP pyrophosphatase [Co	96.1
COG1365		255	Predicted ATPase (PP-loop superfamily) [General fu	96.07
cd02968		142	SCO SCO (an acronym for Synthesis of Cytochrome c	95.97
PTZ00256		183	glutathione peroxidase; Provisional	95.93
KOG3425		128	consensus Uncharacterized conserved protein [Funct	95.88
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	95.86
KOG0914		265	consensus Thioredoxin-like protein [Posttranslatio	95.86
PF00578		124	AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per	95.85
cd02969		171	PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot	95.84
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	95.76
KOG2501		157	consensus Thioredoxin, nucleoredoxin and related p	95.59
TIGR00289		222	conserved hypothetical protein TIGR00289. Homologo	95.53
COG4232		569	Thiol:disulfide interchange protein [Posttranslati	95.53
cd02970		149	PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot	95.5
PRK10606		183	btuE putative glutathione peroxidase; Provisional	95.48
cd03018		149	PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik	95.28
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	95.21
COG0171		268	NadE NAD synthase [Coenzyme metabolism]	95.14
PRK00522		167	tpx lipid hydroperoxide peroxidase; Provisional	95.12
TIGR03137		187	AhpC peroxiredoxin. This gene contains two invaria	95.09
cd03015		173	PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-	95.09
cd03014		143	PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical	95.05
cd02971		140	PRX_family Peroxiredoxin (PRX) family; composed of	94.87
cd03017		140	PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit	94.84
cd02958		114	UAS UAS family; UAS is a domain of unknown functio	94.69
KOG0913		248	consensus Thiol-disulfide isomerase and thioredoxi	94.47
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	94.45
KOG2840		347	consensus Uncharacterized conserved protein with s	94.31
COG2102		223	Predicted ATPases of PP-loop superfamily [General	94.11
PF01902		218	ATP_bind_4: ATP-binding region; InterPro: IPR00276	94.08
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	94.04
PF06110		119	DUF953: Eukaryotic protein of unknown function (DU	93.74
smart00594		122	UAS UAS domain.	93.61
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	93.37
PRK09437		154	bcp thioredoxin-dependent thiol peroxidase; Review	92.89
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	92.76
KOG1622		552	consensus GMP synthase [Nucleotide transport and m	92.7
PF14595		129	Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A.	92.64
COG0367		542	AsnB Asparagine synthase (glutamine-hydrolyzing) [	92.33
PRK10382		187	alkyl hydroperoxide reductase subunit C; Provision	91.89
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	91.86
TIGR03104		589	trio_amidotrans asparagine synthase family amidotr	91.52
TIGR03108		628	eps_aminotran_1 exosortase 1 system-associated ami	91.21
PF03190		163	Thioredox_DsbH: Protein of unknown function, DUF25	90.84
PRK15000		200	peroxidase; Provisional	90.04
PRK11200		85	grxA glutaredoxin 1; Provisional	89.34
PTZ00077		586	asparagine synthetase-like protein; Provisional	89.04
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	88.86
PRK13190		202	putative peroxiredoxin; Provisional	88.7
PHA03050		108	glutaredoxin; Provisional	88.55
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	88.26
PF13728		215	TraF: F plasmid transfer operon protein	88.14
cd03016		203	PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub	88.08
PTZ00137		261	2-Cys peroxiredoxin; Provisional	88.05
PRK09431		554	asnB asparagine synthetase B; Provisional	87.62
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	86.87
PLN02549		578	asparagine synthase (glutamine-hydrolyzing)	86.35
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	86.17
PRK13599		215	putative peroxiredoxin; Provisional	86.02
KOG0573		520	consensus Asparagine synthase [Amino acid transpor	85.07
PRK13191		215	putative peroxiredoxin; Provisional	84.83
PLN02339		700	NAD+ synthase (glutamine-hydrolysing)	84.75
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	84.27
PRK13189		222	peroxiredoxin; Provisional	84.02
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	83.71
PF13462		162	Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV	82.94
cd02972		98	DsbA_family DsbA family; consists of DsbA and DsbA	82.64
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	82.14
cd03020		197	DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil	81.47
PTZ00253		199	tryparedoxin peroxidase; Provisional	80.72
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	80.4

>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

Probab=100.00  E-value=1.5e-100  Score=786.05  Aligned_cols=398  Identities=78%  Similarity=1.271  Sum_probs=359.3

Q ss_pred             CccccccccccccCc-ccccCCcccccccccccccccccccccccc--hhccccccCCCCCCCCCCCCcccccccccCcc
Q 015013            1 MALAVTSSNSISSSS-FALTSSSNDIKVSQIGSFRLVDRAHVASTS--LSQRRSLVRPLNAEPKRNDSVVPLAATLATPE   77 (414)
Q Consensus         1 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   77 (414)
                      ||++++|+++++++. .++.++++++|++|+|+++++++.++.+.+  +++||++|+|+++++++++++++.+|++++|+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (463)
T TIGR00424         1 MALAVTSSSTAISGISLSRSGESTEAKAAQIGSFRLLDRPHTISPSVNLSRRRLSVKPLNAEPKRNESIVPSAATTVAPE   80 (463)
T ss_pred             CchhhhhHHhhhhccccccccccchhhhhhccccccccccccchhhhhhhcccccccccccccccccccccchhhccCcc
Confidence            999997766555443 233347889999999999999999855444  89999999999999999999999999999998


Q ss_pred             hhccccChhhHHHHHHHhccCCHHHHHHHHHHHcCCcEEEEechHHHHHHHHHHHhcCCCeEEEEEeCCCCcHHHHHHHH
Q 015013           78 VAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFD  157 (414)
Q Consensus        78 ~~~~~~~~~~~~~l~~~l~~~~a~eil~~a~~~~~~~i~vafSGGKDSvlL~L~~~~~~~i~VvflDTG~~fpET~~~v~  157 (414)
                      .++..-+..+++.+|++|++++|+++|+|+++.|++++++++|||+|++||||+.+.+++++|||+|||++|||||+|++
T Consensus        81 ~~~~~~~~~~l~~l~~~l~~~~~~eil~~a~~~f~~~iavasSG~edsvLlhl~~~~~~~ipV~flDTG~lFpETy~~~d  160 (463)
T TIGR00424        81 VEEKVVEVEDFEKLAKKLENASPLEIMDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFD  160 (463)
T ss_pred             cccccCCHHHHHHHHHHhhcCCHHHHHHHHHHhcCCCEEEEeccHHHHHHHHHHHHhCCCCcEEEecCCCCCHHHHHHHH
Confidence            88555556899999999999999999999999999889999999999999999999999999999999999999999999


Q ss_pred             HHHHHhCCcEEEEcCChHHHHHHHHhcCCCCCCcccchhhhcchhchhHHHHhccCcEEEecccccCCccCcCCCCceec
Q 015013          158 EVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQV  237 (414)
Q Consensus       158 ~l~~~~gl~i~~~~P~~~~~~~~~~~~G~~~~~~~~~~~Cc~~~Kv~Pl~ral~~~~~~itGiRrdES~~~Ra~~~~~e~  237 (414)
                      +++++||++|+++.|+....+++...+|++.|+.+++++||.++|++||+|+|+++++||||+||+||+++|+.++++++
T Consensus       161 ~v~~~ygl~l~~~~p~~~~~~~~~~~~G~~~~~~~~~~~CC~irKVePL~raL~~~~awitG~Rr~Qs~~tRa~~~~ve~  240 (463)
T TIGR00424       161 AVEKQYGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVVQV  240 (463)
T ss_pred             HHHHHhCCceEEECCCcchHHHHHHhcCcccCCcCChHHHhhHHhHHHHHHHHHhCCcEEeeeccccCccccccCCcccc
Confidence            99999999999999988777777888999888888889999999999999999999999999999999558999999999


Q ss_pred             CCCCccccCCCCCeEEEEeCccccHHHHHHHHHhCCCCCChhhhCCCCCCCCccCCCCCCCCCcccccccccCCCCccce
Q 015013          238 DPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKEC  317 (414)
Q Consensus       238 d~~~~~~~~~~~~~~ki~PL~dWt~~DVw~Yi~~~~lP~npLYd~Gy~SiGC~~CT~~v~~g~~~R~GRW~w~~~~k~EC  317 (414)
                      |+.+++.+++.++++|+|||++||.+|||.||++|+|||||||++||+||||+|||+||.+|+|+|+|||||++..||||
T Consensus       241 d~~~~~~~~~~~~~iKvnPLa~Wt~~dVw~Yi~~~~LP~npL~~~GY~SIGC~pCT~pv~~ged~RaGRW~w~~~~k~EC  320 (463)
T TIGR00424       241 DPVFEGLDGGVGSLVKWNPVANVEGKDVWNFLRTMDVPVNTLHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKEC  320 (463)
T ss_pred             cccccccccCCCceEEEeecccCCHHHHHHHHHHcCCCCCchhhcCCCCCCCCCCCCCCCCCCCcccccccCCCCCCccC
Confidence            98776655555669999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCCCcccccccccCCCCCCCCCcchhhhccCCCCeEecCccchHHHHhhhcCCCcEEEEEeCCCChhhHhHHHHHHHH
Q 015013          318 GLHKGNIKQEDAAVNGNGNGAGNASEAVADIFNSQNLVTLNRTGMENLARLDHRQEPWLVVLYAPWCQFCQVIDVFMQIR  397 (414)
Q Consensus       318 Glh~~~~~~~~~~~~~~~~~~~~~~~~~~dl~~~~~v~~l~~~~~e~~v~~~~~~~~vlV~FyApWC~~Ck~m~p~~ee~  397 (414)
                      |||..+++...    .+.....+...++.|||+++.|+.|+.+||++++++.+.+++|||+||||||++|+.|.|.|+++
T Consensus       321 GlH~~~~~~~~----~~~~~~~~~~~~~~dl~~~~~Vv~L~~~nf~~~v~~~~~~k~VLV~FyApWC~~Ck~m~P~~eel  396 (463)
T TIGR00424       321 GLHKGNIKEET----LDGAVNGNGSDAVADIFDSNNVVSLSRPGIENLLKLEERKEAWLVVLYAPWCPFCQAMEASYLEL  396 (463)
T ss_pred             CCCCCCccccc----cchhhhhccccccccccCCCCeEECCHHHHHHHHhhhcCCCeEEEEEECCCChHHHHHHHHHHHH
Confidence            99998776543    22444456778899999999999999999999987667899999999999999999999999999


Q ss_pred             HHHHH
Q 015013          398 FQIIA  402 (414)
Q Consensus       398 ~~i~a  402 (414)
                      ++.+.
T Consensus       397 A~~~~  401 (463)
T TIGR00424       397 AEKLA  401 (463)
T ss_pred             HHHhc
Confidence            88875

This enzyme, involved in the assimilation of inorganic sulfate, is closely related to the thioredoxin-dependent PAPS reductase of Bacteria (CysH) and Saccharomyces cerevisiae. However, it has its own C-terminal thioredoxin-like domain and is not thioredoxin-dependent. Also, it has a substrate preference for 5'-adenylylsulfate (APS) over 3'-phosphoadenylylsulfate (PAPS) so the pathway does not require an APS kinase (CysC) to convert APS to PAPS. Arabidopsis thaliana appears to have three isozymes, all able to complement E. coli CysH mutants (even in backgrounds lacking thioredoxin or APS kinase) but likely localized to different compartments in Arabidopsis.

>PLN02309 5'-adenylylsulfate reductase	Back alignment and domain information

>KOG0189 consensus Phosphoadenosine phosphosulfate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent	Back alignment and domain information

>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional	Back alignment and domain information

>TIGR00434 cysH phosophoadenylyl-sulfate reductase (thioredoxin)	Back alignment and domain information

>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>TIGR02055 APS_reductase thioredoxin-dependent adenylylsulfate APS reductase	Back alignment and domain information

>PRK12563 sulfate adenylyltransferase subunit 2; Provisional	Back alignment and domain information

>TIGR02039 CysD sulfate adenylyltransferase, small subunit	Back alignment and domain information

>PRK08557 hypothetical protein; Provisional	Back alignment and domain information

>PRK13794 hypothetical protein; Provisional	Back alignment and domain information

>PF01507 PAPS_reduct: Phosphoadenosine phosphosulfate reductase family; InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>PRK05253 sulfate adenylyltransferase subunit 2; Provisional	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>PRK08576 hypothetical protein; Provisional	Back alignment and domain information

>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase	Back alignment and domain information

>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC	Back alignment and domain information

>PRK06850 hypothetical protein; Provisional	Back alignment and domain information

>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only]	Back alignment and domain information

>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain	Back alignment and domain information

>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional	Back alignment and domain information

>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,]	Back alignment and domain information

>TIGR00268 conserved hypothetical protein TIGR00268	Back alignment and domain information

>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox	Back alignment and domain information

>KOG2644 consensus 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism; Coenzyme transport and metabolism]	Back alignment and domain information

>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]	Back alignment and domain information

>PRK00074 guaA GMP synthase; Reviewed	Back alignment and domain information

>cd01995 ExsB ExsB is a transcription regulator related protein	Back alignment and domain information

>PRK00919 GMP synthase subunit B; Validated	Back alignment and domain information

>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway	Back alignment and domain information

>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase	Back alignment and domain information

>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit	Back alignment and domain information

>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed	Back alignment and domain information

>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>PRK14561 hypothetical protein; Provisional	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional	Back alignment and domain information

>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase	Back alignment and domain information

>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional	Back alignment and domain information

>PRK08349 hypothetical protein; Validated	Back alignment and domain information

>PHA02278 thioredoxin-like protein	Back alignment and domain information

>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention	Back alignment and domain information

>cd01998 tRNA_Me_trans tRNA methyl transferase	Back alignment and domain information

>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein	Back alignment and domain information

>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein	Back alignment and domain information

>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein	Back alignment and domain information

>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif	Back alignment and domain information

>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00364 exsB protein	Back alignment and domain information

>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1	Back alignment and domain information

>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44	Back alignment and domain information

>TIGR00032 argG argininosuccinate synthase	Back alignment and domain information

>PRK09381 trxA thioredoxin; Provisional	Back alignment and domain information

>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX	Back alignment and domain information

>PLN02347 GMP synthetase	Back alignment and domain information

>TIGR00552 nadE NAD+ synthetase	Back alignment and domain information

>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions	Back alignment and domain information

>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase	Back alignment and domain information

>PRK13980 NAD synthetase; Provisional	Back alignment and domain information

>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD)	Back alignment and domain information

>PRK08384 thiamine biosynthesis protein ThiI; Provisional	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>PRK13820 argininosuccinate synthase; Provisional	Back alignment and domain information

>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library	Back alignment and domain information

>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI	Back alignment and domain information

>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein	Back alignment and domain information

>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00443 Thioredoxin domain-containing protein; Provisional	Back alignment and domain information

>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1	Back alignment and domain information

>PLN00410 U5 snRNP protein, DIM1 family; Provisional	Back alignment and domain information

>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains	Back alignment and domain information

>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif	Back alignment and domain information

>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions	Back alignment and domain information

>PRK01565 thiamine biosynthesis protein ThiI; Provisional	Back alignment and domain information

>PRK11106 queuosine biosynthesis protein QueC; Provisional	Back alignment and domain information

>PRK00509 argininosuccinate synthase; Provisional	Back alignment and domain information

>PRK04527 argininosuccinate synthase; Provisional	Back alignment and domain information

>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain	Back alignment and domain information

>PLN00200 argininosuccinate synthase; Provisional	Back alignment and domain information

>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5	Back alignment and domain information

>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis	Back alignment and domain information

>TIGR03573 WbuX N-acetyl sugar amidotransferase	Back alignment and domain information

>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional	Back alignment and domain information

>PRK10996 thioredoxin 2; Provisional	Back alignment and domain information

>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus	Back alignment and domain information

>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus	Back alignment and domain information

>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain	Back alignment and domain information

>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1	Back alignment and domain information

>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle	Back alignment and domain information

>PF06508 QueC: Queuosine biosynthesis protein QueC; InterPro: IPR018317 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome	Back alignment and domain information

>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells	Back alignment and domain information

>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34	Back alignment and domain information

>TIGR01068 thioredoxin thioredoxin	Back alignment and domain information

>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily	Back alignment and domain information

>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO	Back alignment and domain information

>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation	Back alignment and domain information

>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors	Back alignment and domain information

>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases	Back alignment and domain information

>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6	Back alignment and domain information

>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only]	Back alignment and domain information

>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source	Back alignment and domain information

>PF02568 ThiI: Thiamine biosynthesis protein (ThiI); InterPro: IPR020536 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell	Back alignment and domain information

>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only]	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif	Back alignment and domain information

>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A	Back alignment and domain information

>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>PTZ00323 NAD+ synthase; Provisional	Back alignment and domain information

>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PHA02125 thioredoxin-like protein	Back alignment and domain information

>TIGR03679 arCOG00187 arCOG00187 universal archaeal metal-binding-domain/4Fe-4S-binding-domain containing ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2	Back alignment and domain information

>PRK15412 thiol:disulfide interchange protein DsbE; Provisional	Back alignment and domain information

>KOG2805 consensus tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif	Back alignment and domain information

>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B	Back alignment and domain information

>PRK00876 nadE NAD synthetase; Reviewed	Back alignment and domain information

>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A	Back alignment and domain information

>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif	Back alignment and domain information

>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional	Back alignment and domain information

>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily	Back alignment and domain information

>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>PRK05370 argininosuccinate synthase; Validated	Back alignment and domain information

>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional	Back alignment and domain information

>PRK13728 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus	Back alignment and domain information

>PRK02628 nadE NAD synthetase; Reviewed	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD	Back alignment and domain information

>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>PTZ00056 glutathione peroxidase; Provisional	Back alignment and domain information

>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>PRK13981 NAD synthetase; Provisional	Back alignment and domain information

>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate	Back alignment and domain information

>PRK03147 thiol-disulfide oxidoreductase; Provisional	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>TIGR02540 gpx7 putative glutathione peroxidase Gpx7	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism]	Back alignment and domain information

>PLN02399 phospholipid hydroperoxide glutathione peroxidase	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6	Back alignment and domain information

>PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO)	Back alignment and domain information

>PRK00768 nadE NAD synthetase; Reviewed	Back alignment and domain information

>PLN02412 probable glutathione peroxidase	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain	Back alignment and domain information

>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF)	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing)	Back alignment and domain information

>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626	Back alignment and domain information

>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism]	Back alignment and domain information

>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only]	Back alignment and domain information

>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold	Back alignment and domain information

>PTZ00256 glutathione peroxidase; Provisional	Back alignment and domain information

>KOG3425 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells	Back alignment and domain information

>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only]	Back alignment and domain information

>TIGR00289 conserved hypothetical protein TIGR00289	Back alignment and domain information

>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>PRK10606 btuE putative glutathione peroxidase; Provisional	Back alignment and domain information

>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>COG0171 NadE NAD synthase [Coenzyme metabolism]	Back alignment and domain information

>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional	Back alignment and domain information

>TIGR03137 AhpC peroxiredoxin	Back alignment and domain information

>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides	Back alignment and domain information

>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx)	Back alignment and domain information

>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified	Back alignment and domain information

>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides	Back alignment and domain information

>cd02958 UAS UAS family; UAS is a domain of unknown function	Back alignment and domain information

>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion]	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>KOG2840 consensus Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only]	Back alignment and domain information

>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only]	Back alignment and domain information

>PF01902 ATP_bind_4: ATP-binding region; InterPro: IPR002761 This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like	Back alignment and domain information

>smart00594 UAS UAS domain	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A	Back alignment and domain information

>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase	Back alignment and domain information

>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1	Back alignment and domain information

>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins	Back alignment and domain information

>PRK15000 peroxidase; Provisional	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>PTZ00077 asparagine synthetase-like protein; Provisional	Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>PRK13190 putative peroxiredoxin; Provisional	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine	Back alignment and domain information

>PTZ00137 2-Cys peroxiredoxin; Provisional	Back alignment and domain information

>PRK09431 asnB asparagine synthetase B; Provisional	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>PLN02549 asparagine synthase (glutamine-hydrolyzing)	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>PRK13599 putative peroxiredoxin; Provisional	Back alignment and domain information

>KOG0573 consensus Asparagine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13191 putative peroxiredoxin; Provisional	Back alignment and domain information

>PLN02339 NAD+ synthase (glutamine-hydrolysing)	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>PRK13189 peroxiredoxin; Provisional	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A	Back alignment and domain information

>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold	Back alignment and domain information

>PTZ00253 tryparedoxin peroxidase; Provisional	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		414
2goy_A		275	Crystal Structure Of Assimilatory Adenosine 5'- Pho		1e-80
2oq2_A		261	Crystal Structure Of Yeast Paps Reductase With Pap,		6e-15
2o8v_A		252	Paps Reductase In A Covalent Complex With Thioredox		2e-13
1sur_A		215	Phospho-Adenylyl-Sulfate Reductase Length = 215		1e-10

>pdb|2GOY|A Chain A, Crystal Structure Of Assimilatory Adenosine 5'- Phosphosulfate Reductase With Bound Aps Length = 275

Back alignment and structure

Iteration: 1

Score = 296 bits (759), Expect = 1e-80, Method: Compositional matrix adjust. Identities = 132/238 (55%), Positives = 176/238 (73%), Gaps = 3/238 (1%) Query: 87 DFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTG 146 D A L + SP +I+ A E FG+++ I+FSGAEDV L++ A R +VFSLDTG Sbjct: 29 DLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTG 88 Query: 147 RLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPL 206 RL+PETYRF D+V +H+GI I+ + PD ++ LV+ KGLFSFY DGH ECC +RK+ PL Sbjct: 89 RLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPL 148 Query: 207 RRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIW 266 +R L G+RAW TGQR+DQSPGTRS++ V+++D F E L K+NP++++ ++W Sbjct: 149 KRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAFSTPE---KPLYKFNPLSSMTSEEVW 205 Query: 267 NFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNI 324 ++R +++P NSLH +GYISIGCEPCTRPVLP QHEREGRWWWE+A KECGLH GN+ Sbjct: 206 GYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGNL 263

PyMOL of 2goy

>pdb|2OQ2|A Chain A, Crystal Structure Of Yeast Paps Reductase With Pap, A Product Complex Length = 261

Back alignment and structure

>pdb|2O8V|A Chain A, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 252

Back alignment and structure

>pdb|1SUR|A Chain A, Phospho-Adenylyl-Sulfate Reductase Length = 215

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		414
2goy_A		275	Adenosine phosphosulfate reductase; iron sulfur cl	1e-103
2o8v_A		252	Phosphoadenosine phosphosulfate reductase; disulfi	1e-99
2oq2_A		261	Phosphoadenosine phosphosulfate reductase; sulfate	5e-85
1sur_A		215	PAPS reductase; assimilatory sulfate reduction, 3-	5e-81
2wsi_A		306	FAD synthetase; transferase, nucleotidyltransferas	8e-51
3fwk_A		308	FMN adenylyltransferase; FAD biosynthesis, alpha/b	2e-45
1zun_A		325	Sulfate adenylyltransferase subunit 2; beta barrel	8e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-09

>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Length = 275	Back alignment and structure

 Score =  306 bits (786), Expect = e-103
 Identities = 134/284 (47%), Positives = 187/284 (65%), Gaps = 9/284 (3%)

Query: 53  VRPLNAEPKRNDSVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFG 112
           + P    P           + A  +    +    D    A  L + SP +I+  A E FG
Sbjct: 1   MLPFATIPATE------RNSAAQHQDPSPMSQPFDLPALASSLADKSPQDILKAAFEHFG 54

Query: 113 NDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFP 172
           +++ I+FSGAEDV L++ A    R  +VFSLDTGRL+PETYRF D+V +H+GI I+ + P
Sbjct: 55  DELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREHYGIAIDVLSP 114

Query: 173 DAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEI 232
           D   ++ LV+ KGLFSFY DGH ECC +RK+ PL+R L G+RAW TGQR+DQSPGTRS++
Sbjct: 115 DPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPGTRSQV 174

Query: 233 PVVQVDPVFEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPC 292
            V+++D  F   E  +    K+NP++++   ++W ++R +++P NSLH +GYISIGCEPC
Sbjct: 175 AVLEIDGAFSTPEKPL---YKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIGCEPC 231

Query: 293 TRPVLPGQHEREGRWWWEDAKAKECGLHKGNIKQEDAAVNGNGN 336
           TRPVLP QHEREGRWWWE+A  KECGLH GN+  +    + + +
Sbjct: 232 TRPVLPNQHEREGRWWWEEATHKECGLHAGNLISKALEHHHHHH 275

PyMOL of 2goy

>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 252	Back alignment and structure

>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Length = 261	Back alignment and structure

>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Length = 215	Back alignment and structure

>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Length = 306	Back alignment and structure

>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Length = 308	Back alignment and structure

>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Length = 325	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		414
2goy_A		275	Adenosine phosphosulfate reductase; iron sulfur cl	100.0
2oq2_A		261	Phosphoadenosine phosphosulfate reductase; sulfate	100.0
2o8v_A		252	Phosphoadenosine phosphosulfate reductase; disulfi	100.0
3fwk_A		308	FMN adenylyltransferase; FAD biosynthesis, alpha/b	100.0
1zun_A		325	Sulfate adenylyltransferase subunit 2; beta barrel	100.0
1sur_A		215	PAPS reductase; assimilatory sulfate reduction, 3-	100.0
2wsi_A		306	FAD synthetase; transferase, nucleotidyltransferas	100.0
2ywb_A		503	GMP synthase [glutamine-hydrolyzing]; GMP syntheta	99.43
1wy5_A		317	TILS, hypothetical UPF0072 protein AQ_1887; N-type	99.39
2dpl_A		308	GMP synthetase, GMP synthase [glutamine-hydrolyzin	99.37
3bl5_A		219	Queuosine biosynthesis protein QUEC; PREQ1 biosynt	99.24
3k32_A		203	Uncharacterized protein MJ0690; predicted subunit	99.19
3a2k_A		464	TRNA(Ile)-lysidine synthase; ligase, pseudo-knot,	99.12
1ni5_A		433	Putative cell cycle protein MESJ; structural genom	99.11
1kor_A		400	Argininosuccinate synthetase; ligase, riken struct	99.1
2pg3_A		232	Queuosine biosynthesis protein QUEC; YP_049261.1,	99.02
2hma_A		376	Probable tRNA (5-methylaminomethyl-2-thiouridylat	98.99
3evi_A		118	Phosducin-like protein 2; alpha beta, 3-layer(ABA)	98.95
3h79_A		127	Thioredoxin-like protein; thioredoxin fold, cataly	98.94
3zzx_A		105	Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va	98.9
1xng_A		268	NH(3)-dependent NAD(+) synthetase; amidotransferas	98.88
2av4_A		160	Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI	98.87
3tqi_A		527	GMP synthase [glutamine-hydrolyzing]; ligase; 2.84	98.83
2der_A		380	TRNA-specific 2-thiouridylase MNMA; protein-RNA co	98.82
3p52_A		249	NH(3)-dependent NAD(+) synthetase; structural geno	98.8
2e18_A		257	NH(3)-dependent NAD(+) synthetase; ligase, structu	98.78
2dml_A		130	Protein disulfide-isomerase A6; thioredoxin domain	98.78
2djj_A		121	PDI, protein disulfide-isomerase; thioredoxin fold	98.78
2pu9_C		111	TRX-F, thioredoxin F-type, chloroplast; protein-pr	98.77
3fiu_A		249	NH(3)-dependent NAD(+) synthetase; rossman fold, a	98.76
2dj1_A		140	Protein disulfide-isomerase A4; protein ERP-72, ER	98.75
2dbc_A		135	PDCL2, unnamed protein product; phosducin-like pro	98.75
1x5d_A		133	Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC	98.74
3hxs_A		141	Thioredoxin, TRXP; electron transport; 2.00A {Bact	98.73
2trx_A		108	Thioredoxin; electron transport; 1.68A {Escherichi	98.73
2dj0_A		137	Thioredoxin-related transmembrane protein 2; AVLA2	98.7
3gnj_A		111	Thioredoxin domain protein; APC92103, STR genomics	98.7
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.7
2dj3_A		133	Protein disulfide-isomerase A4; protein ERP-72, ER	98.69
3tco_A		109	Thioredoxin (TRXA-1); disulfide oxidoreductase, ox	98.68
1gpm_A		525	GMP synthetase, XMP aminase; class I glutamine ami	98.67
3aps_A		122	DNAJ homolog subfamily C member 10; thioredoxin fo	98.66
2i4a_A		107	Thioredoxin; acidophIle, disulfide exchange, oxido	98.66
1faa_A		124	Thioredoxin F; electron transport; 1.85A {Spinacia	98.66
1mek_A		120	Protein disulfide isomerase; electron transport, r	98.65
1zma_A		118	Bacterocin transport accessory protein; alpha-beta	98.65
1t00_A		112	Thioredoxin, TRX; redox regulation, multifunction	98.64
1nsw_A		105	Thioredoxin, TRX; thermostability, electron transp	98.64
3ed3_A		298	Protein disulfide-isomerase MPD1; thioredoxin-like	98.64
3ga4_A		178	Dolichyl-diphosphooligosaccharide-protein glycosyl	98.64
1gh2_A		107	Thioredoxin-like protein; redox-active center, ele	98.63
3hz4_A		140	Thioredoxin; NYSGXRC, PSI-II, reduced form, protei	98.63
3qfa_C		116	Thioredoxin; protein-protein complex, rossmann fol	98.61
1thx_A		115	Thioredoxin, thioredoxin 2; oxido-reductase, elect	98.61
3f3q_A		109	Thioredoxin-1; His TAG, electron transport, cytopl	98.61
3die_A		106	Thioredoxin, TRX; electron transport, SWAP domain,	98.61
3uvt_A		111	Thioredoxin domain-containing protein 5; thioredox	98.6
3d6i_A		112	Monothiol glutaredoxin-3; thioredoxin-like, electr	98.6
1dby_A		107	Chloroplast thioredoxin M CH2; thioredoxin CH2, ch	98.6
3q6o_A		244	Sulfhydryl oxidase 1; protein disulfide isomerase,	98.6
2o8v_B		128	Thioredoxin 1; disulfide crosslinked complex, oxid	98.6
2yzu_A		109	Thioredoxin; redox protein, electron transport, st	98.6
2c5s_A		413	THII, probable thiamine biosynthesis protein THII;	98.59
2voc_A		112	Thioredoxin; electron transport, homodimer, disulf	98.58
3idv_A		241	Protein disulfide-isomerase A4; thioredoxin-like f	98.58
1x5e_A		126	Thioredoxin domain containing protein 1; TMX, TXND	98.58
1r26_A		125	Thioredoxin; redox-active disulfide, electron tran	98.57
1w4v_A		119	Thioredoxin, mitochondrial; antioxidant enzyme, mi	98.57
1fb6_A		105	Thioredoxin M; electron transport; 2.10A {Spinacia	98.56
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.56
3cxg_A		133	Putative thioredoxin; malaria, structural GEN oxid	98.56
3p2a_A		148	Thioredoxin 2, putative thioredoxin-like protein;	98.55
2f51_A		118	Thioredoxin; electron transport; 1.90A {Trichomona	98.55
2ppt_A		155	Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc	98.55
2l5l_A		136	Thioredoxin; structural genomics, electron transpo	98.55
3emx_A		135	Thioredoxin; structural genomics, oxidoreductase,	98.54
2e0q_A		104	Thioredoxin; electron transport; 1.49A {Sulfolobus	98.54
2qsi_A		137	Putative hydrogenase expression/formation protein;	98.54
2i1u_A		121	Thioredoxin, TRX, MPT46; redox protein, electron t	98.53
1ep7_A		112	Thioredoxin CH1, H-type; electron transport; 2.10A	98.53
3gix_A		149	Thioredoxin-like protein 4B; PRE-mRNA splicing, TX	98.53
1a0r_P		245	Phosducin, MEKA, PP33; transducin, beta-gamma, sig	98.52
2xc2_A		117	Thioredoxinn; oxidoreductase, protein disulfide re	98.51
2r2j_A		382	Thioredoxin domain-containing protein 4; CRFS moti	98.49
3uem_A		361	Protein disulfide-isomerase; thioredoxin-like doma	98.49
1qgv_A		142	Spliceosomal protein U5-15KD; snRNP, thioredoxin,	98.49
2vlu_A		122	Thioredoxin, thioredoxin H isoform 2.; oxidoreduct	98.47
1syr_A		112	Thioredoxin; SGPP, structural genomics, PSI, prote	98.47
4euy_A		105	Uncharacterized protein; structural genomics, PSI-	98.46
2nz2_A		413	Argininosuccinate synthase; amino-acid biosynthesi	98.45
2b5e_A		504	Protein disulfide-isomerase; 2.40A {Saccharomyces	98.45
1xfl_A		124	Thioredoxin H1; AT3G51030, structural genomics, pr	98.45
1xwb_A		106	Thioredoxin; dimerization, redox regulation, THI X	98.45
2qgv_A		140	Hydrogenase-1 operon protein HYAE; alpha-beta prot	98.44
1k92_A		455	Argininosuccinate synthase, argininosuccinate SY;	98.43
3d22_A		139	TRXH4, thioredoxin H-type; electron transport, cyt	98.43
2wz9_A		153	Glutaredoxin-3; protein binding; 1.55A {Homo sapie	98.43
1ti3_A		113	Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul	98.42
2trc_P		217	Phosducin, MEKA, PP33; transducin, beta-gamma, sig	98.41
2b5e_A		504	Protein disulfide-isomerase; 2.40A {Saccharomyces	98.41
2vim_A		104	Thioredoxin, TRX; thioredoxin fold, oxidoreductase	98.4
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	98.4
3m9j_A		105	Thioredoxin; oxidoreductase; 1.10A {Homo sapiens}	98.38
3f8u_A		481	Protein disulfide-isomerase A3ERP57; endoplasmic r	98.38
2l6c_A		110	Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu	98.37
1oaz_A		123	Thioredoxin 1; immune system, antibody/complex, an	98.37
2vm1_A		118	Thioredoxin, thioredoxin H isoform 1.; oxidoreduct	98.36
2oe3_A		114	Thioredoxin-3; electron transport, alpha/beta sand	98.35
2l57_A		126	Uncharacterized protein; structural genomics, unkn	98.33
1z6n_A		167	Hypothetical protein PA1234; alpha-beta-alpha sand	98.32
1v98_A		140	Thioredoxin; oxidoreductase, structural genomics,	98.3
3t58_A		519	Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.	98.3
3f8u_A		481	Protein disulfide-isomerase A3ERP57; endoplasmic r	98.3
3ul3_B		128	Thioredoxin, thioredoxin-2; PTEX, oxidoreductase;	98.29
2j23_A		121	Thioredoxin; immune protein, autoreactivity, cross	98.29
3uow_A		556	GMP synthetase; structural genomics consortium, SG	98.29
2kuc_A		130	Putative disulphide-isomerase; structural genomics	98.29
3qcp_A		470	QSOX from trypanosoma brucei (tbqsox); ERV fold, t	98.28
2yj7_A		106	LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti	97.57
3iv4_A		112	Putative oxidoreductase; APC23140, meticillin-resi	98.23
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	98.21
3idv_A		241	Protein disulfide-isomerase A4; thioredoxin-like f	98.2
1sen_A		164	Thioredoxin-like protein P19; endoplasmic reticulu	98.2
3us3_A		367	Calsequestrin-1; calcium-binding protein; 1.74A {O	98.2
1sji_A		350	Calsequestrin 2, calsequestrin, cardiac muscle iso	98.2
3f9u_A		172	Putative exported cytochrome C biogenesis-related;	98.19
3ph9_A		151	Anterior gradient protein 3 homolog; thioredoxin f	98.18
3kp8_A		106	Vkorc1/thioredoxin domain protein; blood coagulati	98.18
1wou_A		123	Thioredoxin -related protein, 14 kDa; electron tra	98.17
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	98.15
1wmj_A		130	Thioredoxin H-type; structural genomics, program f	98.15
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	98.13
2vxo_A		697	GMP synthase [glutamine-hydrolyzing]; proto-oncoge	98.1
1a8l_A		226	Protein disulfide oxidoreductase; PDI, thioredoxin	98.07
1vl2_A		421	Argininosuccinate synthase; TM1780, structural gen	98.03
2es7_A		142	Q8ZP25_salty, putative thiol-disulfide isomerase a	97.94
2lst_A		130	Thioredoxin; structural genomics, NEW YORK structu	97.16
3lwa_A		183	Secreted thiol-disulfide isomerase; thioredoxin, P	97.91
2ywm_A		229	Glutaredoxin-like protein; redox protein, structur	97.9
2h30_A		164	Thioredoxin, peptide methionine sulfoxide reductas	97.9
1fo5_A		85	Thioredoxin; disulfide oxidoreductase, structural	97.88
1i5g_A		144	Tryparedoxin II; electron transport; HET: TS5; 1.4	97.86
3eur_A		142	Uncharacterized protein; PSI2,MCSG, conserved prot	97.86
2hls_A		243	Protein disulfide oxidoreductase; thioredoxin fold	97.86
3raz_A		151	Thioredoxin-related protein; structural genomics,	97.85
1lu4_A		136	Soluble secreted antigen MPT53; thioredoxin-like f	97.82
3ira_A		173	Conserved protein; methanosarcina mazei,structural	97.82
3s9f_A		165	Tryparedoxin; thioredoxin fold, disulfide reductas	97.82
2c0g_A		248	ERP29 homolog, windbeutel protein; PDI-dbeta, PDI,	97.81
3n05_A		590	NH(3)-dependent NAD(+) synthetase; ligase, structu	97.81
1o8x_A		146	Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot	97.81
2djk_A		133	PDI, protein disulfide-isomerase; thioredoxin fold	97.8
1zzo_A		136	RV1677; thioredoxin fold, structural genomics, PSI	97.79
2b5x_A		148	YKUV protein, TRXY; thioredoxin-like, oxidoreducta	97.79
1o73_A		144	Tryparedoxin; electron transport, trypanosomatid,	97.79
1ilo_A		77	Conserved hypothetical protein MTH895; beta-alpha-	97.78
3or5_A		165	Thiol:disulfide interchange protein, thioredoxin p	97.77
1nho_A		85	Probable thioredoxin; beta sheet, alpha helix, oxi	97.76
2b1k_A		168	Thiol:disulfide interchange protein DSBE; C-termin	97.75
3dml_A		116	Putative uncharacterized protein; thioredoxin, oxi	97.73
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	97.73
3lor_A		160	Thiol-disulfide isomerase and thioredoxins; PSI, M	97.72
3erw_A		145	Sporulation thiol-disulfide oxidoreductase A; thio	97.72
3ewl_A		142	Uncharacterized conserved protein BF1870; alpha-be	97.72
2ju5_A		154	Thioredoxin disulfide isomerase; protein, oxidored	97.72
4fo5_A		143	Thioredoxin-like protein; AHPC/TSA family protein,	97.7
3hdc_A		158	Thioredoxin family protein; ATCC53774, DSM 7210, ,	97.7
3eyt_A		158	Uncharacterized protein SPOA0173; thioredoxin-like	97.69
3ha9_A		165	Uncharacterized thioredoxin-like protein; PSI, MCS	97.67
3fkf_A		148	Thiol-disulfide oxidoreductase; structural genomic	97.66
2f9s_A		151	Thiol-disulfide oxidoreductase RESA; thioredoxin-l	97.66
2lrn_A		152	Thiol:disulfide interchange protein; structural ge	97.65
3ia1_A		154	THIO-disulfide isomerase/thioredoxin; oxidoreducta	97.64
2qc7_A		240	ERP31, ERP28, endoplasmic reticulum protein ERP29;	97.63
2e7p_A		116	Glutaredoxin; thioredoxin fold, poplar, electron t	97.63
3kij_A		180	Probable glutathione peroxidase 8; human PDI-perox	97.62
3hcz_A		148	Possible thiol-disulfide isomerase; APC61559.2, cy	97.62
2f8a_A		208	Glutathione peroxidase 1; thioredoxin fold, struct	97.59
2lrt_A		152	Uncharacterized protein; structural genomics, thio	97.59
1kqp_A		271	NAD+ synthase, NH(3)-dependent NAD(+) synthetase,	97.57
2v1m_A		169	Glutathione peroxidase; selenium, selenocysteine,	97.57
4evm_A		138	Thioredoxin family protein; structural genomics, n	97.57
2p5q_A		170	Glutathione peroxidase 5; thioredoxin fold, oxidor	97.56
2p31_A		181	CL683, glutathione peroxidase 7; thioredoxin fold,	97.55
3dwv_A		187	Glutathione peroxidase-like protein; alpha beta, 3	97.54
3gl3_A		152	Putative thiol:disulfide interchange protein DSBE;	97.52
2lus_A		143	Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci	96.66
2l5o_A		153	Putative thioredoxin; structural genomics, unknown	97.52
1kng_A		156	Thiol:disulfide interchange protein CYCY; thioredo	97.52
3q4g_A		279	NH(3)-dependent NAD(+) synthetase; structural geno	97.51
3kcm_A		154	Thioredoxin family protein; SGX, thioredoxin prote	97.49
3dpi_A		285	NAD+ synthetase; ssgcid, decode, structural genomi	97.45
3kh7_A		176	Thiol:disulfide interchange protein DSBE; TRX-like	97.44
2lja_A		152	Putative thiol-disulfide oxidoreductase; structura	97.44
1wxi_A		275	NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l	97.43
2obi_A		183	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	97.42
1jfu_A		186	Thiol:disulfide interchange protein TLPA; thioredo	97.42
2vup_A		190	Glutathione peroxidase-like protein; oxidoreductas	97.42
1un2_A		197	DSBA, thiol-disulfide interchange protein; disulfi	97.41
3cmi_A		171	Peroxiredoxin HYR1; thioredoxin-like fold, oxidore	97.4
2ls5_A		159	Uncharacterized protein; structural genomics, unkn	96.52
2gs3_A		185	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	97.39
2dlx_A		153	UBX domain-containing protein 7; UAS domain, prote	97.38
2cvb_A		188	Probable thiol-disulfide isomerase/thioredoxin; re	97.35
3fw2_A		150	Thiol-disulfide oxidoreductase; structural genomic	97.35
3kp9_A		291	Vkorc1/thioredoxin domain protein; warfarin, disul	97.34
1ttz_A		87	Conserved hypothetical protein; structural genomic	97.31
2rli_A		171	SCO2 protein homolog, mitochondrial; copper protei	97.27
1a8l_A		226	Protein disulfide oxidoreductase; PDI, thioredoxin	97.25
2ggt_A		164	SCO1 protein homolog, mitochondrial; copper chaper	97.23
2ywi_A		196	Hypothetical conserved protein; uncharacterized co	97.23
2hyx_A		352	Protein DIPZ; thioredoxin fold, jelly-roll, struct	97.22
2fgx_A		107	Putative thioredoxin; NET3, NESG, GFT-glutaredoxin	97.17
1vbk_A		307	Hypothetical protein PH1313; structural genomics,	97.16
2k6v_A		172	Putative cytochrome C oxidase assembly protein; th	97.15
2jsy_A		167	Probable thiol peroxidase; solution structure, ant	97.13
3rjz_A		237	N-type ATP pyrophosphatase superfamily; structural	97.12
2b7k_A		200	SCO1 protein; metallochaperone, cytochrome C oxida	97.08
3u5r_E		218	Uncharacterized protein; structural genomics, PSI-	97.08
2k8s_A		80	Thioredoxin; dimer, structural genomics, PSI-2, pr	97.07
3drn_A		161	Peroxiredoxin, bacterioferritin comigratory prote	97.05
1wjk_A		100	C330018D20RIK protein; glutaredoxin, thioredoxin f	97.03
1eej_A		216	Thiol:disulfide interchange protein; oxidoreductas	97.0
1xzo_A		174	BSSCO, hypothetical protein YPMQ; thioredoxin-like	96.97
3hd5_A		195	Thiol:disulfide interchange protein DSBA; protein	96.95
1we0_A		187	Alkyl hydroperoxide reductase C; peroxiredoxin, AH	96.91
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	96.9
2i3y_A		215	Epididymal secretory glutathione peroxidase; thior	96.9
1xvw_A		160	Hypothetical protein RV2238C/MT2298; thioredoxin f	96.84
1ego_A		85	Glutaredoxin; electron transport; NMR {Escherichia	96.83
2bmx_A		195	Alkyl hydroperoxidase C; peroxiredoxin, antioxidan	96.82
1zof_A		198	Alkyl hydroperoxide-reductase; decamer, toroide-sh	96.8
1qmv_A		197	Human thioredoxin peroxidase-B; peroxiredoxin, sul	96.75
1xvq_A		175	Thiol peroxidase; thioredoxin fold, structural gen	96.73
2r37_A		207	Glutathione peroxidase 3; plasma, structural genom	96.71
3uem_A		361	Protein disulfide-isomerase; thioredoxin-like doma	96.69
3gkn_A		163	Bacterioferritin comigratory protein; BCP, PRX, at	96.64
3ilv_A		634	Glutamine-dependent NAD(+) synthetase; protein str	96.64
3hz8_A		193	Thiol:disulfide interchange protein DSBA; thiol-ox	96.64
3h93_A		192	Thiol:disulfide interchange protein DSBA; disulfid	96.58
1t3b_A		211	Thiol:disulfide interchange protein DSBC; oxidored	96.55
2ywm_A		229	Glutaredoxin-like protein; redox protein, structur	96.54
3sdb_A		680	Glutamine-dependent NAD(+) synthetase; glutamine-a	96.53
1uul_A		202	Tryparedoxin peroxidase homologue; peroxiredoxin,	96.49
2h01_A		192	2-Cys peroxiredoxin; thioredoxin peroxidase, struc	96.49
3ztl_A		222	Thioredoxin peroxidase; oxidoreductase, reductase,	96.48
3gyk_A		175	27KDA outer membrane protein; APC61738.2, siliciba	96.48
1kte_A		105	Thioltransferase; redox-active center, electron tr	96.45
2i81_A		213	2-Cys peroxiredoxin; structural genomics consortiu	96.45
1h75_A		81	Glutaredoxin-like protein NRDH; electron transport	96.38
1q98_A		165	Thiol peroxidase, TPX; structural genomics, NYSGXR	96.36
1tp9_A		162	Peroxiredoxin, PRX D (type II); oligomer, thioredo	96.34
2c0d_A		221	Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th	96.33
2pn8_A		211	Peroxiredoxin-4; thioredoxin, oxidoreductase, stru	96.33
1zye_A		220	Thioredoxin-dependent peroxide reductase; catenane	96.33
2yzh_A		171	Probable thiol peroxidase; redox protein, antioxid	96.29
2cq9_A		130	GLRX2 protein, glutaredoxin 2; glutathione-S-trans	96.26
1psq_A		163	Probable thiol peroxidase; structural genomics, NY	96.26
3ixr_A		179	Bacterioferritin comigratory protein; alpha beta p	96.23
2a4v_A		159	Peroxiredoxin DOT5; yeast nuclear thiol peroxidase	96.23
1n8j_A		186	AHPC, alkyl hydroperoxide reductase C22 protein; p	96.21
3feu_A		185	Putative lipoprotein; alpha-beta structure, struct	96.21
2wfc_A		167	Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan	96.21
2hls_A		243	Protein disulfide oxidoreductase; thioredoxin fold	96.18
2pwj_A		171	Mitochondrial peroxiredoxin; alpha and beta protei	96.08
1nm3_A		241	Protein HI0572; hybrid, peroxiredoxin, glutaredoxi	96.04
3me7_A		170	Putative uncharacterized protein; electron transfe	95.91
1r7h_A		75	NRDH-redoxin; thioredoxin, glutaredoxin, redox pro	95.89
2ht9_A		146	Glutaredoxin-2; thioredoxin fold, iron-sulfur clus	95.87
4hde_A		170	SCO1/SENC family lipoprotein; structural genomics,	95.72
3rhb_A		113	ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox	95.66
2hze_A		114	Glutaredoxin-1; thioredoxin fold, arsenic, dimethy	95.65
3p7x_A		166	Probable thiol peroxidase; thioredoxin fold, oxido	95.6
3zrd_A		200	Thiol peroxidase; oxidoreductase, 2Cys peroxiredox	95.53
2yan_A		105	Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H	95.46
4g2e_A		157	Peroxiredoxin; redox protein, structural genomics,	95.45
3nzn_A		103	Glutaredoxin; structural genomics, PSI2, MCSG, pro	95.41
3c1r_A		118	Glutaredoxin-1; oxidized form, oxidoreductase, cyt	95.41
1v58_A		241	Thiol:disulfide interchange protein DSBG; reduced	95.38
3uma_A		184	Hypothetical peroxiredoxin protein; nysgrc, PSI bi	95.36
3qpm_A		240	Peroxiredoxin; oxidoreductase, thioredoxin fold, p	95.25
2klx_A		89	Glutaredoxin; thioredoxin type domain, ssgcid, ele	95.25
1jgt_A		513	Beta-lactam synthetase; asparagine synthetase, cla	95.19
1ct9_A		553	Asparagine synthetase B; amidotransferase, substra	95.18
3mng_A		173	Peroxiredoxin-5, mitochondrial; peroxidase, PRXV,	95.16
2znm_A		195	Thiol:disulfide interchange protein DSBA; thioredo	94.95
3qmx_A		99	Glutaredoxin A, glutaredoxin 3; electron transport	94.95
1fov_A		82	Glutaredoxin 3, GRX3; active site disulfide, CIS P	94.93
1z6m_A		175	Conserved hypothetical protein; structural genomic	94.65
2khp_A		92	Glutaredoxin; thioredoxin type domain, ssgcid, ele	94.49
4gqc_A		164	Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f	94.48
3tjj_A		254	Peroxiredoxin-4; thioredoxin fold, sulfenylation,	94.35
3msz_A		89	Glutaredoxin 1; alpha-beta sandwich, center for st	94.17
2rem_A		193	Disulfide oxidoreductase; disulfide oxidoreductase	94.13
3ic4_A		92	Glutaredoxin (GRX-1); structural genomics, PSI, MC	94.07
1q15_A		503	CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS,	93.97
3h8q_A		114	Thioredoxin reductase 3; oxidoreductase, structura	93.85
3a2v_A		249	Probable peroxiredoxin; thioredoxin peroxidase, hy	93.41
1prx_A		224	HORF6; peroxiredoxin, hydrogen peroxide, redox reg	93.41
2v2g_A		233	Peroxiredoxin 6; oxidoreductase, antioxidant enzym	93.3
3ctg_A		129	Glutaredoxin-2; reduced form, electron transport,	93.29
3l9s_A		191	Thiol:disulfide interchange protein; thioredoxin-f	93.11
1wik_A		109	Thioredoxin-like protein 2; picot homology 2 domai	92.46
1xcc_A		220	1-Cys peroxiredoxin; unknown function, structural	92.09
3l4n_A		127	Monothiol glutaredoxin-6; C-terminal domain of GRX	91.66
2lqo_A		92	Putative glutaredoxin RV3198.1/MT3292; TRX fold, o	90.35
3gv1_A		147	Disulfide interchange protein; neisseria gonorrhoe	90.23
4dvc_A		184	Thiol:disulfide interchange protein DSBA; pilus as	90.15
4f4h_A		565	Glutamine dependent NAD+ synthetase; structural ge	90.11
4f82_A		176	Thioredoxin reductase; structural genomics, niaid,	88.05
4f9z_D		227	Endoplasmic reticulum resident protein 27; thiored	87.32
3keb_A		224	Probable thiol peroxidase; structural genomics, AP	86.52
3gx8_A		121	Monothiol glutaredoxin-5, mitochondrial; TRX fold,	82.73
2l4c_A		124	Endoplasmic reticulum resident protein 27; ERP27,	82.5
4f9z_D		227	Endoplasmic reticulum resident protein 27; thiored	81.89
3sbc_A		216	Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c	81.62
3ipz_A		109	Monothiol glutaredoxin-S14, chloroplastic; electro	81.37

>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa}	Back alignment and structure

Probab=100.00  E-value=3e-62  Score=475.77  Aligned_cols=239  Identities=52%  Similarity=1.049  Sum_probs=200.4

Q ss_pred             hhhHHHHHHHhccCCHHHHHHHHHHHcCCcEEEEechHHHHHHH-HHHHhcCCCeEEEEEeCCCCcHHHHHHHHHHHHHh
Q 015013           85 EEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALI-EYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHF  163 (414)
Q Consensus        85 ~~~~~~l~~~l~~~~a~eil~~a~~~~~~~i~vafSGGKDSvlL-~L~~~~~~~i~VvflDTG~~fpET~~~v~~l~~~~  163 (414)
                      ..+++.+|++|+.++++++|+++++.|+++|+|+|| ||||++| ||+.+.++++.|+|+|||++||||++|+++++++|
T Consensus        27 ~~~~~~~~~~~~~~~a~~~l~~a~~~~g~~i~Va~S-GkDS~vLL~Ll~~~~~~i~vv~iDtg~~~~et~~~v~~~~~~~  105 (275)
T 2goy_A           27 PFDLPALASSLADKSPQDILKAAFEHFGDELWISFS-GAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREHY  105 (275)
T ss_dssp             -CCHHHHHHHHTTSCHHHHHHHHHHHHSTTEEEECC-SSTTHHHHHHHHHHCTTCCEEEECCSCCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccCCHHHHHHHHHHHcCCCEEEEee-cHHHHHHHHHHHHhCCCceEEEEeCCCCCHHHHHHHHHHHHHH
Confidence            457899999999999999999999999878999999 9999875 99999999999999999999999999999999999


Q ss_pred             CCcEEEEcCChHHHHHHHHhcCCCCCCcccchhhhcchhchhHHHHhccCcEEEecccccCCccCcCCCCceecCCCCcc
Q 015013          164 GIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEG  243 (414)
Q Consensus       164 gl~i~~~~P~~~~~~~~~~~~G~~~~~~~~~~~Cc~~~Kv~Pl~ral~~~~~~itGiRrdES~~~Ra~~~~~e~d~~~~~  243 (414)
                      |++++++.|+...++++...+|.+.++..++++||.++|++||+++++++++|++|+|++|++..|+.++.++.|+.+. 
T Consensus       106 gi~l~v~~~~~~~~~~~~~~~g~~~~~~~~~~~cc~~~K~~pl~r~l~~~~~~itG~r~dds~~~R~~~~~~~~d~~~~-  184 (275)
T 2goy_A          106 GIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAFS-  184 (275)
T ss_dssp             TCCCEEECCCHHHHHHHHHHHCSCHHHHHCTHHHHHHHTHHHHHHHHHTCSEEECCCCGGGTTSCSCCCCSEEECTTTC-
T ss_pred             CCeEEEEeCCccCHHHHHHHhCCCCccccCHHHHHHHHHHHHHHHHHHhcCchhcCchhhhhhhhhhhCcccccccccc-
Confidence            9999999998655556666778766666667899999999999999999999999999999922899999998875332 


Q ss_pred             ccCCCCCeEEEEeCccccHHHHHHHHHhCCCCCChhhhCCCCCCCCccCCCCCCCCCcccccccccCCCCccceeccCCC
Q 015013          244 LEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGN  323 (414)
Q Consensus       244 ~~~~~~~~~ki~PL~dWt~~DVw~Yi~~~~lP~npLYd~Gy~SiGC~~CT~~v~~g~~~R~GRW~w~~~~k~ECGlh~~~  323 (414)
                      .  ..+++++++||++||++|||.|++.++|||||||++||+||||++||+++.+|+|+|+|||||+|..|||||||..+
T Consensus       185 ~--~~~g~~~i~PL~~wt~~dV~~Yi~~~~lp~~~Ly~~Gy~siGC~~Ct~~~~~g~~~R~gRw~w~~~~k~ecGlh~~~  262 (275)
T 2goy_A          185 T--PEKPLYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGN  262 (275)
T ss_dssp             C--SSSCCEEECTTTTCCHHHHHHHHHHTTCCCCGGGGGTCSSCCCGGGBCCCCTTCCGGGGBSTTC-------------
T ss_pred             c--CCCCeEEEechHhCCHHHHHHHHHHhCCCCChHHHcCCCCCCCccCCCCCCCCCccccCccccCCCCCccCCCCcCc
Confidence            0  12468899999999999999999999999999999999999999999999999999999999999999999999877


Q ss_pred             cccc
Q 015013          324 IKQE  327 (414)
Q Consensus       324 ~~~~  327 (414)
                      +..+
T Consensus       263 ~~~~  266 (275)
T 2goy_A          263 LISK  266 (275)
T ss_dssp             ----
T ss_pred             chhh
Confidence            7543

PyMOL of 2goy

>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae}	Back alignment and structure

>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A*	Back alignment and structure

>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2	Back alignment and structure

>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2	Back alignment and structure

>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae}	Back alignment and structure

>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A*	Back alignment and structure

>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A*	Back alignment and structure

>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A	Back alignment and structure

>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis}	Back alignment and structure

>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii}	Back alignment and structure

>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus}	Back alignment and structure

>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1	Back alignment and structure

>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A*	Back alignment and structure

>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1	Back alignment and structure

>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae}	Back alignment and structure

>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens}	Back alignment and structure

>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0	Back alignment and structure

>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei}	Back alignment and structure

>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A	Back alignment and structure

>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii}	Back alignment and structure

>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii}	Back alignment and structure

>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A*	Back alignment and structure

>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0	Back alignment and structure

>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii}	Back alignment and structure

>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A	Back alignment and structure

>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A	Back alignment and structure

>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp}	Back alignment and structure

>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A	Back alignment and structure

>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ...	Back alignment and structure

>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1	Back alignment and structure

>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus}	Back alignment and structure

>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti}	Back alignment and structure

>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1	Back alignment and structure

>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2	Back alignment and structure

>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1	Back alignment and structure

>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor}	Back alignment and structure

>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A	Back alignment and structure

>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A*	Back alignment and structure

>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1	Back alignment and structure

>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei}	Back alignment and structure

>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C*	Back alignment and structure

>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1	Back alignment and structure

>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B	Back alignment and structure

>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A	Back alignment and structure

>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A	Back alignment and structure

>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1	Back alignment and structure

>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens}	Back alignment and structure

>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A	Back alignment and structure

>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1	Back alignment and structure

>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A	Back alignment and structure

>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A	Back alignment and structure

>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1	Back alignment and structure

>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A	Back alignment and structure

>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum}	Back alignment and structure

>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis}	Back alignment and structure

>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis}	Back alignment and structure

>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus}	Back alignment and structure

>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus}	Back alignment and structure

>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix}	Back alignment and structure

>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A	Back alignment and structure

>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris}	Back alignment and structure

>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A	Back alignment and structure

>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A	Back alignment and structure

>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A	Back alignment and structure

>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C	Back alignment and structure

>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A	Back alignment and structure

>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens}	Back alignment and structure

>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A	Back alignment and structure

>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A	Back alignment and structure

>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A*	Back alignment and structure

>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1	Back alignment and structure

>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus}	Back alignment and structure

>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens}	Back alignment and structure

>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A	Back alignment and structure

>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1	Back alignment and structure

>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A	Back alignment and structure

>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A	Back alignment and structure

>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A*	Back alignment and structure

>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A	Back alignment and structure

>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A	Back alignment and structure

>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1	Back alignment and structure

>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6	Back alignment and structure

>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A	Back alignment and structure

>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica}	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus}	Back alignment and structure

>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ...	Back alignment and structure

>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A	Back alignment and structure

>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A	Back alignment and structure

>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A	Back alignment and structure

>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A	Back alignment and structure

>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens}	Back alignment and structure

>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A	Back alignment and structure

>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus}	Back alignment and structure

>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A*	Back alignment and structure

>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A	Back alignment and structure

>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum}	Back alignment and structure

>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis}	Back alignment and structure

>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum}	Back alignment and structure

>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A*	Back alignment and structure

>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct}	Back alignment and structure

>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp}	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa}	Back alignment and structure

>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A	Back alignment and structure

>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A	Back alignment and structure

>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A	Back alignment and structure

>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A	Back alignment and structure

>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A	Back alignment and structure

>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP}	Back alignment and structure

>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A	Back alignment and structure

>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa}	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens}	Back alignment and structure

>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A	Back alignment and structure

>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1	Back alignment and structure

>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A	Back alignment and structure

>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus}	Back alignment and structure

>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum}	Back alignment and structure

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A	Back alignment and structure

>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A	Back alignment and structure

>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1	Back alignment and structure

>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A	Back alignment and structure

>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis}	Back alignment and structure

>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix}	Back alignment and structure

>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B}	Back alignment and structure

>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei}	Back alignment and structure

>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major}	Back alignment and structure

>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A	Back alignment and structure

>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis}	Back alignment and structure

>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A	Back alignment and structure

>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A	Back alignment and structure

>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A	Back alignment and structure

>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A	Back alignment and structure

>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10	Back alignment and structure

>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1	Back alignment and structure

>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0	Back alignment and structure

>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1	Back alignment and structure

>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A	Back alignment and structure

>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A*	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0	Back alignment and structure

>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis}	Back alignment and structure

>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae}	Back alignment and structure

>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis}	Back alignment and structure

>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15}	Back alignment and structure

>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi}	Back alignment and structure

>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix}	Back alignment and structure

>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis}	Back alignment and structure

>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A	Back alignment and structure

>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP}	Back alignment and structure

>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus}	Back alignment and structure

>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A	Back alignment and structure

>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A	Back alignment and structure

>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A	Back alignment and structure

>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii}	Back alignment and structure

>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A	Back alignment and structure

>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus}	Back alignment and structure

>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A	Back alignment and structure

>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A	Back alignment and structure

>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae}	Back alignment and structure

>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A	Back alignment and structure

>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens}	Back alignment and structure

>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A	Back alignment and structure

>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls}	Back alignment and structure

>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda}	Back alignment and structure

>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0	Back alignment and structure

>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15}	Back alignment and structure

>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0	Back alignment and structure

>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A	Back alignment and structure

>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus}	Back alignment and structure

>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A*	Back alignment and structure

>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens}	Back alignment and structure

>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei}	Back alignment and structure

>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13	Back alignment and structure

>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae}	Back alignment and structure

>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens}	Back alignment and structure

>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24	Back alignment and structure

>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A	Back alignment and structure

>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP}	Back alignment and structure

>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A	Back alignment and structure

>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens}	Back alignment and structure

>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A	Back alignment and structure

>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A	Back alignment and structure

>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus}	Back alignment and structure

>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea}	Back alignment and structure

>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1	Back alignment and structure

>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus}	Back alignment and structure

>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A	Back alignment and structure

>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A	Back alignment and structure

>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A	Back alignment and structure

>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti}	Back alignment and structure

>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea}	Back alignment and structure

>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A	Back alignment and structure

>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A	Back alignment and structure

>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis}	Back alignment and structure

>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens}	Back alignment and structure

>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A	Back alignment and structure

>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A	Back alignment and structure

>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10	Back alignment and structure

>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A	Back alignment and structure

>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens}	Back alignment and structure

>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A	Back alignment and structure

>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A	Back alignment and structure

>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A	Back alignment and structure

>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0	Back alignment and structure

>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1	Back alignment and structure

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A	Back alignment and structure

>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A*	Back alignment and structure

>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10	Back alignment and structure

>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10	Back alignment and structure

>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D	Back alignment and structure

>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi}	Back alignment and structure

>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A*	Back alignment and structure

>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A	Back alignment and structure

>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10	Back alignment and structure

>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10	Back alignment and structure

>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum}	Back alignment and structure

>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens}	Back alignment and structure

>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10	Back alignment and structure

>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus}	Back alignment and structure

>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10	Back alignment and structure

>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa}	Back alignment and structure

>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10	Back alignment and structure

>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A	Back alignment and structure

>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0	Back alignment and structure

>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina}	Back alignment and structure

>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix}	Back alignment and structure

>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum}	Back alignment and structure

>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10	Back alignment and structure

>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A	Back alignment and structure

>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1	Back alignment and structure

>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A*	Back alignment and structure

>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis}	Back alignment and structure

>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A*	Back alignment and structure

>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B	Back alignment and structure

>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0	Back alignment and structure

>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A	Back alignment and structure

>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens}	Back alignment and structure

>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A	Back alignment and structure

>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei}	Back alignment and structure

>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A*	Back alignment and structure

>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A	Back alignment and structure

>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea}	Back alignment and structure

>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae}	Back alignment and structure

>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A*	Back alignment and structure

>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1	Back alignment and structure

>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A	Back alignment and structure

>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A	Back alignment and structure

>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0	Back alignment and structure

>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A*	Back alignment and structure

>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13	Back alignment and structure

>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis}	Back alignment and structure

>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A	Back alignment and structure

>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C	Back alignment and structure

>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A*	Back alignment and structure

>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa}	Back alignment and structure

>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A*	Back alignment and structure

>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0	Back alignment and structure

>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A	Back alignment and structure

>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10	Back alignment and structure

>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A	Back alignment and structure

>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A*	Back alignment and structure

>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A	Back alignment and structure

>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A	Back alignment and structure

>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae}	Back alignment and structure

>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A	Back alignment and structure

>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis}	Back alignment and structure

>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia}	Back alignment and structure

>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A	Back alignment and structure

>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum}	Back alignment and structure

>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae}	Back alignment and structure

>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens}	Back alignment and structure

>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A	Back alignment and structure

>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		414
d1sura_		215	c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) redu	3e-51
d1zuna1		211	c.26.2.2 (A:1-211) Sulfate adenylyltransferase sub	5e-28
d1zmaa1		115	c.47.1.1 (A:1-115) Bacterocin transport accessory	0.004

>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Length = 215	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PAPS reductase-like
domain: Phosphoadenylyl sulphate (PAPS) reductase
species: Escherichia coli [TaxId: 562]

 Score =  169 bits (429), Expect = 3e-51
 Identities = 55/228 (24%), Positives = 94/228 (41%), Gaps = 18/228 (7%)

Query: 65  SVVPLAATLATPEVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFS-GAE 123
           S + L A    P    KV+      +   ELE       +  AL+    +  ++ S G +
Sbjct: 1   SKLDLNALNELP----KVDRILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQ 56

Query: 124 DVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKHFGIRIEYMFPDAVEVQALVRS 183
               +   +       V   DTG L PETYRF DE+     + ++             R 
Sbjct: 57  AAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARY 116

Query: 184 KGLFSFYEDGHQECCRVRKVRPLRRALKGLRA--WITGQRKDQSPGTRSEIPVVQVDPVF 241
             L+    +G ++   + KV P+ RALK L A  W  G R++QS  +R+ +PV+ +    
Sbjct: 117 GKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSG-SRANLPVLAIQ--- 172

Query: 242 EGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGC 289
                    + K  P+ +     I+ +L+   +  + L  +GY+S+G 
Sbjct: 173 -------RGVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGD 213

PyMOL of d1sura_

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 211	Back information, alignment and structure

>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		414
d1sura_		215	Phosphoadenylyl sulphate (PAPS) reductase {Escheri	100.0
d1zuna1		211	Sulfate adenylyltransferase subunit 2, CysD {Pseud	99.95
d1wy5a1		216	TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId	99.24
d2djja1		116	Protein disulfide isomerase, PDI {Fungi (Humicola	99.08
d2trxa_		108	Thioredoxin {Escherichia coli [TaxId: 562]}	99.07
d2c5sa1		218	Thiamine biosynthesis protein ThiI, C-terminal dom	99.05
d1ni5a1		227	tRNA-Ile-lysidine synthetase, TilS, N-terminal dom	99.05
d1thxa_		108	Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	99.03
d2b5ea1		140	Protein disulfide isomerase, PDI {Baker's yeast (S	98.97
d1fb6a_		104	Thioredoxin {Spinach (Spinacia oleracea), thioredo	98.97
d1nw2a_		105	Thioredoxin {Alicyclobacillus acidocaldarius, form	98.97
d1f9ma_		112	Thioredoxin {Spinach (Spinacia oleracea), thioredo	98.94
d2b5ea4		119	Protein disulfide isomerase, PDI {Baker's yeast (S	98.92
d1dbya_		107	Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305	98.9
d1meka_		120	Protein disulfide isomerase, PDI {Human (Homo sapi	98.89
d2c0ga2		122	Windbeutel, N-terminal domain {Fruit fly (Drosophi	98.79
d1xwaa_		111	Thioredoxin {Fruit fly (Drosophila melanogaster) [	98.77
d2ifqa1		105	Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}	98.76
d1xfla_		114	Thioredoxin {Thale cress (Arabidopsis thaliana) [T	98.75
d1gh2a_		107	Thioredoxin-like protein, N-terminal domain {Human	98.74
d1k92a1		188	Argininosuccinate synthetase, N-terminal domain {E	98.74
d1r26a_		113	Thioredoxin {Trypanosoma brucei [TaxId: 5691]}	98.73
d1ep7a_		112	Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305	98.7
d1ti3a_		113	Thioredoxin {European aspen (Populus tremula), thi	98.64
d1syra_		103	Thioredoxin {Malarial parasite (Plasmodium falcipa	98.64
d1qgva_		137	spliceosomal protein U5-15Kd {Human (Homo sapiens)	98.64
d1vl2a1		168	Argininosuccinate synthetase, N-terminal domain {T	98.62
d1j20a1		165	Argininosuccinate synthetase, N-terminal domain {T	98.59
d1a8ya1		124	Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax	98.51
d1a8la2		107	Protein disulfide isomerase, PDI {Archaeon Pyrococ	98.47
d1zmaa1		115	Bacterocin transport accessory protein Bta {Strept	98.42
d2fwha1		117	Thiol:disulfide interchange protein DsbD, C-termin	98.39
d1xnga1		255	NH3-dependent NAD+-synthetase {Helicobacter pylori	98.33
d1woua_		119	Putative 42-9-9 protein (thioredoxin containing pr	98.32
d1fo5a_		85	MJ0307, thioredoxin/glutaredoxin-like protein {Arc	98.3
d1g7ea_		122	Endoplasmic reticulum protein ERP29, N-terminal do	98.22
d2es7a1		119	Hydrogenase-1 operon protein HyaE {Salmonella typh	98.22
d1sena_		135	Thioredoxin-like protein p19, TLP19 {Human (Homo s	98.21
d1gpma1		197	GMP synthetase, central domain {Escherichia coli [	98.21
d1z5ye1		136	Thioredoxin-like protein CcmG (CycY, DsbE) {Escher	98.13
d2hfda1		132	Hydrogenase-1 operon protein HyaE {Escherichia col	98.13
d2trcp_		217	Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]}	98.03
d1i5ga_		144	Tryparedoxin II {Crithidia fasciculata [TaxId: 565	98.01
d1o73a_		144	Tryparedoxin I {Trypanosoma brucei brucei [TaxId:	97.98
d1nhoa_		85	MTH807, thioredoxin/glutaredoxin-like protein {Arc	97.97
d1zzoa1		134	Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI	97.91
d1hyua4		96	Alkyl hydroperoxide reductase subunit F (AhpF), N-	97.9
d2pg3a1		230	Queuosine biosynthesis protein QueC {Erwinia carot	97.89
d1lu4a_		134	Soluble secreted antigen MPT53 {Mycobacterium tube	97.8
d2fy6a1		143	Peptide methionine sulfoxide reductase MsrA/MsrB,	97.79
d1z6na1		166	Hypothetical protein PA1234 {Pseudomonas aeruginos	97.74
d1knga_		144	Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr	97.74
d1o8xa_		144	Tryparedoxin I {Crithidia fasciculata [TaxId: 5656	97.73
d2b5xa1		143	thiol:disulfide oxidoreductase YkuV {Bacillus subt	97.69
d2cvba1		187	Probable thiol-disulfide isomerase/thioredoxin TTH	97.63
d2dlxa1		147	UBX domain-containing protein 7 {Human (Homo sapie	97.32
d1st9a_		137	Thiol-disulfide oxidoreductase ResA {Bacillus subt	97.24
d1jfua_		176	Membrane-anchored thioredoxin-like protein TlpA, s	97.07
d1wjka_		100	Thioredoxin-like structure containing protein C330	96.89
d1kqpa_		271	NH3-dependent NAD+-synthetase {Bacillus subtilis [	95.87
d2d13a1		226	Hypothetical protein PH1257 {Archaeon Pyrococcus h	95.81
d2cx4a1		160	Bacterioferritin comigratory protein {Archaeon Aer	95.56
d2f8aa1		184	Glutathione peroxidase {Human (Homo sapiens) [TaxI	95.34
d1wxia1		274	NH3-dependent NAD+-synthetase {Escherichia coli [T	95.24
d1e2ya_		167	Tryparedoxin peroxidase (thioredoxin peroxidase ho	94.71
d2a4va1		156	Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c	94.56
d1q15a1		296	beta-Lactam synthetase {Pectobacterium carotovorum	94.51
d1vbka1		132	Hypothetical protein PH1313, C-terminal domain {Ar	94.38
d1jgta1		299	beta-Lactam synthetase {Streptomyces clavuligerus	94.3
d1wp0a1		160	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	93.45
d1we0a1		166	Alkyl hydroperoxide reductase AhpC {Amphibacillus	93.05
d2bmxa1		169	Alkyl hydroperoxide reductase AhpC {Mycobacterium	93.04
d1ct9a1		324	Asparagine synthetase B, C-terminal domain {Escher	92.8
d1qxha_		164	Thiol peroxidase Tpx {Escherichia coli [TaxId: 562	92.2
d1zyea1		158	Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [	92.02
d1xzoa1		172	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	92.0
d1zofa1		170	Thioredoxin reductase TsaA {Helicobacter pylori [T	90.86
d1xvqa_		166	Thiol peroxidase Tpx {Mycobacterium tuberculosis [	90.27
d1xvwa1		153	Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri	90.02
d1uula_		194	Tryparedoxin peroxidase (thioredoxin peroxidase ho	89.98
d1psqa_		163	Probable thiol peroxidase PsaD {Streptococcus pneu	89.08
d1z6ma1		172	Hypothetical protein EF0770 {Enterococcus faecalis	88.04
d1beda_		181	Disulfide-bond formation facilitator (DsbA) {Vibri	87.62
d1eeja1		156	Disulfide bond isomerase, DsbC, C-terminal domain	86.99
d2zcta1		237	Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}	86.14
d1fvka_		188	Disulfide-bond formation facilitator (DsbA) {Esche	85.56
d1n8ja_		186	Alkyl hydroperoxide reductase AhpC {Salmonella typ	85.02
d1ktea_		105	Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr	84.13
d1h75a_		76	Glutaredoxin-like NRDH-redoxin {Escherichia coli [	83.59
d2b7ka1		169	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	83.54
d1q98a_		164	Thiol peroxidase Tpx {Haemophilus influenzae [TaxI	82.69
d1nm3a1		74	C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus	82.41
d2h01a1		170	Thioredoxin peroxidase 2 (thioredoxin peroxidase B	82.3
d1v58a1		169	Thiol:disulfide interchange protein DsbG, C-termin	81.92
d1r7ha_		74	Glutaredoxin-like NRDH-redoxin {Corynebacterium am	81.87
d1fova_		82	Glutaredoxin (Grx, thioltransferase) {Escherichia	81.2
d1un2a_		195	Disulfide-bond formation facilitator (DsbA) {Esche	80.07
d1t3ba1		150	Disulfide bond isomerase, DsbC, C-terminal domain	80.06

>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PAPS reductase-like
domain: Phosphoadenylyl sulphate (PAPS) reductase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.1e-51  Score=385.14  Aligned_cols=197  Identities=24%  Similarity=0.397  Sum_probs=173.8

Q ss_pred             ChhhHHHHHHHhccCCHHHHHHHHHHHcCCcEEEEechHHHHHHH-HHHHhcCCCeEEEEEeCCCCcHHHHHHHHHHHHH
Q 015013           84 GEEDFEQFAKELENASPLEIMDRALEKFGNDIAIAFSGAEDVALI-EYAHLTGRPFRVFSLDTGRLNPETYRFFDEVEKH  162 (414)
Q Consensus        84 ~~~~~~~l~~~l~~~~a~eil~~a~~~~~~~i~vafSGGKDSvlL-~L~~~~~~~i~VvflDTG~~fpET~~~v~~l~~~  162 (414)
                      +...+.++|++|++++|+++|+|++++|+++++|+|||||||+|| ||+.+++++++|+|+|||++||||++|+++++++
T Consensus        16 ~~~~l~~~~~~l~~~~~~~~i~~~~~~~~~~v~vs~SgGkDS~vllhl~~~~~~~~~vvf~DTg~~fpeT~e~~~~~~~~   95 (215)
T d1sura_          16 RILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK   95 (215)
T ss_dssp             HHHHHHHHHHHHTTSCHHHHHHHHHHHCCSEEEEECCCCTTHHHHHHHHHHHSTTCEEEEEECSCBCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCEEEEecCChHHHHHHHHHHhcCCCccEEEEECCcCcHHHHHHHHHHHHh
Confidence            345688999999999999999999999998999999999999875 9999999999999999999999999999999999


Q ss_pred             hCCcEEEEcCChHHHHHHHHhcCCCCCCcccchhhhcchhchhHHHHhccCc--EEEecccccCCccCcCCCCceecCCC
Q 015013          163 FGIRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLR--AWITGQRKDQSPGTRSEIPVVQVDPV  240 (414)
Q Consensus       163 ~gl~i~~~~P~~~~~~~~~~~~G~~~~~~~~~~~Cc~~~Kv~Pl~ral~~~~--~~itGiRrdES~~~Ra~~~~~e~d~~  240 (414)
                      ||++++++.|............+.+.....++++||.++|++|++++++++.  +||+|+|++||. +|+.++.++.+. 
T Consensus        96 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~K~~P~~~~l~~~~~~~~i~G~Rr~Es~-~Ra~~~~~~~~~-  173 (215)
T d1sura_          96 LKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSG-SRANLPVLAIQR-  173 (215)
T ss_dssp             TTCEEEEEECSSCHHHHHHHHCCGGGSHHHHHHHHHHHHTHHHHHHHHHHTTEEEEECCCCTTSSS-TTTTCCSEEEET-
T ss_pred             cCceeeEEeccchHHHHHhhcCCcccCCcchhhhhhcchhccchhhhhhccCceehHHHHhhcchH-hHhcCCceeecC-
Confidence            9999999988765444333333333223345679999999999999999664  699999999996 999999887652 


Q ss_pred             CccccCCCCCeEEEEeCccccHHHHHHHHHhCCCCCChhhhCCCCCCCCcc
Q 015013          241 FEGLEGGVGSLVKWNPVANVKGNDIWNFLRTMDVPINSLHSQGYISIGCEP  291 (414)
Q Consensus       241 ~~~~~~~~~~~~ki~PL~dWt~~DVw~Yi~~~~lP~npLYd~Gy~SiGC~~  291 (414)
                               +++|++||++||.+|||+||+.|||||||||++||+||||||
T Consensus       174 ---------~~~kv~Pi~~Wt~~dVw~Yi~~~~lP~npLY~~Gy~siGC~h  215 (215)
T d1sura_         174 ---------GVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTH  215 (215)
T ss_dssp             ---------TEEEECTTTTCCHHHHHHHHHHHTCCCCGGGGGTCSCCCBCC
T ss_pred             ---------CEEEEechHhCCHHHHHHHHHHcCCCCCchhhcCCCCCCccC
Confidence                     588999999999999999999999999999999999999997

PyMOL of d1sura_

>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]}	Back information, alignment and structure

>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]}	Back information, alignment and structure

>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	Back information, alignment and structure

>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]}	Back information, alignment and structure

>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]}	Back information, alignment and structure

>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]}	Back information, alignment and structure

>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]}	Back information, alignment and structure

>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]}	Back information, alignment and structure

>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]}	Back information, alignment and structure

>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}	Back information, alignment and structure

>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]}	Back information, alignment and structure

>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]}	Back information, alignment and structure

>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]}	Back information, alignment and structure

>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]}	Back information, alignment and structure

>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]}	Back information, alignment and structure

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}	Back information, alignment and structure

>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure