Citrus Sinensis ID: 015230

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-

MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI

cccccccHHHccccccccccEEEEccccEEEEcccccEEEEEccHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHcccccccccccccccccHHcccccEEEccccHHHHHHHHHHccccEEEEEEcccccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccccccHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccEEEEcccccccccHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHc

cHHHcccHHHHccccccccccEEEEEEcEEEEccccEEEEccHHHccccccEccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHccccEEEEEEcccEcccccEcccccHHHHHHHHHHHcccEEEEEccccEcccEccHHHHHccccccEEEEcHHHHcccccEEEEEcHHHHccEcccccEcccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEEccccccccHHHHHcccHHHHHHHHHHHHHccEEccccccccEEccccccHHHHHHHHHHHHHHHHcc

mpggvnspvrafksvggqpivfdsvkgshmwdidgneyidyvgswgpaiighADDQVLAALGETmkkgtsfgapclLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKfegcyhghadpflvkagsgvatlglpdspgvpkgatyetltapfndvSALENLFENNKGEIAAIilepvvgnsgfiapkpdFLNAIRRITKENGALLIFDEVMTGFRLAYggaqeyfgvtpdlttlgkiiggglpvgayggrrdimemvapagpmyqagtlsgnplamtAGIHTLkrlkepgtyeYLNKITGELTQGIIDAGKKAGHAICGgyisgmfgffftegpvynfedakkseTTKFARFYRGMleegvyfapsqfeagftslahssddIQHTITAAEKVLRQI

mpggvnspvrafksvggqpIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI

MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDlttlgkiiggglPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI

********************************IDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYFGVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLA********************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		411	2.2.26 [Sep-21-2011]
P31593		478	Glutamate-1-semialdehyde	N/A	no	1.0	0.859	0.883	0.0
Q42522		472	Glutamate-1-semialdehyde	yes	no	1.0	0.870	0.868	0.0
P45621		466	Glutamate-1-semialdehyde	yes	no	1.0	0.881	0.866	0.0
Q85WB7		473	Glutamate-1-semialdehyde	N/A	no	1.0	0.868	0.858	0.0
Q40147		481	Glutamate-1-semialdehyde	N/A	no	1.0	0.854	0.871	0.0
P42799		474	Glutamate-1-semialdehyde	no	no	1.0	0.867	0.851	0.0
Q6YZE2		478	Glutamate-1-semialdehyde	yes	no	1.0	0.859	0.841	0.0
P18492		469	Glutamate-1-semialdehyde	N/A	no	1.0	0.876	0.836	0.0
B1X023		433	Glutamate-1-semialdehyde	yes	no	1.0	0.949	0.742	0.0
B2J7M9		432	Glutamate-1-semialdehyde	yes	no	1.0	0.951	0.744	0.0

>sp\|P31593\|GSA_TOBAC Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Nicotiana tabacum GN=GSA PE=2 SV=1	Back alignment and function desciption

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/411 (88%), Positives = 385/411 (93%)

Query: 1   MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAA 60
           MPGGVNSPVRAFKSVGGQPI+ DSVKGS M DIDGNEYIDYVGSWGPAIIGHADD+VLAA
Sbjct: 68  MPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHADDEVLAA 127

Query: 61  LGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRER 120
           L ETMKKGTSFGAPCLLEN LAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGR +
Sbjct: 128 LAETMKKGTSFGAPCLLENTLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRPK 187

Query: 121 IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENN 180
           IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPG PK AT +TLTAP+ND+SA+E+LFE +
Sbjct: 188 IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGGPKAATSDTLTAPYNDISAVESLFEEH 247

Query: 181 KGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYF 240
           KGE+AAIILEPVVGN+GFI P  DFL AIR+ITKEN ALLIFDEVMTGFRLAYGGAQEYF
Sbjct: 248 KGEVAAIILEPVVGNAGFIQPNLDFLAAIRKITKENDALLIFDEVMTGFRLAYGGAQEYF 307

Query: 241 GVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 300
           G+TPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR
Sbjct: 308 GITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 367

Query: 301 LKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSE 360
           L+ PGTYEYL+KITGELTQGI+DAGKK GHA+CGGYI GMFGF F EGPV NF DAKKS+
Sbjct: 368 LQGPGTYEYLDKITGELTQGILDAGKKTGHAMCGGYIRGMFGFLFAEGPVNNFSDAKKSD 427

Query: 361 TTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI 411
           T KF RFYRGMLEEGVYFAPSQFEAGFTSLAH+S+DIQ T+ AAEKVL+QI
Sbjct: 428 TEKFGRFYRGMLEEGVYFAPSQFEAGFTSLAHTSEDIQKTVAAAEKVLKQI 478

Nicotiana tabacum (taxid: 4097)
EC: 5EC: .EC: 4EC: .EC: 3EC: .EC: 8

>sp\|Q42522\|GSA2_ARATH Glutamate-1-semialdehyde 2,1-aminomutase 2, chloroplastic OS=Arabidopsis thaliana GN=GSA2 PE=2 SV=2	Back alignment and function description

>sp\|P45621\|GSA_SOYBN Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Glycine max GN=GSA1 PE=2 SV=1	Back alignment and function description

>sp\|Q85WB7\|GSA_BRANA Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Brassica napus GN=GSA PE=2 SV=1	Back alignment and function description

>sp\|Q40147\|GSA_SOLLC Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1	Back alignment and function description

>sp\|P42799\|GSA1_ARATH Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic OS=Arabidopsis thaliana GN=GSA1 PE=1 SV=1	Back alignment and function description

>sp\|Q6YZE2\|GSA_ORYSJ Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Oryza sativa subsp. japonica GN=GSA PE=2 SV=1	Back alignment and function description

>sp\|P18492\|GSA_HORVU Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Hordeum vulgare GN=GSA PE=1 SV=3	Back alignment and function description

>sp\|B1X023\|GSA_CYAA5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain ATCC 51142) GN=hemL PE=3 SV=2	Back alignment and function description

>sp\|B2J7M9\|GSA_NOSP7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hemL PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		411
449438260		471	PREDICTED: glutamate-1-semialdehyde 2,1-	1.0	0.872	0.905	0.0
255571784		473	glutamate-1-semialdehyde 2,1-aminomutase	1.0	0.868	0.909	0.0
224134068		479	predicted protein [Populus trichocarpa]	1.0	0.858	0.897	0.0
225456404		473	PREDICTED: glutamate-1-semialdehyde 2,1-	1.0	0.868	0.892	0.0
307136451		471	glutamate-1-semialdehyde 21-aminomutase	1.0	0.872	0.892	0.0
19875		478	glutamate-1-semialdehyde 2,1-aminomutase	1.0	0.859	0.883	0.0
357467549		468	Glutamate-1-semialdehyde 2,1-aminomutase	1.0	0.878	0.863	0.0
399785		478	RecName: Full=Glutamate-1-semialdehyde 2	1.0	0.859	0.883	0.0
345451030		471	glutamate 1-semialdehyde aminotransferas	1.0	0.872	0.861	0.0
297816078		476	glutamate-1-semialdehyde 2,1-aminomutase	1.0	0.863	0.871	0.0

>gi\|449438260\|ref\|XP_004136907.1\| PREDICTED: glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic-like [Cucumis sativus] gi\|449527822\|ref\|XP_004170908.1\| PREDICTED: glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/411 (90%), Positives = 398/411 (96%)

Query: 1   MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAA 60
           MPGGVNSPVRAFKSVGGQPI+ DSVKGSHMWDIDGNEY+DYVGSWGPAIIGHADD+VLAA
Sbjct: 61  MPGGVNSPVRAFKSVGGQPIIIDSVKGSHMWDIDGNEYVDYVGSWGPAIIGHADDEVLAA 120

Query: 61  LGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRER 120
           L ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG+E+
Sbjct: 121 LAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGKEK 180

Query: 121 IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENN 180
           +IKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPK ATYETLTAPFND+SA+E++F  N
Sbjct: 181 LIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKAATYETLTAPFNDISAVESIFNAN 240

Query: 181 KGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYF 240
           KGEIAAIILEPVVGNSGFIAPKPDFLNAIR++TKEN ALLIFDEVMTGFRL+YGGAQEYF
Sbjct: 241 KGEIAAIILEPVVGNSGFIAPKPDFLNAIRKLTKENDALLIFDEVMTGFRLSYGGAQEYF 300

Query: 241 GVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 300
           G+TPDLTTLGKIIGGGLPVGAYGGRR+IMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR
Sbjct: 301 GITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 360

Query: 301 LKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSE 360
           LKEPGTYEYL+KIT EL +G++ AGKKAGHAICGGYI+GMFGFFFT+GPVYNFEDAKKS+
Sbjct: 361 LKEPGTYEYLDKITSELVEGLVAAGKKAGHAICGGYINGMFGFFFTDGPVYNFEDAKKSD 420

Query: 361 TTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI 411
           T KF RFYRGMLE+GVYFAPSQFEAGFTSLAH+S+DIQHTI AAEKV +QI
Sbjct: 421 TAKFGRFYRGMLEQGVYFAPSQFEAGFTSLAHTSEDIQHTIAAAEKVFKQI 471

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255571784\|ref\|XP_002526835.1\| glutamate-1-semialdehyde 2,1-aminomutase, putative [Ricinus communis] gi\|223533839\|gb\|EEF35570.1\| glutamate-1-semialdehyde 2,1-aminomutase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224134068\|ref\|XP_002321728.1\| predicted protein [Populus trichocarpa] gi\|222868724\|gb\|EEF05855.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225456404\|ref\|XP_002284200.1\| PREDICTED: glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic [Vitis vinifera] gi\|147861754\|emb\|CAN83169.1\| hypothetical protein VITISV_021914 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|307136451\|gb\|ADN34256.1\| glutamate-1-semialdehyde 21-aminomutase [Cucumis melo subsp. melo]	Back alignment and taxonomy information

>gi\|19875\|emb\|CAA46787.1\| glutamate-1-semialdehyde 2,1-aminomutase [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|357467549\|ref\|XP_003604059.1\| Glutamate-1-semialdehyde 2,1-aminomutase [Medicago truncatula] gi\|345451028\|gb\|AEN94094.1\| glutamate 1-semialdehyde aminotransferase [Medicago truncatula] gi\|355493107\|gb\|AES74310.1\| Glutamate-1-semialdehyde 2,1-aminomutase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|399785\|sp\|P31593.1\|GSA_TOBAC RecName: Full=Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic; Short=GSA; AltName: Full=Glutamate-1-semialdehyde aminotransferase; Short=GSA-AT; Flags: Precursor gi\|19873\|emb\|CAA46786.1\| glutamate-1-semialdehyde 2,1-aminomutase [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|345451030\|gb\|AEN94095.1\| glutamate 1-semialdehyde aminotransferase [Medicago sativa]	Back alignment and taxonomy information

>gi\|297816078\|ref\|XP_002875922.1\| glutamate-1-semialdehyde 2,1-aminomutase 2 [Arabidopsis lyrata subsp. lyrata] gi\|297321760\|gb\|EFH52181.1\| glutamate-1-semialdehyde 2,1-aminomutase 2 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		411
TAIR\|locus:2114520		472	GSA2 "glutamate-1-semialdehyde	1.0	0.870	0.839	1.1e-188
TAIR\|locus:2160554		474	GSA1 ""glutamate-1-semialdehyd	1.0	0.867	0.822	8.2e-186
TIGR_CMR\|CHY_1212		432	CHY_1212 "glutamate-1-semialde	0.995	0.946	0.569	1.5e-122
TIGR_CMR\|GSU_0337		427	GSU_0337 "glutamate-1-semialde	0.982	0.946	0.559	4.2e-118
TIGR_CMR\|BA_4693		429	BA_4693 "glutamate-1-semialdeh	0.992	0.951	0.556	2.3e-117
UNIPROTKB\|P23893		426	hemL "glutamate-1-semialdehyde	1.0	0.964	0.516	3.1e-115
TIGR_CMR\|SO_1300		430	SO_1300 "glutamate-1-semialdeh	1.0	0.955	0.519	6.6e-113
UNIPROTKB\|Q9KU97		432	hemL "Glutamate-1-semialdehyde	0.987	0.939	0.523	4.8e-110
TIGR_CMR\|VC_0626		432	VC_0626 "glutamate-1-semialdeh	0.987	0.939	0.523	4.8e-110
TIGR_CMR\|CPS_4629		427	CPS_4629 "glutamate-1-semialde	1.0	0.962	0.481	9.2e-107

TAIR\|locus:2114520 GSA2 "glutamate-1-semialdehyde 2,1-aminomutase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1829 (648.9 bits), Expect = 1.1e-188, P = 1.1e-188
 Identities = 345/411 (83%), Positives = 374/411 (90%)

Query:     1 MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAA 60
             MPGGVNSPVRAFKSVGGQP+V DS KGS + DIDGNEYIDYVGSWGPAIIGHADD+VLAA
Sbjct:    62 MPGGVNSPVRAFKSVGGQPVVMDSAKGSRIRDIDGNEYIDYVGSWGPAIIGHADDEVLAA 121

Query:    61 LGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRER 120
             L ETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTG+++
Sbjct:   122 LAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGKQK 181

Query:   121 IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENN 180
              IKFEGCYHGHA+ FLVKAGSGVATLGLPDSPGVPK AT +TLTAP+ND++A+E LFE N
Sbjct:   182 FIKFEGCYHGHANSFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDIAAVEKLFEAN 241

Query:   181 KGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYF 240
             KGEIAAIILEPVVGNSGFI PKP+F+  IRRITK+NGALLIFDEVMTGFRLAYGGAQEYF
Sbjct:   242 KGEIAAIILEPVVGNSGFITPKPEFIEGIRRITKDNGALLIFDEVMTGFRLAYGGAQEYF 301

Query:   241 GVTPDXXXXXXXXXXXXPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 300
             G+TPD            PVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR
Sbjct:   302 GITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 361

Query:   301 LKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSE 360
             L +PGTYEYL+KIT ELT GI++AGKK GHA+CGGYISGMFGFFFTEGPVY+F DAKKS+
Sbjct:   362 LSQPGTYEYLDKITKELTNGILEAGKKTGHAMCGGYISGMFGFFFTEGPVYDFSDAKKSD 421

Query:   361 TTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI 411
             T KF +F+RGMLEEGVY APSQFEAGFTSLAH+S+DIQ TI AAEKVL ++
Sbjct:   422 TEKFGKFFRGMLEEGVYLAPSQFEAGFTSLAHTSEDIQFTIAAAEKVLSRL 472

GO:0003824 "catalytic activity" evidence=IEA

GO:0008483 "transaminase activity" evidence=IEA

GO:0009507 "chloroplast" evidence=ISS;IDA

GO:0030170 "pyridoxal phosphate binding" evidence=IEA

GO:0033014 "tetrapyrrole biosynthetic process" evidence=IEA

GO:0042286 "glutamate-1-semialdehyde 2,1-aminomutase activity" evidence=IEA;ISS

GO:0009941 "chloroplast envelope" evidence=IDA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0006098 "pentose-phosphate shunt" evidence=RCA

GO:0006364 "rRNA processing" evidence=RCA

GO:0009073 "aromatic amino acid family biosynthetic process" evidence=RCA

GO:0009965 "leaf morphogenesis" evidence=RCA

GO:0015995 "chlorophyll biosynthetic process" evidence=RCA

GO:0019344 "cysteine biosynthetic process" evidence=RCA

GO:0030154 "cell differentiation" evidence=RCA

GO:0045036 "protein targeting to chloroplast" evidence=RCA

GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA

GO:0006779 "porphyrin-containing compound biosynthetic process" evidence=TAS

TAIR\|locus:2160554 GSA1 ""glutamate-1-semialdehyde-2,1-aminomutase"" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TIGR_CMR\|CHY_1212 CHY_1212 "glutamate-1-semialdehyde-2,1-aminomutase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)]	Back alignment and assigned GO terms

TIGR_CMR\|GSU_0337 GSU_0337 "glutamate-1-semialdehyde-2,1-aminomutase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

TIGR_CMR\|BA_4693 BA_4693 "glutamate-1-semialdehyde-2,1-aminomutase" [Bacillus anthracis str. Ames (taxid:198094)]	Back alignment and assigned GO terms

UNIPROTKB\|P23893 hemL "glutamate-1-semialdehyde aminotransferase" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1300 SO_1300 "glutamate-1-semialdehyde-2,1-aminomutase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9KU97 hemL "Glutamate-1-semialdehyde 2,1-aminomutase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_0626 VC_0626 "glutamate-1-semialdehyde 2,1-aminomutase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_4629 CPS_4629 "glutamate-1-semialdehyde-2,1-aminomutase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B7KA18	GSA_CYAP7	5, ., 4, ., 3, ., 8	0.7274	1.0	0.9491	yes	no
B8HYK1	GSA_CYAP4	5, ., 4, ., 3, ., 8	0.7372	1.0	0.9513	yes	no
Q2JMP7	GSA_SYNJB	5, ., 4, ., 3, ., 8	0.7153	1.0	0.9426	yes	no
A2C0U2	GSA_PROM1	5, ., 4, ., 3, ., 8	0.7055	1.0	0.9602	yes	no
A2BVE5	GSA_PROM5	5, ., 4, ., 3, ., 8	0.6836	1.0	0.9491	yes	no
Q55665	GSA_SYNY3	5, ., 4, ., 3, ., 8	0.7230	0.9927	0.9422	N/A	no
A5GUJ2	GSA_SYNR3	5, ., 4, ., 3, ., 8	0.7031	1.0	0.9470	yes	no
A7NKV1	GSA_ROSCS	5, ., 4, ., 3, ., 8	0.5975	0.9975	0.9447	yes	no
P18492	GSA_HORVU	5, ., 4, ., 3, ., 8	0.8369	1.0	0.8763	N/A	no
P45621	GSA_SOYBN	5, ., 4, ., 3, ., 8	0.8661	1.0	0.8819	yes	no
A3PBK8	GSA_PROM0	5, ., 4, ., 3, ., 8	0.6861	1.0	0.9491	yes	no
A5GMT2	GSA_SYNPW	5, ., 4, ., 3, ., 8	0.7007	1.0	0.9491	yes	no
Q46GT9	GSA_PROMT	5, ., 4, ., 3, ., 8	0.7055	1.0	0.9513	yes	no
Q7VDA1	GSA_PROMA	5, ., 4, ., 3, ., 8	0.6958	1.0	0.9491	yes	no
Q7V677	GSA_PROMM	5, ., 4, ., 3, ., 8	0.7047	0.9805	0.9415	yes	no
Q39566	GSA_CHLRE	5, ., 4, ., 3, ., 8	0.6958	1.0	0.8876	N/A	no
A9BEA5	GSA_PROM4	5, ., 4, ., 3, ., 8	0.6982	1.0	0.9513	yes	no
Q3AWP4	GSA_SYNS9	5, ., 4, ., 3, ., 8	0.7196	0.9805	0.9415	yes	no
Q7U598	GSA_SYNPX	5, ., 4, ., 3, ., 8	0.7031	1.0	0.9602	yes	no
B1XIT5	GSA_SYNP2	5, ., 4, ., 3, ., 8	0.7445	1.0	0.9513	yes	no
Q0I8G1	GSA_SYNS3	5, ., 4, ., 3, ., 8	0.7196	0.9805	0.9200	yes	no
Q40147	GSA_SOLLC	5, ., 4, ., 3, ., 8	0.8710	1.0	0.8544	N/A	no
P31593	GSA_TOBAC	5, ., 4, ., 3, ., 8	0.8832	1.0	0.8598	N/A	no
B1X023	GSA_CYAA5	5, ., 4, ., 3, ., 8	0.7420	1.0	0.9491	yes	no
B7K2I1	GSA_CYAP8	5, ., 4, ., 3, ., 8	0.7372	1.0	0.9491	yes	no
A9B550	GSA_HERA2	5, ., 4, ., 3, ., 8	0.6082	1.0	0.9580	yes	no
Q3M3B9	GSA_ANAVT	5, ., 4, ., 3, ., 8	0.7396	1.0	0.9513	yes	no
Q3ACS9	GSA_CARHZ	5, ., 4, ., 3, ., 8	0.5965	0.9951	0.9467	yes	no
C0ZAH4	GSA2_BREBN	5, ., 4, ., 3, ., 8	0.5804	0.9975	0.9557	yes	no
B2J7M9	GSA_NOSP7	5, ., 4, ., 3, ., 8	0.7445	1.0	0.9513	yes	no
A2BPW6	GSA_PROMS	5, ., 4, ., 3, ., 8	0.6836	1.0	0.9491	yes	no
B0CC57	GSA_ACAM1	5, ., 4, ., 3, ., 8	0.7299	1.0	0.9513	yes	no
P24630	GSA_SYNP6	5, ., 4, ., 3, ., 8	0.7372	1.0	0.9491	yes	no
Q110Z9	GSA_TRIEI	5, ., 4, ., 3, ., 8	0.7274	1.0	0.9513	yes	no
Q6YZE2	GSA_ORYSJ	5, ., 4, ., 3, ., 8	0.8418	1.0	0.8598	yes	no
A8G3J9	GSA_PROM2	5, ., 4, ., 3, ., 8	0.6934	1.0	0.9491	yes	no
Q3ALU9	GSA_SYNSC	5, ., 4, ., 3, ., 8	0.7196	0.9805	0.9415	yes	no
Q8DLK8	GSA_THEEB	5, ., 4, ., 3, ., 8	0.7372	1.0	0.9405	yes	no
Q7V2J3	GSA_PROMP	5, ., 4, ., 3, ., 8	0.6909	1.0	0.9491	yes	no
A2C7I7	GSA_PROM3	5, ., 4, ., 3, ., 8	0.7047	0.9805	0.9415	yes	no
Q31QJ2	GSA_SYNE7	5, ., 4, ., 3, ., 8	0.7396	1.0	0.9491	yes	no
Q42522	GSA2_ARATH	5, ., 4, ., 3, ., 8	0.8686	1.0	0.8707	yes	no
P42799	GSA1_ARATH	5, ., 4, ., 3, ., 8	0.8515	1.0	0.8670	no	no
Q2RJ31	GSA_MOOTA	5, ., 4, ., 3, ., 8	0.5849	1.0	0.9405	yes	no
Q31C50	GSA_PROM9	5, ., 4, ., 3, ., 8	0.6861	1.0	0.9470	yes	no
Q7NPI4	GSA_GLOVI	5, ., 4, ., 3, ., 8	0.6544	0.9927	0.9444	yes	no
Q85WB7	GSA_BRANA	5, ., 4, ., 3, ., 8	0.8588	1.0	0.8689	N/A	no
Q8YS26	GSA_NOSS1	5, ., 4, ., 3, ., 8	0.7396	1.0	0.9513	yes	no
Q2JS70	GSA_SYNJA	5, ., 4, ., 3, ., 8	0.7177	1.0	0.9426	yes	no
B0JPW6	GSA_MICAN	5, ., 4, ., 3, ., 8	0.7347	1.0	0.9491	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	5.4.3	0.691
3rd Layer	5.4.3.8	0.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00150799	glutamate-1-semialdehyde 2,1-aminomutase (EC-5.4.3.8) (479 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	gw1.I.4290.1	glutamyl-tRNA reductase (EC-1.2.1.70) (471 aa)	•	•		•	•	•	0.995
	estExt_Genewise1_v1.C_LG_II0707	glutamyl-tRNA reductase (EC-1.2.1.70) (469 aa)	•	•		•	•	•	0.995
	eugene3.00020758	hypothetical protein (430 aa)	•	•	•		•	•	0.995
	gw1.IX.2784.1	glutamyl-tRNA reductase (EC-1.2.1.70) (503 aa)	•	•		•	•	•	0.994
	fgenesh4_pm.C_LG_VII000271	hydroxymethylbilane synthase (EC-2.5.1.61) (363 aa)	•	•	•			•	0.970
	fgenesh4_pg.C_LG_V000312	hydroxymethylbilane synthase (EC-2.5.1.61) (364 aa)	•	•	•			•	0.970
	gw1.13426.3.1	Delta-aminolevulinic acid dehydratase (293 aa)	•	•				•	0.969
	gw1.16698.2.1	Delta-aminolevulinic acid dehydratase (254 aa)	•	•				•	0.962
	gw1.148.3.1	uroporphyrin-III C-methyltransferase (EC-2.1.1.107) (328 aa)	•					•	0.954
	gw1.182.88.1	uroporphyrinogen decarboxylase (EC-4.1.1.37) (357 aa)	•	•	•			•	0.930

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		411
PLN02482		474	PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-a	0.0
PRK00062		426	PRK00062, PRK00062, glutamate-1-semialdehyde amino	0.0
COG0001		432	COG0001, HemL, Glutamate-1-semialdehyde aminotrans	0.0
TIGR00713		423	TIGR00713, hemL, glutamate-1-semialdehyde-2,1-amin	0.0
PRK12389		428	PRK12389, PRK12389, glutamate-1-semialdehyde amino	0.0
cd00610		413	cd00610, OAT_like, Acetyl ornithine aminotransfera	1e-124
PRK00615		433	PRK00615, PRK00615, glutamate-1-semialdehyde amino	1e-109
PRK06209		431	PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-a	1e-70
pfam00202		338	pfam00202, Aminotran_3, Aminotransferase class-III	7e-69
COG4992		404	COG4992, ArgD, Ornithine/acetylornithine aminotran	1e-63
COG0160		447	COG0160, GabT, 4-aminobutyrate aminotransferase an	1e-60
TIGR00707		379	TIGR00707, argD, transaminase, acetylornithine/suc	1e-52
PRK02627		396	PRK02627, PRK02627, acetylornithine aminotransfera	9e-50
PRK08117		433	PRK08117, PRK08117, 4-aminobutyrate aminotransfera	8e-49
PRK07046		453	PRK07046, PRK07046, aminotransferase; Validated	4e-48
PRK08360		443	PRK08360, PRK08360, 4-aminobutyrate aminotransfera	3e-46
PRK02936		377	PRK02936, argD, acetylornithine aminotransferase;	7e-46
PRK05769		441	PRK05769, PRK05769, 4-aminobutyrate aminotransfera	8e-46
PTZ00125		400	PTZ00125, PTZ00125, ornithine aminotransferase-lik	1e-43
PRK03244		398	PRK03244, argD, acetylornithine aminotransferase;	2e-42
PRK08088		425	PRK08088, PRK08088, 4-aminobutyrate aminotransfera	6e-41
PRK07495		425	PRK07495, PRK07495, 4-aminobutyrate aminotransfera	6e-41
PRK03715		395	PRK03715, argD, acetylornithine transaminase prote	7e-41
COG0161		449	COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon	1e-40
PRK08593		445	PRK08593, PRK08593, 4-aminobutyrate aminotransfera	2e-39
PRK06777		421	PRK06777, PRK06777, 4-aminobutyrate aminotransfera	3e-39
PRK01278		389	PRK01278, argD, acetylornithine transaminase prote	5e-39
PLN02624		474	PLN02624, PLN02624, ornithine-delta-aminotransfera	8e-38
TIGR00508		417	TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon	7e-37
PRK11522		459	PRK11522, PRK11522, putrescine--2-oxoglutarate ami	1e-36
PRK12381		406	PRK12381, PRK12381, bifunctional succinylornithine	1e-36
TIGR00700		420	TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf	2e-36
PRK04013		364	PRK04013, argD, acetylornithine/acetyl-lysine amin	1e-35
PRK05093		403	PRK05093, argD, bifunctional N-succinyldiaminopime	5e-35
TIGR01885		401	TIGR01885, Orn_aminotrans, ornithine aminotransfer	1e-34
TIGR03246		397	TIGR03246, arg_catab_astC, succinylornithine trans	3e-34
PRK06918		451	PRK06918, PRK06918, 4-aminobutyrate aminotransfera	3e-34
TIGR00709		442	TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase	9e-34
PRK09792		421	PRK09792, PRK09792, 4-aminobutyrate transaminase;	4e-33
PLN00144		382	PLN00144, PLN00144, acetylornithine transaminase	2e-32
PRK04260		375	PRK04260, PRK04260, acetylornithine aminotransfera	3e-32
TIGR03372		442	TIGR03372, putres_am_tran, putrescine aminotransfe	4e-32
PRK06062		451	PRK06062, PRK06062, hypothetical protein; Provisio	3e-31
PRK06931		459	PRK06931, PRK06931, diaminobutyrate--2-oxoglutarat	2e-30
PRK09221		445	PRK09221, PRK09221, beta alanine--pyruvate transam	3e-30
PRK06058		443	PRK06058, PRK06058, 4-aminobutyrate aminotransfera	2e-29
PRK04612		408	PRK04612, argD, acetylornithine transaminase prote	3e-28
PRK06938		464	PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat	5e-28
PRK05964		423	PRK05964, PRK05964, adenosylmethionine--8-amino-7-	6e-27
PRK13360		442	PRK13360, PRK13360, omega amino acid--pyruvate tra	2e-25
PRK04073		396	PRK04073, rocD, ornithine--oxo-acid transaminase;	1e-23
PRK07483		443	PRK07483, PRK07483, hypothetical protein; Provisio	3e-23
PRK06917		447	PRK06917, PRK06917, hypothetical protein; Provisio	4e-22
TIGR02407		412	TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglu	1e-21
PLN02760		504	PLN02760, PLN02760, 4-aminobutyrate:pyruvate trans	6e-21
PRK05639		457	PRK05639, PRK05639, 4-aminobutyrate aminotransfera	1e-20
PRK00854		401	PRK00854, rocD, ornithine--oxo-acid transaminase;	2e-20
PRK06916		460	PRK06916, PRK06916, adenosylmethionine--8-amino-7-	4e-20
PRK06173		429	PRK06173, PRK06173, adenosylmethionine--8-amino-7-	5e-20
PRK06148		1013	PRK06148, PRK06148, hypothetical protein; Provisio	8e-20
PRK08742		472	PRK08742, PRK08742, adenosylmethionine--8-amino-7-	2e-19
PRK07678		451	PRK07678, PRK07678, aminotransferase; Validated	5e-19
PRK07481		449	PRK07481, PRK07481, hypothetical protein; Provisio	3e-18
PRK06149		972	PRK06149, PRK06149, hypothetical protein; Provisio	3e-18
PRK07036		466	PRK07036, PRK07036, hypothetical protein; Provisio	7e-18
PRK06082		459	PRK06082, PRK06082, 4-aminobutyrate aminotransfera	7e-18
PRK12403		460	PRK12403, PRK12403, putative aminotransferase; Pro	1e-17
PRK07986		428	PRK07986, PRK07986, adenosylmethionine--8-amino-7-	2e-17
PRK07480		456	PRK07480, PRK07480, putative aminotransferase; Val	8e-17
PRK07030		466	PRK07030, PRK07030, adenosylmethionine--8-amino-7-	2e-15
PRK06541		460	PRK06541, PRK06541, hypothetical protein; Provisio	2e-15
PRK06943		453	PRK06943, PRK06943, adenosylmethionine--8-amino-7-	2e-14
PRK09264		425	PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat	3e-14
PRK05630		422	PRK05630, PRK05630, adenosylmethionine--8-amino-7-	1e-13
PRK05965		459	PRK05965, PRK05965, hypothetical protein; Provisio	2e-13
PRK06105		460	PRK06105, PRK06105, aminotransferase; Provisional	1e-12
PRK08297		443	PRK08297, PRK08297, L-lysine aminotransferase; Pro	2e-11
TIGR03251		431	TIGR03251, LAT_fam, L-lysine 6-transaminase	4e-11
PRK07482		461	PRK07482, PRK07482, hypothetical protein; Provisio	4e-11
PLN02974		817	PLN02974, PLN02974, adenosylmethionine-8-amino-7-o	8e-10
cd06454		349	cd06454, KBL_like, KBL_like; this family belongs t	1e-06
COG0156		388	COG0156, BioF, 7-keto-8-aminopelargonate synthetas	1e-06
TIGR00699		464	TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotran	5e-06
TIGR01822		393	TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate co	5e-06
cd01494		170	cd01494, AAT_I, Aspartate aminotransferase (AAT) s	7e-06
PRK06939		397	PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzym	1e-05
TIGR00858		360	TIGR00858, bioF, 8-amino-7-oxononanoate synthase	1e-04
pfam00155		357	pfam00155, Aminotran_1_2, Aminotransferase class I	2e-04
PRK09264		425	PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat	3e-04

>gnl\|CDD\|178100 PLN02482, PLN02482, glutamate-1-semialdehyde 2,1-aminomutase	Back alignment and domain information

 Score =  868 bits (2244), Expect = 0.0
 Identities = 353/411 (85%), Positives = 384/411 (93%)

Query: 1   MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAA 60
           MPGGVNSPVRAFKSVGGQPIVFD VKGS+ WD+DGNEYIDYVGSWGPAIIGHADD+VLAA
Sbjct: 64  MPGGVNSPVRAFKSVGGQPIVFDRVKGSYAWDVDGNEYIDYVGSWGPAIIGHADDEVLAA 123

Query: 61  LGETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRER 120
           L ETMKKGTSFGAPCLLENVLAEMVI AVPS+EMVRFVNSGTEACMGVLRLARA+TGRE+
Sbjct: 124 LAETMKKGTSFGAPCLLENVLAEMVIDAVPSVEMVRFVNSGTEACMGVLRLARAYTGREK 183

Query: 121 IIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATYETLTAPFNDVSALENLFENN 180
           IIKFEGCYHGHAD FLVKAGSGVATLGLPDSPGVPK AT  TLTAP+ND+ A++ LFE N
Sbjct: 184 IIKFEGCYHGHADSFLVKAGSGVATLGLPDSPGVPKAATSATLTAPYNDLEAVKKLFEAN 243

Query: 181 KGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYF 240
           KGEIAA+ILEPVVGNSGFI PK +FL  +R ITKENGALL+FDEVMTGFR+AYGGAQEYF
Sbjct: 244 KGEIAAVILEPVVGNSGFIVPKKEFLEGLREITKENGALLVFDEVMTGFRIAYGGAQEYF 303

Query: 241 GVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 300
           G+TPDLTTLGK+IGGGLPVGAYGGRR+IMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR
Sbjct: 304 GITPDLTTLGKVIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKR 363

Query: 301 LKEPGTYEYLNKITGELTQGIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSE 360
           L++PGTYEYL+KIT +L QGI++AGKKAGH +CGGYISGMFGFFFTEGPVYNF DAKKS+
Sbjct: 364 LQQPGTYEYLDKITKKLIQGILEAGKKAGHEMCGGYISGMFGFFFTEGPVYNFADAKKSD 423

Query: 361 TTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQHTITAAEKVLRQI 411
           T KFARF+RGMLEEGVY APSQFEAGFTSLAH+ +DI  TI AAE+VL +I
Sbjct: 424 TAKFARFHRGMLEEGVYLAPSQFEAGFTSLAHTEEDIDFTIAAAERVLARI 474

Length = 474

>gnl\|CDD\|234607 PRK00062, PRK00062, glutamate-1-semialdehyde aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|223080 COG0001, HemL, Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|233100 TIGR00713, hemL, glutamate-1-semialdehyde-2,1-aminomutase	Back alignment and domain information

>gnl\|CDD\|183493 PRK12389, PRK12389, glutamate-1-semialdehyde aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family	Back alignment and domain information

>gnl\|CDD\|234803 PRK00615, PRK00615, glutamate-1-semialdehyde aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|180471 PRK06209, PRK06209, glutamate-1-semialdehyde 2,1-aminomutase; Provisional	Back alignment and domain information

>gnl\|CDD\|201078 pfam00202, Aminotran_3, Aminotransferase class-III	Back alignment and domain information

>gnl\|CDD\|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family	Back alignment and domain information

>gnl\|CDD\|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|235917 PRK07046, PRK07046, aminotransferase; Validated	Back alignment and domain information

>gnl\|CDD\|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|236149 PRK08088, PRK08088, 4-aminobutyrate aminotransferase; Validated	Back alignment and domain information

>gnl\|CDD\|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215335 PLN02624, PLN02624, ornithine-delta-aminotransferase	Back alignment and domain information

>gnl\|CDD\|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase	Back alignment and domain information

>gnl\|CDD\|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|183486 PRK12381, PRK12381, bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type	Back alignment and domain information

>gnl\|CDD\|101376 PRK04013, argD, acetylornithine/acetyl-lysine aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase	Back alignment and domain information

>gnl\|CDD\|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family	Back alignment and domain information

>gnl\|CDD\|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed	Back alignment and domain information

>gnl\|CDD\|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases	Back alignment and domain information

>gnl\|CDD\|182078 PRK09792, PRK09792, 4-aminobutyrate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|177748 PLN00144, PLN00144, acetylornithine transaminase	Back alignment and domain information

>gnl\|CDD\|179803 PRK04260, PRK04260, acetylornithine aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|132415 TIGR03372, putres_am_tran, putrescine aminotransferase	Back alignment and domain information

>gnl\|CDD\|235687 PRK06062, PRK06062, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235889 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|236027 PRK07483, PRK07483, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235884 PRK06917, PRK06917, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233853 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase	Back alignment and domain information

>gnl\|CDD\|215405 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase	Back alignment and domain information

>gnl\|CDD\|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed	Back alignment and domain information

>gnl\|CDD\|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|180441 PRK06173, PRK06173, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|180426 PRK06148, PRK06148, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236336 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|181078 PRK07678, PRK07678, aminotransferase; Validated	Back alignment and domain information

>gnl\|CDD\|168967 PRK07481, PRK07481, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235716 PRK06149, PRK06149, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235913 PRK07036, PRK07036, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|171472 PRK12403, PRK12403, putative aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|181189 PRK07986, PRK07986, adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated	Back alignment and domain information

>gnl\|CDD\|180994 PRK07480, PRK07480, putative aminotransferase; Validated	Back alignment and domain information

>gnl\|CDD\|180800 PRK07030, PRK07030, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|235823 PRK06541, PRK06541, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|235894 PRK06943, PRK06943, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated	Back alignment and domain information

>gnl\|CDD\|180174 PRK05630, PRK05630, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>gnl\|CDD\|180330 PRK05965, PRK05965, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|180401 PRK06105, PRK06105, aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|236224 PRK08297, PRK08297, L-lysine aminotransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase	Back alignment and domain information

>gnl\|CDD\|236026 PRK07482, PRK07482, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215526 PLN02974, PLN02974, adenosylmethionine-8-amino-7-oxononanoate transaminase	Back alignment and domain information

>gnl\|CDD\|99747 cd06454, KBL_like, KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I)	Back alignment and domain information

>gnl\|CDD\|223234 COG0156, BioF, 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|129782 TIGR00699, GABAtrns_euk, 4-aminobutyrate aminotransferase, eukaryotic type	Back alignment and domain information

>gnl\|CDD\|130881 TIGR01822, 2am3keto_CoA, 2-amino-3-ketobutyrate coenzyme A ligase	Back alignment and domain information

>gnl\|CDD\|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes	Back alignment and domain information

>gnl\|CDD\|235893 PRK06939, PRK06939, 2-amino-3-ketobutyrate coenzyme A ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|129937 TIGR00858, bioF, 8-amino-7-oxononanoate synthase	Back alignment and domain information

>gnl\|CDD\|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II	Back alignment and domain information

>gnl\|CDD\|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		411
COG0001		432	HemL Glutamate-1-semialdehyde aminotransferase [Co	100.0
COG4992		404	ArgD Ornithine/acetylornithine aminotransferase [A	100.0
COG0160		447	GabT 4-aminobutyrate aminotransferase and related	100.0
PLN02482		474	glutamate-1-semialdehyde 2,1-aminomutase	100.0
PRK12389		428	glutamate-1-semialdehyde aminotransferase; Provisi	100.0
PRK00615		433	glutamate-1-semialdehyde aminotransferase; Provisi	100.0
COG0161		449	BioA Adenosylmethionine-8-amino-7-oxononanoate ami	100.0
KOG1404		442	consensus Alanine-glyoxylate aminotransferase AGT2	100.0
TIGR00713		423	hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi	100.0
PRK00062		426	glutamate-1-semialdehyde aminotransferase; Provisi	100.0
PRK07046		453	aminotransferase; Validated	100.0
PRK06062		451	hypothetical protein; Provisional	100.0
PRK11522		459	putrescine--2-oxoglutarate aminotransferase; Provi	100.0
PRK05965		459	hypothetical protein; Provisional	100.0
TIGR03372		442	putres_am_tran putrescine aminotransferase. Member	100.0
PRK07481		449	hypothetical protein; Provisional	100.0
PRK07678		451	aminotransferase; Validated	100.0
PRK07482		461	hypothetical protein; Provisional	100.0
PLN02760		504	4-aminobutyrate:pyruvate transaminase	100.0
PRK06931		459	diaminobutyrate--2-oxoglutarate aminotransferase;	100.0
PRK06058		443	4-aminobutyrate aminotransferase; Provisional	100.0
KOG1401		433	consensus Acetylornithine aminotransferase [Amino	100.0
PRK07483		443	hypothetical protein; Provisional	100.0
PRK06943		453	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK07030		466	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK06938		464	diaminobutyrate--2-oxoglutarate aminotransferase;	100.0
PRK07495		425	4-aminobutyrate aminotransferase; Provisional	100.0
PRK06916		460	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK08593		445	4-aminobutyrate aminotransferase; Provisional	100.0
PRK08742		472	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK04612		408	argD acetylornithine transaminase protein; Provisi	100.0
TIGR00709		442	dat 2,4-diaminobutyrate 4-transaminases. This fami	100.0
PRK06541		460	hypothetical protein; Provisional	100.0
PRK06105		460	aminotransferase; Provisional	100.0
PRK07986		428	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK07480		456	putative aminotransferase; Validated	100.0
PRK07036		466	hypothetical protein; Provisional	100.0
PRK05639		457	4-aminobutyrate aminotransferase; Provisional	100.0
PRK06917		447	hypothetical protein; Provisional	100.0
PRK12403		460	putative aminotransferase; Provisional	100.0
TIGR03246		397	arg_catab_astC succinylornithine transaminase fami	100.0
PRK06777		421	4-aminobutyrate aminotransferase; Provisional	100.0
PRK13360		442	omega amino acid--pyruvate transaminase; Provision	100.0
PRK08117		433	4-aminobutyrate aminotransferase; Provisional	100.0
PRK09792		421	4-aminobutyrate transaminase; Provisional	100.0
PRK08360		443	4-aminobutyrate aminotransferase; Provisional	100.0
PRK09221		445	beta alanine--pyruvate transaminase; Provisional	100.0
TIGR00700		420	GABAtrnsam 4-aminobutyrate aminotransferase, proka	100.0
PRK05769		441	4-aminobutyrate aminotransferase; Provisional	100.0
KOG1402		427	consensus Ornithine aminotransferase [Amino acid t	100.0
PRK06082		459	4-aminobutyrate aminotransferase; Provisional	100.0
PRK05964		423	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK12381		406	bifunctional succinylornithine transaminase/acetyl	100.0
PRK06173		429	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
PRK03715		395	argD acetylornithine transaminase protein; Provisi	100.0
PRK05630		422	adenosylmethionine--8-amino-7-oxononanoate transam	100.0
TIGR02407		412	ectoine_ectB diaminobutyrate--2-oxoglutarate amino	100.0
PLN00144		382	acetylornithine transaminase	100.0
PRK04013		364	argD acetylornithine/acetyl-lysine aminotransferas	100.0
PRK06918		451	4-aminobutyrate aminotransferase; Reviewed	100.0
PRK06148		1013	hypothetical protein; Provisional	100.0
PRK09264		425	diaminobutyrate--2-oxoglutarate aminotransferase;	100.0
PRK06209		431	glutamate-1-semialdehyde 2,1-aminomutase; Provisio	100.0
TIGR00699		464	GABAtrns_euk 4-aminobutyrate aminotransferase, euk	100.0
PRK01278		389	argD acetylornithine transaminase protein; Provisi	100.0
PRK08297		443	L-lysine aminotransferase; Provisional	100.0
PRK05093		403	argD bifunctional N-succinyldiaminopimelate-aminot	100.0
PLN02624		474	ornithine-delta-aminotransferase	100.0
PRK06149		972	hypothetical protein; Provisional	100.0
PRK04073		396	rocD ornithine--oxo-acid transaminase; Provisional	100.0
TIGR00508		427	bioA adenosylmethionine-8-amino-7-oxononanoate tra	100.0
PRK02936		377	argD acetylornithine aminotransferase; Provisional	100.0
PRK03244		398	argD acetylornithine aminotransferase; Provisional	100.0
TIGR03251		431	LAT_fam L-lysine 6-transaminase. Characterized mem	100.0
PRK08088		425	4-aminobutyrate aminotransferase; Validated	100.0
PF00202		339	Aminotran_3: Aminotransferase class-III; InterPro:	100.0
cd00610		413	OAT_like Acetyl ornithine aminotransferase family.	100.0
PLN02974		817	adenosylmethionine-8-amino-7-oxononanoate transami	100.0
PRK02627		396	acetylornithine aminotransferase; Provisional	100.0
KOG1403		452	consensus Predicted alanine-glyoxylate aminotransf	100.0
TIGR01885		401	Orn_aminotrans ornithine aminotransferase. This mo	100.0
PTZ00125		400	ornithine aminotransferase-like protein; Provision	100.0
PRK00854		401	rocD ornithine--oxo-acid transaminase; Reviewed	100.0
PRK04260		375	acetylornithine aminotransferase; Provisional	100.0
TIGR00707		379	argD acetylornithine and succinylornithine aminotr	100.0
KOG1405		484	consensus 4-aminobutyrate aminotransferase [Amino	100.0
PLN02822		481	serine palmitoyltransferase	100.0
PRK07505		402	hypothetical protein; Provisional	100.0
COG0156		388	BioF 7-keto-8-aminopelargonate synthetase and rela	100.0
PLN02955		476	8-amino-7-oxononanoate synthase	100.0
TIGR01821		402	5aminolev_synth 5-aminolevulinic acid synthase. Th	100.0
PRK13393		406	5-aminolevulinate synthase; Provisional	100.0
PRK09064		407	5-aminolevulinate synthase; Validated	100.0
COG0436		393	Aspartate/tyrosine/aromatic aminotransferase [Amin	100.0
TIGR01822		393	2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig	100.0
PRK05958		385	8-amino-7-oxononanoate synthase; Reviewed	100.0
PRK06939		397	2-amino-3-ketobutyrate coenzyme A ligase; Provisio	99.98
TIGR01825		385	gly_Cac_T_rel pyridoxal phosphate-dependent acyltr	99.98
PRK07179		407	hypothetical protein; Provisional	99.98
PLN03227		392	serine palmitoyltransferase-like protein; Provisio	99.97
COG1168		388	MalY Bifunctional PLP-dependent enzyme with beta-c	99.97
PRK13392		410	5-aminolevulinate synthase; Provisional	99.97
TIGR00858		360	bioF 8-amino-7-oxononanoate synthase. This model r	99.97
PRK07682		378	hypothetical protein; Validated	99.97
PRK07681		399	aspartate aminotransferase; Provisional	99.97
PLN00175		413	aminotransferase family protein; Provisional	99.97
PRK06225		380	aspartate aminotransferase; Provisional	99.97
PRK07366		388	succinyldiaminopimelate transaminase; Validated	99.97
PRK06207		405	aspartate aminotransferase; Provisional	99.96
PRK03317		368	histidinol-phosphate aminotransferase; Provisional	99.96
PRK08068		389	transaminase; Reviewed	99.96
KOG0257		420	consensus Kynurenine aminotransferase, glutamine t	99.96
PLN02483		489	serine palmitoyltransferase	99.96
PRK15481		431	transcriptional regulatory protein PtsJ; Provision	99.96
PRK07324		373	transaminase; Validated	99.96
PRK06290		410	aspartate aminotransferase; Provisional	99.96
KOG1359		417	consensus Glycine C-acetyltransferase/2-amino-3-ke	99.96
PRK09276		385	LL-diaminopimelate aminotransferase; Provisional	99.96
KOG0259		447	consensus Tyrosine aminotransferase [Amino acid tr	99.96
PRK08636		403	aspartate aminotransferase; Provisional	99.96
TIGR03540		383	DapC_direct LL-diaminopimelate aminotransferase. T	99.96
PRK05942		394	aspartate aminotransferase; Provisional	99.96
PRK08960		387	hypothetical protein; Provisional	99.96
PRK06108		382	aspartate aminotransferase; Provisional	99.96
PRK09147		396	succinyldiaminopimelate transaminase; Provisional	99.96
PRK13355		517	bifunctional HTH-domain containing protein/aminotr	99.96
PRK06348		384	aspartate aminotransferase; Provisional	99.96
PRK09148		405	aminotransferase; Validated	99.96
PRK07309		391	aromatic amino acid aminotransferase; Validated	99.96
PRK06855		433	aminotransferase; Validated	99.96
PRK08175		395	aminotransferase; Validated	99.96
PRK12414		384	putative aminotransferase; Provisional	99.96
COG1167		459	ARO8 Transcriptional regulators containing a DNA-b	99.96
PLN02187		462	rooty/superroot1	99.96
COG0079		356	HisC Histidinol-phosphate/aromatic aminotransferas	99.96
PLN00145		430	tyrosine/nicotianamine aminotransferase; Provision	99.96
TIGR03537		350	DapC succinyldiaminopimelate transaminase. Note: t	99.96
PRK01533		366	histidinol-phosphate aminotransferase; Validated	99.96
PRK07683		387	aminotransferase A; Validated	99.96
PRK09082		386	methionine aminotransferase; Validated	99.96
PLN02656		409	tyrosine transaminase	99.96
PRK08363		398	alanine aminotransferase; Validated	99.96
PRK05957		389	aspartate aminotransferase; Provisional	99.96
PRK02731		367	histidinol-phosphate aminotransferase; Validated	99.95
PRK08912		387	hypothetical protein; Provisional	99.95
PRK14809		357	histidinol-phosphate aminotransferase; Provisional	99.95
KOG1360		570	consensus 5-aminolevulinate synthase [Coenzyme tra	99.95
PLN00143		409	tyrosine/nicotianamine aminotransferase; Provision	99.95
PRK03158		359	histidinol-phosphate aminotransferase; Provisional	99.95
PRK00950		361	histidinol-phosphate aminotransferase; Validated	99.95
PRK14807		351	histidinol-phosphate aminotransferase; Provisional	99.95
PRK06107		402	aspartate aminotransferase; Provisional	99.95
TIGR03538		393	DapC_gpp succinyldiaminopimelate transaminase. Thi	99.95
PRK08361		391	aspartate aminotransferase; Provisional	99.95
PRK05839		374	hypothetical protein; Provisional	99.95
PRK02610		374	histidinol-phosphate aminotransferase; Provisional	99.95
PRK05937		370	8-amino-7-oxononanoate synthase; Provisional	99.95
PLN03026		380	histidinol-phosphate aminotransferase; Provisional	99.95
cd06454		349	KBL_like KBL_like; this family belongs to the pyri	99.95
PRK07777		387	aminotransferase; Validated	99.95
PRK08153		369	histidinol-phosphate aminotransferase; Provisional	99.95
TIGR01141		346	hisC histidinol-phosphate aminotransferase. Histid	99.95
PRK05764		393	aspartate aminotransferase; Provisional	99.95
TIGR01264		401	tyr_amTase_E tyrosine aminotransferase, eukaryotic	99.95
PRK07550		386	hypothetical protein; Provisional	99.95
PRK08056		356	threonine-phosphate decarboxylase; Provisional	99.95
PTZ00433		412	tyrosine aminotransferase; Provisional	99.95
PRK07865		364	N-succinyldiaminopimelate aminotransferase; Review	99.95
PRK09265		404	aminotransferase AlaT; Validated	99.95
PRK06358		354	threonine-phosphate decarboxylase; Provisional	99.95
PRK07337		388	aminotransferase; Validated	99.95
PRK07590		409	L,L-diaminopimelate aminotransferase; Validated	99.95
PLN02672		1082	methionine S-methyltransferase	99.95
PTZ00377		481	alanine aminotransferase; Provisional	99.95
TIGR03576		346	pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158	99.95
PRK04870		356	histidinol-phosphate aminotransferase; Provisional	99.94
PLN02450		468	1-aminocyclopropane-1-carboxylate synthase	99.94
TIGR03539		357	DapC_actino succinyldiaminopimelate transaminase.	99.94
PRK05387		353	histidinol-phosphate aminotransferase; Provisional	99.94
PRK05664		330	threonine-phosphate decarboxylase; Reviewed	99.94
PRK09257		396	aromatic amino acid aminotransferase; Provisional	99.94
PRK06959		339	putative threonine-phosphate decarboxylase; Provis	99.94
PRK06425		332	histidinol-phosphate aminotransferase; Validated	99.94
PRK03321		352	putative aminotransferase; Provisional	99.94
PTZ00376		404	aspartate aminotransferase; Provisional	99.94
PRK06836		394	aspartate aminotransferase; Provisional	99.94
PLN02376		496	1-aminocyclopropane-1-carboxylate synthase	99.94
PRK09440		416	avtA valine--pyruvate transaminase; Provisional	99.94
PRK09105		370	putative aminotransferase; Provisional	99.94
PRK14808		335	histidinol-phosphate aminotransferase; Provisional	99.94
PLN02607		447	1-aminocyclopropane-1-carboxylate synthase	99.94
PRK07568		397	aspartate aminotransferase; Provisional	99.94
PRK03967		337	histidinol-phosphate aminotransferase; Provisional	99.94
PRK07392		360	threonine-phosphate decarboxylase; Validated	99.94
PRK01688		351	histidinol-phosphate aminotransferase; Provisional	99.93
TIGR01265		403	tyr_nico_aTase tyrosine/nicotianamine aminotransfe	99.93
PRK05166		371	histidinol-phosphate aminotransferase; Provisional	99.93
TIGR01140		330	L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy	99.93
PF00155		363	Aminotran_1_2: Aminotransferase class I and II 1-a	99.93
TIGR03542		402	DAPAT_plant LL-diaminopimelate aminotransferase. T	99.93
PRK08354		311	putative aminotransferase; Provisional	99.92
PLN02231		534	alanine transaminase	99.92
PRK07908		349	hypothetical protein; Provisional	99.92
PLN02721		353	threonine aldolase	99.92
PRK04781		364	histidinol-phosphate aminotransferase; Provisional	99.92
PRK09275		527	aspartate aminotransferase; Provisional	99.92
PRK04635		354	histidinol-phosphate aminotransferase; Provisional	99.92
cd00609		350	AAT_like Aspartate aminotransferase family. This f	99.92
TIGR03392		398	FeS_syn_CsdA cysteine desulfurase, catalytic subun	99.91
PLN02397		423	aspartate transaminase	99.91
cd00613		398	GDC-P Glycine cleavage system P-protein, alpha- an	99.91
cd06502		338	TA_like Low-specificity threonine aldolase (TA). T	99.91
TIGR03801		521	asp_4_decarbox aspartate 4-decarboxylase. This enz	99.91
PRK10874		401	cysteine sulfinate desulfinase; Provisional	99.91
PRK10534		333	L-threonine aldolase; Provisional	99.91
PRK08637		388	hypothetical protein; Provisional	99.91
COG1104		386	NifS Cysteine sulfinate desulfinase/cysteine desul	99.91
PRK13520		371	L-tyrosine decarboxylase; Provisional	99.91
TIGR03301		355	PhnW-AepZ 2-aminoethylphosphonate aminotransferase	99.91
TIGR02539		370	SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation	99.91
PRK09331		387	Sep-tRNA:Cys-tRNA synthetase; Provisional	99.9
cd06451		356	AGAT_like Alanine-glyoxylate aminotransferase (AGA	99.9
PRK09295		406	bifunctional cysteine desulfurase/selenocysteine l	99.89
COG0520		405	csdA Selenocysteine lyase/Cysteine desulfurase [Po	99.89
TIGR02326		363	transamin_PhnW 2-aminoethylphosphonate--pyruvate t	99.89
TIGR01976		397	am_tr_V_VC1184 cysteine desulfurase family protein	99.89
TIGR01979		403	sufS cysteine desulfurases, SufS subfamily. This m	99.89
PRK13238		460	tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d	99.89
PLN02409		401	serine--glyoxylate aminotransaminase	99.88
PLN02368		407	alanine transaminase	99.88
PRK02948		381	cysteine desulfurase; Provisional	99.88
cd06453		373	SufS_like Cysteine desulfurase (SufS)-like. This f	99.88
TIGR03402		379	FeS_nifS cysteine desulfurase NifS. Members of thi	99.88
TIGR03812		373	tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe	99.87
PRK13479		368	2-aminoethylphosphonate--pyruvate transaminase; Pr	99.87
PLN02855		424	Bifunctional selenocysteine lyase/cysteine desulfu	99.87
KOG0256		471	consensus 1-aminocyclopropane-1-carboxylate syntha	99.87
TIGR01814		406	kynureninase kynureninase. This model describes ky	99.87
cd06452		361	SepCysS Sep-tRNA:Cys-tRNA synthase. This family be	99.87
TIGR01437		363	selA_rel uncharacterized pyridoxal phosphate-depen	99.86
cd00378		402	SHMT Serine-glycine hydroxymethyltransferase (SHMT	99.86
COG0075		383	Serine-pyruvate aminotransferase/archaeal aspartat	99.86
TIGR03403		382	nifS_epsilon cysteine desulfurase, NifS family, ep	99.85
COG2008		342	GLY1 Threonine aldolase [Amino acid transport and	99.85
cd06450		345	DOPA_deC_like DOPA decarboxylase family. This fami	99.84
KOG1357		519	consensus Serine palmitoyltransferase [Posttransla	99.84
PRK00011		416	glyA serine hydroxymethyltransferase; Reviewed	99.84
TIGR02006		402	IscS cysteine desulfurase IscS. This model represe	99.84
TIGR01977		376	am_tr_V_EF2568 cysteine desulfurase family protein	99.84
KOG0634		472	consensus Aromatic amino acid aminotransferase and	99.84
KOG1368		384	consensus Threonine aldolase [Amino acid transport	99.83
PF00266		371	Aminotran_5: Aminotransferase class-V; InterPro: I	99.82
TIGR02379		376	ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase	99.82
PRK13034		416	serine hydroxymethyltransferase; Reviewed	99.82
cd00614		369	CGS_like CGS_like: Cystathionine gamma-synthase is	99.81
cd00617		431	Tnase_like Tryptophanase family (Tnase). This fami	99.81
PLN02651		364	cysteine desulfurase	99.8
PLN02242		418	methionine gamma-lyase	99.8
PRK06767		386	methionine gamma-lyase; Provisional	99.8
COG3977		417	Alanine-alpha-ketoisovalerate (or valine-pyruvate)	99.8
PRK14012		404	cysteine desulfurase; Provisional	99.8
PRK11706		375	TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio	99.8
KOG2862		385	consensus Alanine-glyoxylate aminotransferase AGT1	99.79
KOG1358		467	consensus Serine palmitoyltransferase [Posttransla	99.79
TIGR03235		353	DNA_S_dndA cysteine desulfurase DndA. This model d	99.78
KOG0633		375	consensus Histidinol phosphate aminotransferase [A	99.78
PRK00451		447	glycine dehydrogenase subunit 1; Validated	99.78
PRK13580		493	serine hydroxymethyltransferase; Provisional	99.78
cd00616		352	AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa	99.77
PRK07810		403	O-succinylhomoserine sulfhydrylase; Provisional	99.77
PRK06234		400	methionine gamma-lyase; Provisional	99.77
TIGR01325		380	O_suc_HS_sulf O-succinylhomoserine sulfhydrylase.	99.76
PRK08247		366	cystathionine gamma-synthase; Reviewed	99.76
PRK08133		390	O-succinylhomoserine sulfhydrylase; Validated	99.76
PRK07504		398	O-succinylhomoserine sulfhydrylase; Reviewed	99.76
PRK08249		398	cystathionine gamma-synthase; Provisional	99.76
KOG1549		428	consensus Cysteine desulfurase NFS1 [Amino acid tr	99.76
TIGR02080		382	O_succ_thio_ly O-succinylhomoserine (thiol)-lyase.	99.75
TIGR01328		391	met_gam_lyase methionine gamma-lyase. This model d	99.75
PRK02769		380	histidine decarboxylase; Provisional	99.75
TIGR01324		377	cysta_beta_ly_B cystathionine beta-lyase, bacteria	99.75
PRK08045		386	cystathionine gamma-synthase; Provisional	99.75
PRK06460		376	hypothetical protein; Provisional	99.75
PRK07049		427	methionine gamma-lyase; Validated	99.75
PLN03226		475	serine hydroxymethyltransferase; Provisional	99.75
COG0399		374	WecE Predicted pyridoxal phosphate-dependent enzym	99.74
PLN03032		374	serine decarboxylase; Provisional	99.74
PTZ00094		452	serine hydroxymethyltransferase; Provisional	99.74
PRK11658		379	UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin	99.74
PRK05968		389	hypothetical protein; Provisional	99.73
PRK09028		394	cystathionine beta-lyase; Provisional	99.73
PRK07811		388	cystathionine gamma-synthase; Provisional	99.72
PRK07503		403	methionine gamma-lyase; Provisional	99.72
PRK08776		405	cystathionine gamma-synthase; Provisional	99.72
PRK07050		394	cystathionine beta-lyase; Provisional	99.72
PRK07582		366	cystathionine gamma-lyase; Validated	99.72
PRK08861		388	cystathionine gamma-synthase; Provisional	99.71
TIGR01788		431	Glu-decarb-GAD glutamate decarboxylase. This model	99.71
PRK07269		364	cystathionine gamma-synthase; Reviewed	99.7
PF01041		363	DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe	99.69
TIGR01329		378	cysta_beta_ly_E cystathionine beta-lyase, eukaryot	99.69
PRK06084		425	O-acetylhomoserine aminocarboxypropyltransferase;	99.69
PRK15407		438	lipopolysaccharide biosynthesis protein RfbH; Prov	99.69
PRK08574		385	cystathionine gamma-synthase; Provisional	99.68
TIGR01326		418	OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d	99.68
PLN02509		464	cystathionine beta-lyase	99.67
PLN02414		993	glycine dehydrogenase (decarboxylating)	99.67
PRK08248		431	O-acetylhomoserine aminocarboxypropyltransferase;	99.67
PRK05994		427	O-acetylhomoserine aminocarboxypropyltransferase;	99.67
PRK04366		481	glycine dehydrogenase subunit 2; Validated	99.67
PRK05967		395	cystathionine beta-lyase; Provisional	99.66
TIGR03588		380	PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin	99.66
cd00615		294	Orn_deC_like Ornithine decarboxylase family. This	99.66
PRK06702		432	O-acetylhomoserine aminocarboxypropyltransferase;	99.65
TIGR03531		444	selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr	99.65
PRK04311		464	selenocysteine synthase; Provisional	99.64
PRK05939		397	hypothetical protein; Provisional	99.64
PLN02263		470	serine decarboxylase	99.64
PRK03080		378	phosphoserine aminotransferase; Provisional	99.64
PRK08064		390	cystathionine beta-lyase; Provisional	99.63
PRK07671		377	cystathionine beta-lyase; Provisional	99.63
PRK06176		380	cystathionine gamma-synthase/cystathionine beta-ly	99.62
COG3844		407	Kynureninase [Amino acid transport and metabolism]	99.62
PRK08114		395	cystathionine beta-lyase; Provisional	99.62
PF01053		386	Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent	99.61
PRK08134		433	O-acetylhomoserine aminocarboxypropyltransferase;	99.61
PRK05355		360	3-phosphoserine/phosphohydroxythreonine aminotrans	99.6
PRK07812		436	O-acetylhomoserine aminocarboxypropyltransferase;	99.6
PLN02880		490	tyrosine decarboxylase	99.6
TIGR00461		939	gcvP glycine dehydrogenase (decarboxylating). This	99.59
TIGR03799		522	NOD_PanD_pyr putative pyridoxal-dependent aspartat	99.58
TIGR00474		454	selA seryl-tRNA(sec) selenium transferase. In bact	99.57
PRK05367		954	glycine dehydrogenase; Provisional	99.57
TIGR01364		349	serC_1 phosphoserine aminotransferase. This model	99.57
PLN02590		539	probable tyrosine decarboxylase	99.57
TIGR01366		361	serC_3 phosphoserine aminotransferase, putative. T	99.57
PRK12566		954	glycine dehydrogenase; Provisional	99.56
COG1103		382	Archaea-specific pyridoxal phosphate-dependent enz	99.56
PLN02724		805	Molybdenum cofactor sulfurase	99.56
cd00611		355	PSAT_like Phosphoserine aminotransferase (PSAT) fa	99.54
COG2873		426	MET17 O-acetylhomoserine sulfhydrylase [Amino acid	99.54
KOG0258		475	consensus Alanine aminotransferase [Amino acid tra	99.52
cd01494		170	AAT_I Aspartate aminotransferase (AAT) superfamily	99.52
TIGR02618		450	tyr_phenol_ly tyrosine phenol-lyase. This model de	99.51
PRK05613		437	O-acetylhomoserine aminocarboxypropyltransferase;	99.49
COG0626		396	MetC Cystathionine beta-lyases/cystathionine gamma	99.47
KOG0053		409	consensus Cystathionine beta-lyases/cystathionine	99.47
PLN02271		586	serine hydroxymethyltransferase	99.46
PRK13237		460	tyrosine phenol-lyase; Provisional	99.46
PLN02452		365	phosphoserine transaminase	99.44
COG1448		396	TyrB Aspartate/tyrosine/aromatic aminotransferase	99.43
PRK06434		384	cystathionine gamma-lyase; Validated	99.41
COG0076		460	GadB Glutamate decarboxylase and related PLP-depen	99.4
PRK15029		755	arginine decarboxylase; Provisional	99.39
PF01212		290	Beta_elim_lyase: Beta-eliminating lyase; InterPro:	99.38
COG1003		496	GcvP Glycine cleavage system protein P (pyridoxal-	99.38
COG0112		413	GlyA Glycine/serine hydroxymethyltransferase [Amin	99.37
PF01276		417	OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain;	99.33
PF12897		425	Aminotran_MocR: Alanine-glyoxylate amino-transfera	99.3
TIGR01365		374	serC_2 phosphoserine aminotransferase, Methanosarc	99.29
TIGR02617		467	tnaA_trp_ase tryptophanase, leader peptide-associa	99.27
PF00464		399	SHMT: Serine hydroxymethyltransferase; InterPro: I	99.25
PF00282		373	Pyridoxal_deC: Pyridoxal-dependent decarboxylase c	99.24
PLN02414		993	glycine dehydrogenase (decarboxylating)	99.23
PRK13578		720	ornithine decarboxylase; Provisional	99.19
PRK15399		713	lysine decarboxylase LdcC; Provisional	99.19
PRK15400		714	lysine decarboxylase CadA; Provisional	99.15
PRK05367		954	glycine dehydrogenase; Provisional	99.14
KOG3846		465	consensus L-kynurenine hydrolase [Amino acid trans	99.13
PRK12462		364	phosphoserine aminotransferase; Provisional	99.12
TIGR03811		608	tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu	99.03
KOG2040		1001	consensus Glycine dehydrogenase (decarboxylating)	99.01
COG1982		557	LdcC Arginine/lysine/ornithine decarboxylases [Ami	98.99
COG1921		395	SelA Selenocysteine synthase [seryl-tRNASer seleni	98.91
KOG1383		491	consensus Glutamate decarboxylase/sphingosine phos	98.8
COG0403		450	GcvP Glycine cleavage system protein P (pyridoxal-	98.77
PF03841		367	SelA: L-seryl-tRNA selenium transferase; InterPro:	98.72
COG3033		471	TnaA Tryptophanase [Amino acid transport and metab	98.69
KOG0629		510	consensus Glutamate decarboxylase and related prot	98.69
TIGR00461		939	gcvP glycine dehydrogenase (decarboxylating). This	98.64
PF05889		389	SLA_LP_auto_ag: Soluble liver antigen/liver pancre	98.64
PF06838		403	Met_gamma_lyase: Methionine gamma-lyase ; InterPro	98.63
PF04864		363	Alliinase_C: Allinase; InterPro: IPR006948 Allicin	98.62
KOG1412		410	consensus Aspartate aminotransferase/Glutamic oxal	98.54
KOG2467		477	consensus Glycine/serine hydroxymethyltransferase	98.49
PF02347		429	GDC-P: Glycine cleavage system P-protein; InterPro	98.39
KOG0628		511	consensus Aromatic-L-amino-acid/L-histidine decarb	98.34
KOG1411		427	consensus Aspartate aminotransferase/Glutamic oxal	98.23
COG4100		416	Cystathionine beta-lyase family protein involved i	97.96
COG1932		365	SerC Phosphoserine aminotransferase [Coenzyme meta	97.93
PRK12566		954	glycine dehydrogenase; Provisional	97.74
KOG3843		432	consensus Predicted serine hydroxymethyltransferas	97.31
PLN02994		153	1-aminocyclopropane-1-carboxylate synthase	97.2
KOG2040		1001	consensus Glycine dehydrogenase (decarboxylating)	88.55
KOG1465		353	consensus Translation initiation factor 2B, beta s	85.57

>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism]	Back alignment and domain information

Probab=100.00  E-value=2.4e-70  Score=491.64  Aligned_cols=411  Identities=59%  Similarity=1.024  Sum_probs=390.1

Q ss_pred             CCCCccCcccccccCCCCCeEEEeecCcEEEecCCCEEEeccCCccccccCCCcHHHHHHHHHHHHcCCCCCCCCHHHHH
Q 015230            1 MPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDIDGNEYIDYVGSWGPAIIGHADDQVLAALGETMKKGTSFGAPCLLENV   80 (411)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~g~~~~d~~~~~~~~~~g~~~~~v~~a~~~~l~~~~~~~~~~~~~~~   80 (411)
                      ||+||||++|.+.+.+..|+.+.+++|+++||.|||+|+||..+|++.-+||+||.|++|+.++++++..++.+++.+.+
T Consensus        18 ~pGGvnspvra~~~v~~~P~fi~~g~Ga~l~DvDGn~YIDy~~~~Gp~ilGH~~p~V~~Av~~~l~~G~~fg~Pte~Ei~   97 (432)
T COG0001          18 IPGGVNSPVRAFKSVGGYPIFIERGKGAYLTDVDGNEYIDYVLGWGPLILGHAHPAVVEAVQEQLERGLSFGAPTELEVE   97 (432)
T ss_pred             CCCCCCccccccCCCCCCCeeEEeccCCeEEeCCCCEeeehhccCcccccCCCCHHHHHHHHHHHHhcCCCCCCCHHHHH
Confidence            79999999999999988999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhCCCCCEEEEeCChHHHHHHHHHHHHhccCCcEEEEEeCCcCCCchhhhhhcCCCCcccCCCCCCCCCCCCCC
Q 015230           81 LAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTGRERIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPKGATY  160 (411)
Q Consensus        81 l~~~l~~~~~~~~~v~~~~~g~~a~~~al~~~~~~~~~~~vi~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  160 (411)
                      +++.+.+..+..+.|-|+||||||...||+++|.++++++|+.|+++|||+.+..+...|.+......|...+++.....
T Consensus        98 ~Aell~~~~p~~e~vrfvnSGTEAtmsAiRlARa~TgR~kIikF~G~YHG~~D~~lv~agsg~~t~g~p~s~Gvp~~~a~  177 (432)
T COG0001          98 LAELLIERVPSIEKVRFVNSGTEATMSAIRLARAYTGRDKIIKFEGCYHGHSDSLLVKAGSGAATLGSPSSPGVPADVAK  177 (432)
T ss_pred             HHHHHHHhcCcccEEEEecchhHHHHHHHHHHHHhhCCCeEEEEcCCCCCCccHHHhhcCcCcccCCCCCCCCCChhhhc
Confidence            99999999998899999999999999999999999999999999999999999999988887777777889999988899


Q ss_pred             ceeecCCCCHHHHHHHHHcCCCcEEEEEEcccCCCCCccCCCHHHHHHHHHHHHHhCCEEEEeccccccccccCcccccc
Q 015230          161 ETLTAPFNDVSALENLFENNKGEIAAIILEPVVGNSGFIAPKPDFLNAIRRITKENGALLIFDEVMTGFRLAYGGAQEYF  240 (411)
Q Consensus       161 ~~~~~~~~d~~~l~~~~~~~~~~~~~vi~~~~~~~~G~~~~~~~~l~~i~~l~~~~~~~li~De~~~g~~~g~~~~~~~~  240 (411)
                      .+..+|+||++.+++++++.++++++||+||+.++.|.+.|+++|++.|+++|++||++||.||+.+|||.....+++.+
T Consensus       178 ~ti~~~yND~~al~~~~~~~g~~IAaVIvEPv~gn~g~i~p~~~Fl~~Lr~lt~e~G~lLI~DEViTGFR~~~gGaq~~~  257 (432)
T COG0001         178 HTLVLPYNDLEALEEAFEEYGDDIAAVIVEPVAGNMGVVPPEPGFLEGLRELTEEHGALLIFDEVITGFRVALGGAQGYY  257 (432)
T ss_pred             cEEEecCCCHHHHHHHHHHcCCcEEEEEeccccCCCCCCCCCHHHHHHHHHHHHHcCcEEEEecchhhcccCCccccccc
Confidence            99999999999999999998889999999999999999999999999999999999999999999999977766788899


Q ss_pred             CCCcchhhhhhhccCCcccccccccHHHHHHhcCCCCcccccCCCCCHHHHHHHHHHHHHHhc-CChHHHHHHHHHHHHH
Q 015230          241 GVTPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLKE-PGTYEYLNKITGELTQ  319 (411)
Q Consensus       241 ~~~~d~~~~sK~~~~G~~~g~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~a~~~~~l~~~~~-~~~~~~~~~~~~~~~~  319 (411)
                      ++.||+.|++|.++||+|+|.+.+++++++.+.+..+.++.+|+++||++++++.+.++.+.. +...+++.+..+++++
T Consensus       258 gi~PDlttlGKiIGGGlP~ga~gGr~eiM~~~~p~g~vyqaGT~sgnplamaAG~atl~~l~~~~~~y~~l~~~~~~L~~  337 (432)
T COG0001         258 GVEPDLTTLGKIIGGGLPIGAFGGRAEIMEQLAPLGPVYQAGTLSGNPLAMAAGLATLEELMTEEGVYERLDALGERLAE  337 (432)
T ss_pred             CcCcchhhhhhhhcCCcceeeeccHHHHHhhhCCCCCccccCCCCCcHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999888889999999999999999999999887 5689999999999999


Q ss_pred             HHHHHHHhcCCceEEeeecceEEEEEecCCCCCcchhcccchHHHHHHHHHHHHcCeEeccCCCcceeeecCCCHHHHHH
Q 015230          320 GIIDAGKKAGHAICGGYISGMFGFFFTEGPVYNFEDAKKSETTKFARFYRGMLEEGVYFAPSQFEAGFTSLAHSSDDIQH  399 (411)
Q Consensus       320 ~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gi~v~~~~~~~~~~~~~~t~~~i~~  399 (411)
                      .|++...++++...+...|.++.+.+......++..+...+.+...++.+.|.++||++.|+.+....++..+|+++|++
T Consensus       338 gl~~~~~~~g~~~~v~~~gsm~~i~F~~~~~~n~~da~~sd~~~~~~~~~~~l~~GV~l~ps~~ea~flS~ahte~di~~  417 (432)
T COG0001         338 GLRAAAERHGIPLTVNRVGSMFGIFFTEEGVRNYADAKRSDVERFAKFFHHLLNRGVYLAPSQFEAGFLSTAHTEEDIDR  417 (432)
T ss_pred             HHHHHHHHhCCCeEEeeecceEEEEecCCCCCCHHHHHhhchHHHHHHHHHHHhCCcccCCccccceeeecccCHHHHHH
Confidence            99999999999999999999999999887788888888777777888888999999999999887889999999999999


Q ss_pred             HHHHHHHHHHhC
Q 015230          400 TITAAEKVLRQI  411 (411)
Q Consensus       400 ~i~~l~~~~~~~  411 (411)
                      .+++++++++++
T Consensus       418 ~~~a~~~~~~~~  429 (432)
T COG0001         418 TLEAADEAFKEL  429 (432)
T ss_pred             HHHHHHHHHHHh
Confidence            999999988763

>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase	Back alignment and domain information

>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional	Back alignment and domain information

>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional	Back alignment and domain information

>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism]	Back alignment and domain information

>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase	Back alignment and domain information

>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional	Back alignment and domain information

>PRK07046 aminotransferase; Validated	Back alignment and domain information

>PRK06062 hypothetical protein; Provisional	Back alignment and domain information

>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>PRK05965 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03372 putres_am_tran putrescine aminotransferase	Back alignment and domain information

>PRK07481 hypothetical protein; Provisional	Back alignment and domain information

>PRK07678 aminotransferase; Validated	Back alignment and domain information

>PRK07482 hypothetical protein; Provisional	Back alignment and domain information

>PLN02760 4-aminobutyrate:pyruvate transaminase	Back alignment and domain information

>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>PRK06058 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK07483 hypothetical protein; Provisional	Back alignment and domain information

>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>PRK07495 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>PRK08593 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>PRK04612 argD acetylornithine transaminase protein; Provisional	Back alignment and domain information

>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases	Back alignment and domain information

>PRK06541 hypothetical protein; Provisional	Back alignment and domain information

>PRK06105 aminotransferase; Provisional	Back alignment and domain information

>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated	Back alignment and domain information

>PRK07480 putative aminotransferase; Validated	Back alignment and domain information

>PRK07036 hypothetical protein; Provisional	Back alignment and domain information

>PRK05639 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK06917 hypothetical protein; Provisional	Back alignment and domain information

>PRK12403 putative aminotransferase; Provisional	Back alignment and domain information

>TIGR03246 arg_catab_astC succinylornithine transaminase family	Back alignment and domain information

>PRK06777 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK13360 omega amino acid--pyruvate transaminase; Provisional	Back alignment and domain information

>PRK08117 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK09792 4-aminobutyrate transaminase; Provisional	Back alignment and domain information

>PRK08360 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK09221 beta alanine--pyruvate transaminase; Provisional	Back alignment and domain information

>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type	Back alignment and domain information

>PRK05769 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06082 4-aminobutyrate aminotransferase; Provisional	Back alignment and domain information

>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional	Back alignment and domain information

>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>PRK03715 argD acetylornithine transaminase protein; Provisional	Back alignment and domain information

>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional	Back alignment and domain information

>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase	Back alignment and domain information

>PLN00144 acetylornithine transaminase	Back alignment and domain information

>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional	Back alignment and domain information

>PRK06918 4-aminobutyrate aminotransferase; Reviewed	Back alignment and domain information

>PRK06148 hypothetical protein; Provisional	Back alignment and domain information

>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated	Back alignment and domain information

>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional	Back alignment and domain information

>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type	Back alignment and domain information

>PRK01278 argD acetylornithine transaminase protein; Provisional	Back alignment and domain information

>PRK08297 L-lysine aminotransferase; Provisional	Back alignment and domain information

>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed	Back alignment and domain information

>PLN02624 ornithine-delta-aminotransferase	Back alignment and domain information

>PRK06149 hypothetical protein; Provisional	Back alignment and domain information

>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional	Back alignment and domain information

>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase	Back alignment and domain information

>PRK02936 argD acetylornithine aminotransferase; Provisional	Back alignment and domain information

>PRK03244 argD acetylornithine aminotransferase; Provisional	Back alignment and domain information

>TIGR03251 LAT_fam L-lysine 6-transaminase	Back alignment and domain information

>PRK08088 4-aminobutyrate aminotransferase; Validated	Back alignment and domain information

>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue	Back alignment and domain information

>cd00610 OAT_like Acetyl ornithine aminotransferase family	Back alignment and domain information

>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase	Back alignment and domain information

>PRK02627 acetylornithine aminotransferase; Provisional	Back alignment and domain information

>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only]	Back alignment and domain information

>TIGR01885 Orn_aminotrans ornithine aminotransferase	Back alignment and domain information

>PTZ00125 ornithine aminotransferase-like protein; Provisional	Back alignment and domain information

>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed	Back alignment and domain information

>PRK04260 acetylornithine aminotransferase; Provisional	Back alignment and domain information

>TIGR00707 argD acetylornithine and succinylornithine aminotransferases	Back alignment and domain information

>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02822 serine palmitoyltransferase	Back alignment and domain information

>PRK07505 hypothetical protein; Provisional	Back alignment and domain information

>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>PLN02955 8-amino-7-oxononanoate synthase	Back alignment and domain information

>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase	Back alignment and domain information

>PRK13393 5-aminolevulinate synthase; Provisional	Back alignment and domain information

>PRK09064 5-aminolevulinate synthase; Validated	Back alignment and domain information

>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase	Back alignment and domain information

>PRK05958 8-amino-7-oxononanoate synthase; Reviewed	Back alignment and domain information

>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional	Back alignment and domain information

>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative	Back alignment and domain information

>PRK07179 hypothetical protein; Provisional	Back alignment and domain information

>PLN03227 serine palmitoyltransferase-like protein; Provisional	Back alignment and domain information

>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13392 5-aminolevulinate synthase; Provisional	Back alignment and domain information

>TIGR00858 bioF 8-amino-7-oxononanoate synthase	Back alignment and domain information

>PRK07682 hypothetical protein; Validated	Back alignment and domain information

>PRK07681 aspartate aminotransferase; Provisional	Back alignment and domain information

>PLN00175 aminotransferase family protein; Provisional	Back alignment and domain information

>PRK06225 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK07366 succinyldiaminopimelate transaminase; Validated	Back alignment and domain information

>PRK06207 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK03317 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK08068 transaminase; Reviewed	Back alignment and domain information

>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02483 serine palmitoyltransferase	Back alignment and domain information

>PRK15481 transcriptional regulatory protein PtsJ; Provisional	Back alignment and domain information

>PRK07324 transaminase; Validated	Back alignment and domain information

>PRK06290 aspartate aminotransferase; Provisional	Back alignment and domain information

>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK09276 LL-diaminopimelate aminotransferase; Provisional	Back alignment and domain information

>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08636 aspartate aminotransferase; Provisional	Back alignment and domain information

>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase	Back alignment and domain information

>PRK05942 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK08960 hypothetical protein; Provisional	Back alignment and domain information

>PRK06108 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK09147 succinyldiaminopimelate transaminase; Provisional	Back alignment and domain information

>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional	Back alignment and domain information

>PRK06348 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK09148 aminotransferase; Validated	Back alignment and domain information

>PRK07309 aromatic amino acid aminotransferase; Validated	Back alignment and domain information

>PRK06855 aminotransferase; Validated	Back alignment and domain information

>PRK08175 aminotransferase; Validated	Back alignment and domain information

>PRK12414 putative aminotransferase; Provisional	Back alignment and domain information

>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism]	Back alignment and domain information

>PLN02187 rooty/superroot1	Back alignment and domain information

>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional	Back alignment and domain information

>TIGR03537 DapC succinyldiaminopimelate transaminase	Back alignment and domain information

>PRK01533 histidinol-phosphate aminotransferase; Validated	Back alignment and domain information

>PRK07683 aminotransferase A; Validated	Back alignment and domain information

>PRK09082 methionine aminotransferase; Validated	Back alignment and domain information

>PLN02656 tyrosine transaminase	Back alignment and domain information

>PRK08363 alanine aminotransferase; Validated	Back alignment and domain information

>PRK05957 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK02731 histidinol-phosphate aminotransferase; Validated	Back alignment and domain information

>PRK08912 hypothetical protein; Provisional	Back alignment and domain information

>PRK14809 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism]	Back alignment and domain information

>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional	Back alignment and domain information

>PRK03158 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK00950 histidinol-phosphate aminotransferase; Validated	Back alignment and domain information

>PRK14807 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK06107 aspartate aminotransferase; Provisional	Back alignment and domain information

>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase	Back alignment and domain information

>PRK08361 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK05839 hypothetical protein; Provisional	Back alignment and domain information

>PRK02610 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK05937 8-amino-7-oxononanoate synthase; Provisional	Back alignment and domain information

>PLN03026 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I)	Back alignment and domain information

>PRK07777 aminotransferase; Validated	Back alignment and domain information

>PRK08153 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>TIGR01141 hisC histidinol-phosphate aminotransferase	Back alignment and domain information

>PRK05764 aspartate aminotransferase; Provisional	Back alignment and domain information

>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic	Back alignment and domain information

>PRK07550 hypothetical protein; Provisional	Back alignment and domain information

>PRK08056 threonine-phosphate decarboxylase; Provisional	Back alignment and domain information

>PTZ00433 tyrosine aminotransferase; Provisional	Back alignment and domain information

>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed	Back alignment and domain information

>PRK09265 aminotransferase AlaT; Validated	Back alignment and domain information

>PRK06358 threonine-phosphate decarboxylase; Provisional	Back alignment and domain information

>PRK07337 aminotransferase; Validated	Back alignment and domain information

>PRK07590 L,L-diaminopimelate aminotransferase; Validated	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>PTZ00377 alanine aminotransferase; Provisional	Back alignment and domain information

>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family	Back alignment and domain information

>PRK04870 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PLN02450 1-aminocyclopropane-1-carboxylate synthase	Back alignment and domain information

>TIGR03539 DapC_actino succinyldiaminopimelate transaminase	Back alignment and domain information

>PRK05387 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK05664 threonine-phosphate decarboxylase; Reviewed	Back alignment and domain information

>PRK09257 aromatic amino acid aminotransferase; Provisional	Back alignment and domain information

>PRK06959 putative threonine-phosphate decarboxylase; Provisional	Back alignment and domain information

>PRK06425 histidinol-phosphate aminotransferase; Validated	Back alignment and domain information

>PRK03321 putative aminotransferase; Provisional	Back alignment and domain information

>PTZ00376 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK06836 aspartate aminotransferase; Provisional	Back alignment and domain information

>PLN02376 1-aminocyclopropane-1-carboxylate synthase	Back alignment and domain information

>PRK09440 avtA valine--pyruvate transaminase; Provisional	Back alignment and domain information

>PRK09105 putative aminotransferase; Provisional	Back alignment and domain information

>PRK14808 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PLN02607 1-aminocyclopropane-1-carboxylate synthase	Back alignment and domain information

>PRK07568 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK03967 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK07392 threonine-phosphate decarboxylase; Validated	Back alignment and domain information

>PRK01688 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases	Back alignment and domain information

>PRK05166 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase	Back alignment and domain information

>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue	Back alignment and domain information

>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase	Back alignment and domain information

>PRK08354 putative aminotransferase; Provisional	Back alignment and domain information

>PLN02231 alanine transaminase	Back alignment and domain information

>PRK07908 hypothetical protein; Provisional	Back alignment and domain information

>PLN02721 threonine aldolase	Back alignment and domain information

>PRK04781 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>PRK09275 aspartate aminotransferase; Provisional	Back alignment and domain information

>PRK04635 histidinol-phosphate aminotransferase; Provisional	Back alignment and domain information

>cd00609 AAT_like Aspartate aminotransferase family	Back alignment and domain information

>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA	Back alignment and domain information

>PLN02397 aspartate transaminase	Back alignment and domain information

>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits	Back alignment and domain information

>cd06502 TA_like Low-specificity threonine aldolase (TA)	Back alignment and domain information

>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase	Back alignment and domain information

>PRK10874 cysteine sulfinate desulfinase; Provisional	Back alignment and domain information

>PRK10534 L-threonine aldolase; Provisional	Back alignment and domain information

>PRK08637 hypothetical protein; Provisional	Back alignment and domain information

>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13520 L-tyrosine decarboxylase; Provisional	Back alignment and domain information

>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase	Back alignment and domain information

>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase	Back alignment and domain information

>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional	Back alignment and domain information

>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family	Back alignment and domain information

>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated	Back alignment and domain information

>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase	Back alignment and domain information

>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily	Back alignment and domain information

>TIGR01979 sufS cysteine desulfurases, SufS subfamily	Back alignment and domain information

>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional	Back alignment and domain information

>PLN02409 serine--glyoxylate aminotransaminase	Back alignment and domain information

>PLN02368 alanine transaminase	Back alignment and domain information

>PRK02948 cysteine desulfurase; Provisional	Back alignment and domain information

>cd06453 SufS_like Cysteine desulfurase (SufS)-like	Back alignment and domain information

>TIGR03402 FeS_nifS cysteine desulfurase NifS	Back alignment and domain information

>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA	Back alignment and domain information

>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional	Back alignment and domain information

>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase	Back alignment and domain information

>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01814 kynureninase kynureninase	Back alignment and domain information

>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase	Back alignment and domain information

>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme	Back alignment and domain information

>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT)	Back alignment and domain information

>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type	Back alignment and domain information

>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism]	Back alignment and domain information

>cd06450 DOPA_deC_like DOPA decarboxylase family	Back alignment and domain information

>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00011 glyA serine hydroxymethyltransferase; Reviewed	Back alignment and domain information

>TIGR02006 IscS cysteine desulfurase IscS	Back alignment and domain information

>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein	Back alignment and domain information

>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism]	Back alignment and domain information

>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue	Back alignment and domain information

>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase	Back alignment and domain information

>PRK13034 serine hydroxymethyltransferase; Reviewed	Back alignment and domain information

>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis	Back alignment and domain information

>cd00617 Tnase_like Tryptophanase family (Tnase)	Back alignment and domain information

>PLN02651 cysteine desulfurase	Back alignment and domain information

>PLN02242 methionine gamma-lyase	Back alignment and domain information

>PRK06767 methionine gamma-lyase; Provisional	Back alignment and domain information

>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14012 cysteine desulfurase; Provisional	Back alignment and domain information

>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional	Back alignment and domain information

>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only]	Back alignment and domain information

>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03235 DNA_S_dndA cysteine desulfurase DndA	Back alignment and domain information

>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00451 glycine dehydrogenase subunit 1; Validated	Back alignment and domain information

>PRK13580 serine hydroxymethyltransferase; Provisional	Back alignment and domain information

>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn)	Back alignment and domain information

>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional	Back alignment and domain information

>PRK06234 methionine gamma-lyase; Provisional	Back alignment and domain information

>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase	Back alignment and domain information

>PRK08247 cystathionine gamma-synthase; Reviewed	Back alignment and domain information

>PRK08133 O-succinylhomoserine sulfhydrylase; Validated	Back alignment and domain information

>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed	Back alignment and domain information

>PRK08249 cystathionine gamma-synthase; Provisional	Back alignment and domain information

>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase	Back alignment and domain information

>TIGR01328 met_gam_lyase methionine gamma-lyase	Back alignment and domain information

>PRK02769 histidine decarboxylase; Provisional	Back alignment and domain information

>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial	Back alignment and domain information

>PRK08045 cystathionine gamma-synthase; Provisional	Back alignment and domain information

>PRK06460 hypothetical protein; Provisional	Back alignment and domain information

>PRK07049 methionine gamma-lyase; Validated	Back alignment and domain information

>PLN03226 serine hydroxymethyltransferase; Provisional	Back alignment and domain information

>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN03032 serine decarboxylase; Provisional	Back alignment and domain information

>PTZ00094 serine hydroxymethyltransferase; Provisional	Back alignment and domain information

>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional	Back alignment and domain information

>PRK05968 hypothetical protein; Provisional	Back alignment and domain information

>PRK09028 cystathionine beta-lyase; Provisional	Back alignment and domain information

>PRK07811 cystathionine gamma-synthase; Provisional	Back alignment and domain information

>PRK07503 methionine gamma-lyase; Provisional	Back alignment and domain information

>PRK08776 cystathionine gamma-synthase; Provisional	Back alignment and domain information

>PRK07050 cystathionine beta-lyase; Provisional	Back alignment and domain information

>PRK07582 cystathionine gamma-lyase; Validated	Back alignment and domain information

>PRK08861 cystathionine gamma-synthase; Provisional	Back alignment and domain information

>TIGR01788 Glu-decarb-GAD glutamate decarboxylase	Back alignment and domain information

>PRK07269 cystathionine gamma-synthase; Reviewed	Back alignment and domain information

>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions	Back alignment and domain information

>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic	Back alignment and domain information

>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional	Back alignment and domain information

>PRK08574 cystathionine gamma-synthase; Provisional	Back alignment and domain information

>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase	Back alignment and domain information

>PLN02509 cystathionine beta-lyase	Back alignment and domain information

>PLN02414 glycine dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>PRK04366 glycine dehydrogenase subunit 2; Validated	Back alignment and domain information

>PRK05967 cystathionine beta-lyase; Provisional	Back alignment and domain information

>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase	Back alignment and domain information

>cd00615 Orn_deC_like Ornithine decarboxylase family	Back alignment and domain information

>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase	Back alignment and domain information

>PRK04311 selenocysteine synthase; Provisional	Back alignment and domain information

>PRK05939 hypothetical protein; Provisional	Back alignment and domain information

>PLN02263 serine decarboxylase	Back alignment and domain information

>PRK03080 phosphoserine aminotransferase; Provisional	Back alignment and domain information

>PRK08064 cystathionine beta-lyase; Provisional	Back alignment and domain information

>PRK07671 cystathionine beta-lyase; Provisional	Back alignment and domain information

>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated	Back alignment and domain information

>COG3844 Kynureninase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK08114 cystathionine beta-lyase; Provisional	Back alignment and domain information

>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal)	Back alignment and domain information

>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional	Back alignment and domain information

>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>PLN02880 tyrosine decarboxylase	Back alignment and domain information

>TIGR00461 gcvP glycine dehydrogenase (decarboxylating)	Back alignment and domain information

>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase	Back alignment and domain information

>TIGR00474 selA seryl-tRNA(sec) selenium transferase	Back alignment and domain information

>PRK05367 glycine dehydrogenase; Provisional	Back alignment and domain information

>TIGR01364 serC_1 phosphoserine aminotransferase	Back alignment and domain information

>PLN02590 probable tyrosine decarboxylase	Back alignment and domain information

>TIGR01366 serC_3 phosphoserine aminotransferase, putative	Back alignment and domain information

>PRK12566 glycine dehydrogenase; Provisional	Back alignment and domain information

>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only]	Back alignment and domain information

>PLN02724 Molybdenum cofactor sulfurase	Back alignment and domain information

>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family	Back alignment and domain information

>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes	Back alignment and domain information

>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase	Back alignment and domain information

>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated	Back alignment and domain information

>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02271 serine hydroxymethyltransferase	Back alignment and domain information

>PRK13237 tyrosine phenol-lyase; Provisional	Back alignment and domain information

>PLN02452 phosphoserine transaminase	Back alignment and domain information

>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06434 cystathionine gamma-lyase; Validated	Back alignment and domain information

>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PRK15029 arginine decarboxylase; Provisional	Back alignment and domain information

>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases	Back alignment and domain information

>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism]	Back alignment and domain information

>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates []	Back alignment and domain information

>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases	Back alignment and domain information

>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type	Back alignment and domain information

>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated	Back alignment and domain information

>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) []	Back alignment and domain information

>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal)	Back alignment and domain information

>PLN02414 glycine dehydrogenase (decarboxylating)	Back alignment and domain information

>PRK13578 ornithine decarboxylase; Provisional	Back alignment and domain information

>PRK15399 lysine decarboxylase LdcC; Provisional	Back alignment and domain information

>PRK15400 lysine decarboxylase CadA; Provisional	Back alignment and domain information

>PRK05367 glycine dehydrogenase; Provisional	Back alignment and domain information

>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12462 phosphoserine aminotransferase; Provisional	Back alignment and domain information

>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type	Back alignment and domain information

>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism]	Back alignment and domain information

>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism]	Back alignment and domain information

>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism]	Back alignment and domain information

>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism]	Back alignment and domain information

>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor	Back alignment and domain information

>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00461 gcvP glycine dehydrogenase (decarboxylating)	Back alignment and domain information

>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen)	Back alignment and domain information

>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria []	Back alignment and domain information

>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species	Back alignment and domain information

>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1	Back alignment and domain information

>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism]	Back alignment and domain information

>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism]	Back alignment and domain information

>PRK12566 glycine dehydrogenase; Provisional	Back alignment and domain information

>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02994 1-aminocyclopropane-1-carboxylate synthase	Back alignment and domain information

>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism]	Back alignment and domain information

>KOG1465 consensus Translation initiation factor 2B, beta subunit (eIF-2Bbeta/GCD7) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		411
2gsa_A		432	Crystal Structure Of Glutamate-1-Semialdehyde Amino		1e-175
2hoy_A		432	Inter-Subunit Signaling In Gsam Length = 432		1e-174
3fq7_A		427	Gabaculine Complex Of Gsam Length = 427		1e-174
3fqa_A		427	Gabaculien Complex Of Gabaculine Resistant Gsam Ver		1e-174
2cfb_A		411	Glutamate-1-Semialdehyde 2,1-Aminomutase From Therm		1e-174
3fq8_A		427	M248i Mutant Of Gsam Length = 427		1e-174
3bs8_A		438	Crystal Structure Of Glutamate 1-Semialdehyde Amino		1e-131
3k28_A		429	Crystal Structure Of A Glutamate-1-Semialdehyde Ami		1e-118
2e7u_A		424	Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A		1e-117
4e77_A		429	2.0a Crystal Structure Of A Glutamate-1-Semialdehyd		1e-116
3l44_A		434	Crystal Structure Of Bacillus Anthracis Heml-1, Glu		1e-104
2epj_A		434	Crystal Structure Of Glutamate-1-Semialdehyde 2,1-A		7e-83
4ao9_A		454	Biochemical Properties And Crystal Structure Of A N		2e-45
2yku_A		465	Structural Determinants Of The Beta-Selectivity Of		2e-44
2cy8_A		453	Crystal Structure Of D-Phenylglycine Aminotransfera		8e-42
1szk_A		426	The Structure Of Gamma-Aminobutyrate Aminotransfera		1e-31
1szs_A		426	The Structure Of Gamma-aminobutyrate Aminotransfera		1e-31
1sf2_A		426	Structure Of E. Coli Gamma-Aminobutyrate Aminotrans		1e-31
1szu_A		426	The Structure Of Gamma-Aminobutyrate Aminotransfera		4e-31
1vef_A		395	Acetylornithine Aminotransferase From Thermus Therm		2e-30
2eh6_A		375	Crystal Structure Of Acetylornithine Aminotransfera		2e-24
2pb0_A		420	Structure Of Biosynthetic N-Acetylornithine Aminotr		5e-23
4adb_A		406	Structural And Functional Study Of Succinyl-ornithi		1e-22
2e54_A		385	Crystal Structure Of Acetylornithine Aminotransfera		1e-20
2ord_A		397	Crystal Structure Of Acetylornithine Aminotransfera		1e-20
1oat_A		439	Ornithine Aminotransferase Length = 439		5e-20
2can_A		402	Human Ornithine Aminotransferase Complexed With L-C		6e-20
2byj_A		439	Ornithine Aminotransferase Mutant Y85i Length = 439		2e-19
3r4t_A		467	Crystal Structure Of 4-Aminobutyrate Aminotransfera		2e-19
1m0n_A		433	Structure Of Dialkylglycine Decarboxylase Complexed		3e-19
2byl_A		439	Structure Of Ornithine Aminotransferase Triple Muta		3e-19
1z3z_A		431	The Crystal Structure Of A Dgd Mutant: Q52a Length		3e-19
1dgd_A		432	An Alkali Metal Ion Size-Dependent Switch In The Ac		8e-19
1d7r_A		433	Crystal Structure Of The Complex Of 2,2-Dialkylglyc		1e-18
3q8n_A		453	Crystal Structure Of 4-Aminobutyrate Transaminase F		3e-18
4atp_A		456	Structure Of Gaba-Transaminase A1r958 From Arthroba		3e-17
4ffc_A		453	Crystal Structure Of A 4-Aminobutyrate Aminotransfe		4e-17
2eo5_A		419	Crystal Structure Of 4-Aminobutyrate Aminotransfera		2e-16
3oks_A		451	Crystal Structure Of 4-Aminobutyrate Transaminase F		9e-16
1mgv_A		429	Crystal Structure Of The R391a Mutant Of 7,8-Diamin		2e-15
3nx3_A		395	Crystal Structure Of Acetylornithine Aminotransfera		2e-15
3ruy_A		392	Crystal Structure Of The Ornithine-Oxo Acid Transam		3e-15
3lg0_A		422	Structure Of Plasmodium Falciparum Ornithine Delta-		3e-15
1z7d_A		433	Ornithine Aminotransferase Py00104 From Plasmodium		6e-15
1qj3_A		429	Crystal Structure Of 7,8-Diaminopelargonic Acid Syn		6e-15
1s0a_A		429	Crystal Structure Of The Y17f Mutant Of 7,8- Diamin		9e-15
1dty_A		429	Crystal Structure Of Adenosylmethionine-8-Amino-7-O		1e-14
1s08_A		429	Crystal Structure Of The D147n Mutant Of 7,8- Diami		2e-14
3bv0_A		437	Crystal Structure Of Plp Bound 7,8-Diaminopelargoni		2e-14
3lv2_A		462	Crystal Structure Of Mycobacterium Tuberculosis 7,8		2e-14
3tft_A		457	Crystal Structure Of 7,8-Diaminopelargonic Acid Syn		2e-14
1s06_A		429	Crystal Structure Of The R253k Mutant Of 7,8- Diami		3e-14
1s09_A		429	Crystal Structure Of The Y144f Mutant Of 7,8- Diami		3e-14
1s07_A		429	Crystal Structure Of The R253a Mutant Of 7,8-Diamin		3e-14
3dxw_A		452	The Crystal Structure Of Alpha-Amino-Epsilon-Caprol		5e-12
2zuk_A		439	The Crystal Structure Of Alpha-Amino-Epsilon-Caprol		5e-12
3a8u_X		449	Crystal Structure Of Omega-Amino Acid:pyruvate Amin		4e-11
4a6r_A		459	Crystal Structure Of The Omega Transaminase From Ch		4e-10
3du4_A		448	Crystal Structure Of 7-Keto-8-Aminopelargonic Acid		8e-10
3dod_A		448	Crystal Structure Of Plp Bound 7,8-diaminopelargoni		1e-09
3i4j_A		430	Crystal Structure Of Aminotransferase, Class Iii Fr		1e-09
3n5m_A		452	Crystals Structure Of A Bacillus Anthracis Aminotra		6e-09
3fcr_A		459	Crystal Structure Of Putative Aminotransferase (Yp_		5e-08
3gju_A		459	Crystal Structure Of A Putative Aminotransferase (M		2e-07
2jjf_A		449	N328a Mutant Of M. Tuberculosis Rv3290c Length = 44		6e-07
2cin_A		449	Lysine Aminotransferase From M. Tuberculosis In The		3e-06
2jjh_A		449	E243 Mutant Of M. Tuberculosis Rv3290c Length = 449		4e-06
2jje_A		449	Crystal Structure Of T330s Mutant Of Rv3290c From M		6e-06
3hmu_A		472	Crystal Structure Of A Class Iii Aminotransferase F		2e-05
3i5t_A		476	Crystal Structure Of Aminotransferase Prk07036 From		2e-05
1ohv_A		472	4-aminobutyrate-aminotransferase From Pig Length =		1e-04

>pdb|2GSA|A Chain A, Crystal Structure Of Glutamate-1-Semialdehyde Aminomutase (Aminotransferase, Wild-Type Form) Length = 432