Citrus Sinensis ID: 017159

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370------
MFDGSISMSLQTPNCPPFFLSTVYINKTLSRTRPILSAVVQSSSLLGQSHESGSLHESRKFPGSAAASLLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTLLLDSQSSAKQCPREQSSALLQFKQLWKILFSVVVERIIPTQR
ccccccccccccccccccccccEEEccccccccccccEEccccccccccccccccccccccccccHHHHHHccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccccccccHHHHHHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc
cccccEEEEcccccccccccccccccHHHHcccccHEEccccccEEEEEccccccccccccccHHHHHHcccccHHHHHHHHHHEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEEccccccccEEEEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccEcccccccEEEEEccHHcHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEcccHHHEEcccccccccccccHHHHHHHHHHHHHHccccccccHcHHccHccccHHHHHHHHHHHHHHHHHHHHHHHHEccccc
mfdgsismslqtpncppffLSTVYINKTLSRTRPILSAVVQsssllgqshesgslhesrkfpgsaAASLlrskspdsllnqANTIGIIGGVSVSSTLNFLGKLVWysakdaeecppfvvcndpalneELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGArcivmpchishawhgdvsegcsipflHVGECVAKELKEaklkpleagsgvriGVLATDATLSAGFYQEKLqnqgfevvlpdkatmehvIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIigsdemqgvlpkddpllkkcidpmdALARSTVTWARSNKKLTLLLDsqssakqcpreQSSALLQFKQLWKILFSVVVERIIPTQR
mfdgsismslqtpncppFFLSTVYINKTLSRTRPILSAVVQSSSLLGQShesgslhesrkFPGSAAASLLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAklkpleagsgvrIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIigsdemqgvlpkDDPLLKKCIDPMDALARSTVTWARSNKKLTLLLDSQSSAKQCPREQSSALLQFKQLWKILFSVVVERIIPTQR
MFDGSISMSLQTPNCPPFFLSTVYINKTLSRTRPILSAVVQSSSLLGQSHESGSLHESRKFPGSAAASLLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVakelkeaklkpleaGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTLLLDSQSSAKQCPREQSSALLQFKQLWKILFSVVVERIIPTQR
*************NCPPFFLSTVYINKTLSRTRPILSAVV***************************************NQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTLLL***************ALLQFKQLWKILFSVVVERII****
********SLQTPNCPPFFLSTVYINKTLSR**************LGQSHESG******************************TIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKK**********************LQFKQLWKILFSVVVERIIPT**
*********LQTPNCPPFFLSTVYINKTLSRTRPILSAVVQS**************************LLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTLLLD*************SALLQFKQLWKILFSVVVERIIPTQR
*FDGSISMSLQTPNCPPFFLSTVYINKTLSRTRPILSAVVQSSSLLGQSHESGSLHES*K*P***AASLLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTLLLDSQSSAKQCPREQSSALLQFKQLWKILFSVVVERIIPT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDGSISMSLQTPNCPPFFLSTVYINKTLSRTRPILSAVVQSSSLLGQSHESGSLHESRKFPGSAAASLLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTLLLDSQSSAKQCPREQSSALLQFKQLWKILFSVVVERIIPTQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query376 2.2.26 [Sep-21-2011]
P29079243 Aspartate racemase OS=Ent yes no 0.412 0.637 0.255 4e-08
P32968150 Uncharacterized protein i N/A no 0.359 0.9 0.268 1e-07
H8L901243 Aspartate racemase OS=Ent N/A no 0.401 0.621 0.25 2e-07
P32960227 Probable amino-acid racem yes no 0.367 0.607 0.279 2e-07
>sp|P29079|RACD_ENTFC Aspartate racemase OS=Enterococcus faecium PE=1 SV=1 Back     alignment and function desciption
 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 13/168 (7%)

Query: 170 IVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLS 229
           IV+ C+ +H +  ++     IP LH+    A EL       +   +  R+ +L T+ ++ 
Sbjct: 80  IVLTCNTAHYFFEELQAATDIPILHMPREAANEL-------VRQHTTGRVAILGTEGSMK 132

Query: 230 AGFYQEKLQNQGFEVVLPDKATME---HVIIPTIEALNHRDMEGARNLLRIGIQLLLVRA 286
           AG Y+ +++N GFE V+PD A  E   ++I   I+  +H + E    +L   ++ L    
Sbjct: 133 AGIYEREVKNLGFETVIPDTALQEKINYLIYHEIKESDHLNQELYYEILEEAVERL---N 189

Query: 287 VNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARSTVTWARSNKKLTL 334
              VI+G  E+  +    +      ID    LA  T+  A + +   L
Sbjct: 190 CEKVILGCTELSLMNEFAEDNHYPVIDAQSILADRTIERALAERNEAL 237

Enterococcus faecium (taxid: 1352)
EC: 5EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 3
>sp|P32968|YPNL_PECCC Uncharacterized protein in pnlA 3'region (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum PE=3 SV=1 Back     alignment and function description
>sp|H8L901|RACD_ENTFU Aspartate racemase OS=Enterococcus faecium (strain Aus0004) GN=EFAU004_01689 PE=1 SV=1 Back     alignment and function description
>sp|P32960|RACX_BACSU Probable amino-acid racemase OS=Bacillus subtilis (strain 168) GN=racX PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
359484398324 PREDICTED: uncharacterized protein LOC10 0.803 0.932 0.639 1e-108
147819141330 hypothetical protein VITISV_015733 [Viti 0.859 0.978 0.605 1e-106
224070839330 predicted protein [Populus trichocarpa] 0.856 0.975 0.598 1e-106
255553111330 racemase and epimerase, acting on amino 0.861 0.981 0.595 1e-103
225442873305 PREDICTED: uncharacterized protein LOC10 0.779 0.960 0.640 1e-103
255566957302 racemase and epimerase, acting on amino 0.779 0.970 0.585 5e-99
297743412443 unnamed protein product [Vitis vinifera] 0.667 0.566 0.655 3e-96
449469004327 PREDICTED: uncharacterized protein LOC10 0.75 0.862 0.611 2e-95
87162592321 Asp/Glu racemase [Medicago truncatula] 0.792 0.928 0.569 2e-94
357455147318 Aspartate racemase [Medicago truncatula] 0.792 0.937 0.569 3e-94
>gi|359484398|ref|XP_003633103.1| PREDICTED: uncharacterized protein LOC100853647 [Vitis vinifera] gi|147821411|emb|CAN63506.1| hypothetical protein VITISV_011681 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/308 (63%), Positives = 240/308 (77%), Gaps = 6/308 (1%)

Query: 24  YINKTLSRTRPILSAVVQSSSLLGQSHESGSLHESRKFPGSAAASLLRSKSPDSLLNQAN 83
           ++N+T    R   SA VQ SS+  Q+ ESG+  ES+K  G  AA + R ++P+SLL QAN
Sbjct: 12  FLNRTWCSGRSNPSAAVQLSSVFIQTDESGNTPESKKILGPVAA-VARCQAPNSLLTQAN 70

Query: 84  TIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPALNEELFHASVHSL---KSK 140
           T+GI+GGVSV STL FL KLVW+S++  EE  PFVVC+DP LN EL   S+      K+ 
Sbjct: 71  TVGILGGVSVFSTLIFLEKLVWWSSRHGEESLPFVVCSDPTLNRELASPSLSPFFRGKNA 130

Query: 141 TVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVA 200
             QLDH  G + +NLR KRAFLEQ+GARCIVMPCH++HAWH +VS+GC +PFLHVGECVA
Sbjct: 131 QFQLDH--GPIVENLRCKRAFLEQSGARCIVMPCHLAHAWHSEVSKGCPLPFLHVGECVA 188

Query: 201 KELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTI 260
            ELK+AK KPLEAGS VRIGVLA   TL AGFYQEKLQ+QGFEVVLPD ATMEH+++P I
Sbjct: 189 SELKKAKFKPLEAGSNVRIGVLAPGETLMAGFYQEKLQSQGFEVVLPDMATMEHIVVPAI 248

Query: 261 EALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALAR 320
           EAL+ +DMEGARNLLRI + + L+RAVN VI+ SDEMQ +LP+DDPL KKCI+PMDALAR
Sbjct: 249 EALHRKDMEGARNLLRIAVHIFLMRAVNIVILASDEMQDLLPRDDPLSKKCINPMDALAR 308

Query: 321 STVTWARS 328
           ST+ WA+S
Sbjct: 309 STIGWAKS 316

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147819141|emb|CAN68957.1| hypothetical protein VITISV_015733 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224070839|ref|XP_002303258.1| predicted protein [Populus trichocarpa] gi|222840690|gb|EEE78237.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255553111|ref|XP_002517598.1| racemase and epimerase, acting on amino acids and derivatives, putative [Ricinus communis] gi|223543230|gb|EEF44762.1| racemase and epimerase, acting on amino acids and derivatives, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225442873|ref|XP_002281753.1| PREDICTED: uncharacterized protein LOC100249822 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566957|ref|XP_002524461.1| racemase and epimerase, acting on amino acids and derivatives, putative [Ricinus communis] gi|223536249|gb|EEF37901.1| racemase and epimerase, acting on amino acids and derivatives, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743412|emb|CBI36279.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469004|ref|XP_004152211.1| PREDICTED: uncharacterized protein LOC101217164 [Cucumis sativus] gi|449532820|ref|XP_004173376.1| PREDICTED: uncharacterized protein LOC101225587 [Cucumis sativus] Back     alignment and taxonomy information
>gi|87162592|gb|ABD28387.1| Asp/Glu racemase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357455147|ref|XP_003597854.1| Aspartate racemase [Medicago truncatula] gi|355486902|gb|AES68105.1| Aspartate racemase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query376
TAIR|locus:2037743330 AT1G15410 [Arabidopsis thalian 0.853 0.972 0.507 2.1e-77
TIGR_CMR|SPO_2662485 SPO_2662 "aspartate racemase, 0.417 0.323 0.300 9.5e-09
UNIPROTKB|Q81Q00226 BAS2459 "Aspartate racemase fa 0.356 0.592 0.244 1e-05
TIGR_CMR|BA_2639226 BA_2639 "aspartate racemase fa 0.356 0.592 0.244 1e-05
UNIPROTKB|Q5LLG5232 Q5LLG5 "Aspartate racemase" [R 0.566 0.918 0.235 2.6e-05
TIGR_CMR|SPO_A0062232 SPO_A0062 "aspartate racemase" 0.566 0.918 0.235 2.6e-05
TIGR_CMR|CJE_0080231 CJE_0080 "aspartate racemase, 0.547 0.891 0.231 0.0005
TAIR|locus:2037743 AT1G15410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 779 (279.3 bits), Expect = 2.1e-77, P = 2.1e-77
 Identities = 166/327 (50%), Positives = 217/327 (66%)

Query:     8 MSLQTPNCPPFFLSTV-YINKTLSRTRPILSAVVQSSSLLGQSHESGSLHESRK-FPGSA 65
             M LQ  N P   L+ + Y ++   R R      +  SS+L    ES  L + +K F  S 
Sbjct:     1 MYLQIFNNPSHGLAHLCYSSRVSCRVRLSRVLAMPPSSVLLHMDESNDLPKPKKGFCLSE 60

Query:    66 -AASLLRSKSPDSLLNQANTIGIIGGVSVSSTLNFLGKLVWYSAKDAEECPPFVVCNDPA 124
              + + L S   DSLL QANT+GIIGGVS  STL F+ KLV +S+ D +   PFV+C+DPA
Sbjct:    61 DSRNSLNSLPADSLLRQANTVGIIGGVSTDSTLKFVKKLVDWSSNDGKSSLPFVLCSDPA 120

Query:   125 LNEELF---HASVHSLKSKTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWH 181
             LN+EL      S  SL  +          + +NLR+KR +LE+ GA+ I+MPCHI+H W+
Sbjct:   121 LNKELLLYEENSYPSLYHREESTPVDPKLIVENLRNKRRYLERCGAKLILMPCHIAHIWY 180

Query:   182 GDVSEGCSIPFLHVGECVXXXXXXXXXXXXXXGSGVRIGVLATDATLSAGFYQEKLQNQG 241
              +V EG  +P LH+GEC+              G+ +R+GV+AT ATLSAGFYQEKLQ+ G
Sbjct:   181 EEVCEGSLVPLLHMGECIAKELQEAKMKPLEAGNPLRVGVMATSATLSAGFYQEKLQSNG 240

Query:   242 FEVVLPDKATMEHVIIPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVL 301
             FE VLPDKATMEH +IP+IEA+  +DMEGARNLLRI +Q+LLV+AVN V++GSDEM+ +L
Sbjct:   241 FEAVLPDKATMEHTVIPSIEAMKRKDMEGARNLLRIALQVLLVQAVNVVMLGSDEMRDLL 300

Query:   302 PKDDPLLKKCIDPMDALARSTVTWARS 328
             P DDPLLKKC+DPMDALARS + WA +
Sbjct:   301 PGDDPLLKKCVDPMDALARSAIKWAEN 327
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016855 "racemase and epimerase activity, acting on amino acids and derivatives" evidence=IEA;ISS
TIGR_CMR|SPO_2662 SPO_2662 "aspartate racemase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|Q81Q00 BAS2459 "Aspartate racemase family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2639 BA_2639 "aspartate racemase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LLG5 Q5LLG5 "Aspartate racemase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_A0062 SPO_A0062 "aspartate racemase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CJE_0080 CJE_0080 "aspartate racemase, putative" [Campylobacter jejuni RM1221 (taxid:195099)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.1.1.76LOW CONFIDENCE prediction!
3rd Layer5.1.1.3LOW CONFIDENCE prediction!
3rd Layer5.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
COG1794230 COG1794, RacX, Aspartate racemase [Cell envelope b 1e-28
pfam01177209 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemas 6e-27
TIGR00035229 TIGR00035, asp_race, aspartate racemase 4e-26
PRK10200230 PRK10200, PRK10200, putative racemase; Provisional 2e-06
>gnl|CDD|224707 COG1794, RacX, Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
 Score =  111 bits (279), Expect = 1e-28
 Identities = 66/247 (26%), Positives = 105/247 (42%), Gaps = 30/247 (12%)

Query: 83  NTIGIIGGVSVSSTLNFLGKLVWYS-AKDAEECPPFVVCNDPALNE--ELFHASVHSLKS 139
            TIGI+GG+   ST  +  K+     AK        ++       E   L  A       
Sbjct: 2   KTIGILGGMGPESTAPYYRKINEAVRAKLGGLHSAELLLYSVDFPEIETLQRAGEWDEAG 61

Query: 140 KTVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECV 199
           + +    I  A           LE+AGA  IV+P +  H    D+ +   IP LH+ +  
Sbjct: 62  EIL----IDAAKK---------LERAGADFIVLPTNTMHKVADDIQKAVGIPLLHIIDAT 108

Query: 200 AKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPD---KATMEHVI 256
           AK +K A  K        ++G+L T  T+  GFY+++L+ +G EVV+PD   +A +  +I
Sbjct: 109 AKAIKAAGAK--------KVGLLGTRFTMEQGFYRKRLEEKGIEVVVPDDDEQAEVNRII 160

Query: 257 IPTIEALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMD 316
              +        + +R L    I+ L  R    VI+G  E+  +L +DD  +    D   
Sbjct: 161 YEELCQGIV--KDASRELYLAVIERLAERGAEGVILGCTEIPLLLSQDDSSV-PVFDTTA 217

Query: 317 ALARSTV 323
             A + V
Sbjct: 218 IHAEAAV 224

Length = 230
>gnl|CDD|216346 pfam01177, Asp_Glu_race, Asp/Glu/Hydantoin racemase Back     alignment and domain information
>gnl|CDD|213495 TIGR00035, asp_race, aspartate racemase Back     alignment and domain information
>gnl|CDD|182300 PRK10200, PRK10200, putative racemase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 376
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 100.0
PRK10200230 putative racemase; Provisional 100.0
TIGR00035229 asp_race aspartate racemase. 100.0
TIGR00067251 glut_race glutamate racemase. The most closely rel 100.0
PRK00865261 glutamate racemase; Provisional 100.0
COG0796269 MurI Glutamate racemase [Cell envelope biogenesis, 100.0
PF01177216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 99.93
PRK07475245 hypothetical protein; Provisional 99.89
COG4126230 Hydantoin racemase [Amino acid transport and metab 99.38
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 98.99
PRK10481224 hypothetical protein; Provisional 98.98
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 98.79
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 97.26
PRK00865261 glutamate racemase; Provisional 96.08
COG1609333 PurR Transcriptional regulators [Transcription] 94.91
TIGR00035229 asp_race aspartate racemase. 94.9
TIGR00067251 glut_race glutamate racemase. The most closely rel 94.47
COG1794230 RacX Aspartate racemase [Cell envelope biogenesis, 94.46
PF01177216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 93.82
PRK10481224 hypothetical protein; Provisional 93.79
COG4126230 Hydantoin racemase [Amino acid transport and metab 92.93
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 92.79
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 92.44
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 92.39
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 91.78
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 91.6
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 91.38
PLN02424332 ketopantoate hydroxymethyltransferase 91.2
PRK04452319 acetyl-CoA decarbonylase/synthase complex subunit 91.08
PRK10200230 putative racemase; Provisional 91.07
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 90.83
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 90.78
COG0796269 MurI Glutamate racemase [Cell envelope biogenesis, 90.57
PRK07475245 hypothetical protein; Provisional 90.53
cd06339336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 90.24
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 89.83
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 89.73
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 89.49
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 89.45
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 88.76
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 88.3
cd06295275 PBP1_CelR Ligand binding domain of a transcription 88.13
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 88.11
TIGR03288290 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, s 88.04
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 87.8
PRK06259486 succinate dehydrogenase/fumarate reductase iron-su 87.75
PRK09526342 lacI lac repressor; Reviewed 87.65
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 87.61
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 87.51
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 87.03
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 86.84
PRK09492315 treR trehalose repressor; Provisional 86.82
PRK10423327 transcriptional repressor RbsR; Provisional 86.64
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 86.59
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 86.57
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 86.56
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 86.15
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 85.97
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 85.93
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 85.82
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 85.31
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 85.11
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 85.04
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 84.89
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 84.77
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 84.73
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 84.27
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 84.19
COG0683366 LivK ABC-type branched-chain amino acid transport 84.15
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 83.93
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 83.76
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 83.74
PRK14987331 gluconate operon transcriptional regulator; Provis 83.34
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 83.14
COG2048293 HdrB Heterodisulfide reductase, subunit B [Energy 83.01
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 82.7
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 82.26
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 82.06
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 82.06
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 81.24
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 80.83
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 80.65
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 80.5
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 80.41
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 80.2
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 80.19
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
Probab=100.00  E-value=5e-56  Score=408.45  Aligned_cols=226  Identities=28%  Similarity=0.372  Sum_probs=204.6

Q ss_pred             CCeEEEEcCCChHHHHHHHHHHHHHhh-hCCCCCCCeEeecCCcchhHHhhhchhhhccccccCcchHHHHHHHHHHHHH
Q 017159           82 ANTIGIIGGVSVSSTLNFLGKLVWYSA-KDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRA  160 (376)
Q Consensus        82 ~k~IGIIGGmGp~AT~~f~~kI~~~~~-~~dq~~~p~il~s~p~ipd~l~~~s~~~~~~~~~~~~~~~~~i~~~l~~~~~  160 (376)
                      ||+|||||||||+||+.||++||+.++ +.|+.|.+.++.+++++|++.-.           .....|++..+.|.+.++
T Consensus         1 mk~iGilGGMgpeST~~yyr~ine~~~~~~g~~h~~~i~~~s~~f~~~~~~-----------q~~~~w~~~~~~L~~~a~   69 (230)
T COG1794           1 MKTIGILGGMGPESTAPYYRKINEAVRAKLGGLHSAELLLYSVDFPEIETL-----------QRAGEWDEAGEILIDAAK   69 (230)
T ss_pred             CceeEeccCCChHHHHHHHHHHHHHHHHHhCCcCcchhheecCCcccHHHH-----------HccCccccHHHHHHHHHH
Confidence            799999999999999999999999997 68899999999999998876321           223446889999999999


Q ss_pred             HHHHcCCcEEEEeCCCchhhHHHHhccCCCCeeccHHHHHHHHHHhcCCCCcCCCCceEEEeecchhhchHHHHHHHHhc
Q 017159          161 FLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQ  240 (376)
Q Consensus       161 ~L~~~Gad~IVIaCNTAH~~~d~L~~~~~vPvl~Iveat~~~~~~~g~k~~~~~~~~rVGlLaT~~T~~s~~Y~~~L~~~  240 (376)
                      .|+++|||+|++||||+|.++|++++.+++|++||+|+|+++++..|.+        |||||||.+||++++|++.|.++
T Consensus        70 ~Le~~GAd~i~l~~NT~H~~~d~iq~~~~iPllhIidaTa~~ik~~g~k--------kvgLLgT~~Tm~~~fY~~~l~~~  141 (230)
T COG1794          70 KLERAGADFIVLPTNTMHKVADDIQKAVGIPLLHIIDATAKAIKAAGAK--------KVGLLGTRFTMEQGFYRKRLEEK  141 (230)
T ss_pred             HHHhcCCCEEEEeCCcHHHHHHHHHHhcCCCeehHHHHHHHHHHhcCCc--------eeEEeeccchHHhHHHHHHHHHC
Confidence            9999999999999999999999999999999999999999999998876        99999999999999999999999


Q ss_pred             CCceeecCccccccchHHH-HHHHhcCCh-HHHHHHHHHHHHHHhhCCCCEEEECCCccccccCCCCCCCCeeeehHHHH
Q 017159          241 GFEVVLPDKATMEHVIIPT-IEALNHRDM-EGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDAL  318 (376)
Q Consensus       241 G~evv~p~~~~q~~~l~~~-ie~lk~G~~-~~a~~~l~~~i~~L~~~gaDaVILGCTElpll~~~~~~~~vpvIDp~~~l  318 (376)
                      |+++++|++++|+. ++.+ ++++|.|+. +++++.+...+++|.++|||+|||||||+|+++++.+ ..+|+||++.+|
T Consensus       142 gievvvPdd~~q~~-v~~iIy~El~~G~~~~~sr~~~~~ii~~l~~~Gae~vIlGCTEi~lll~~~d-~~vP~~Dtt~ih  219 (230)
T COG1794         142 GIEVVVPDDDEQAE-VNRIIYEELCQGIVKDASRELYLAVIERLAERGAEGVILGCTEIPLLLSQDD-SSVPVFDTTAIH  219 (230)
T ss_pred             CceEecCCHHHHHH-HHHHHHHHHhcccchHHHHHHHHHHHHHHHHcCCCEEEEeccchheeecCCc-ccCcccccHHHH
Confidence            99999999988875 4444 466999998 4689999999999999999999999999999998876 358999999999


Q ss_pred             HHHHHHHHHh
Q 017159          319 ARSTVTWARS  328 (376)
Q Consensus       319 A~a~v~~a~~  328 (376)
                      |+++++++..
T Consensus       220 a~aav~~aL~  229 (230)
T COG1794         220 AEAAVELALE  229 (230)
T ss_pred             HHHHHHHHhc
Confidence            9999988753

>PRK10200 putative racemase; Provisional Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>COG0796 MurI Glutamate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG0796 MurI Glutamate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03288 CoB_CoM_SS_B CoB--CoM heterodisulfide reductase, subunit B Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>COG2048 HdrB Heterodisulfide reductase, subunit B [Energy production and conversion] Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
3s81_A268 Crystal Structure Of Putative Aspartate Racemase Fr 2e-15
1jfl_A228 Crystal Structure Determination Of Aspartate Racema 6e-15
2dx7_A228 Crystal Structure Of Pyrococcus Horikoshii Ot3 Aspa 7e-14
3s7z_A268 Crystal Structure Of Putative Aspartate Racemase Fr 7e-14
2zsk_A226 Crystal Structure Of Ph1733, An Aspartate Racemase 1e-07
3ojc_A231 Crystal Structure Of A Putative AspGLU RACEMASE FRO 9e-07
1iu9_A111 Crystal Structure Of The C-Terminal Domain Of Aspar 4e-05
>pdb|3S81|A Chain A, Crystal Structure Of Putative Aspartate Racemase From Salmonella Typhimurium Length = 268 Back     alignment and structure 
Iteration: 1

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 112/249 (44%), Gaps = 26/249 (10%)
Query: 83  NTIGIIGGVSVSSTLNFLGKLV--WYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSK 140
           +TIGI+GG+  ++T + L K V   +++ D +  P             L  +S+  +  +
Sbjct: 27  HTIGILGGMGPAATADMLEKFVELRHASCDQQHIP-------------LIVSSIPDIPDR 73
Query: 141 TVQLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVX 200
           T  L     +  + L      LE AGA CIV+PC+ +H W  D+        + + +   
Sbjct: 74  TACLLSGGPSPYRYLERYLHMLEDAGAECIVIPCNTAHYWFDDLQNVAKARMISILDATL 133
Query: 201 XXXXXXXXXXXXXGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTI 260
                         S   +G+LAT+ATL+ G YQ+K   +G  ++ P+ A  + +++  I
Sbjct: 134 GDIPP---------SARHVGLLATNATLATGLYQKKALARGLTLIQPEDAG-QALVMQAI 183
Query: 261 EALNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLK-KCIDPMDALA 319
             L   D   A+ LL   I  L+ R   A+I+G  E+  ++   +  +    ID   +L 
Sbjct: 184 YTLKRGDKTAAQALLLPQIDSLIARGAQAIIMGCTEIPLIVAGHERAIACPMIDSTASLV 243
Query: 320 RSTVTWARS 328
           R+ + W  S
Sbjct: 244 RAAIRWYES 252
>pdb|1JFL|A Chain A, Crystal Structure Determination Of Aspartate Racemase From An Archaea Length = 228 Back     alignment and structure
>pdb|2DX7|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Ot3 Aspartate Racemase Complex With Citric Acid Length = 228 Back     alignment and structure
>pdb|3S7Z|A Chain A, Crystal Structure Of Putative Aspartate Racemase From Salmonella Typhimurium Complexed With Succinate Length = 268 Back     alignment and structure
>pdb|2ZSK|A Chain A, Crystal Structure Of Ph1733, An Aspartate Racemase Homologue, From Pyrococcus Horikoshii Ot3 Length = 226 Back     alignment and structure
>pdb|3OJC|A Chain A, Crystal Structure Of A Putative AspGLU RACEMASE FROM YERSINIA PESTIS Length = 231 Back     alignment and structure
>pdb|1IU9|A Chain A, Crystal Structure Of The C-Terminal Domain Of Aspartate Racemase From Pyrococcus Horikoshii Ot3 Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query376
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 5e-42
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 4e-40
3s81_A268 Putative aspartate racemase; structural genomics, 3e-39
3ojc_A231 Putative aspartate/glutamate racemase; structural 5e-39
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 6e-05
3ist_A269 Glutamate racemase; structural genomics, cell WALL 1e-04
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 1e-04
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synth 2e-04
3uhf_A274 Glutamate racemase; structural genomics, center fo 2e-04
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell sha 3e-04
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 4e-04
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 6e-04
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell sha 7e-04
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Length = 228 Back     alignment and structure
 Score =  145 bits (368), Expect = 5e-42
 Identities = 67/244 (27%), Positives = 111/244 (45%), Gaps = 22/244 (9%)

Query: 84  TIGIIGGVSVSSTLNFLGKLV-WYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTV 142
           TIGI+GG+   +T     ++V    AK  +E P  ++ N+P + +             T 
Sbjct: 3   TIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDR------------TA 50

Query: 143 QLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKE 202
            +          L      LE+ GA  I+MPC+ +HA+  D+ +   IP + + E  AK+
Sbjct: 51  YILGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKK 110

Query: 203 LKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQGFEVVLPDKATMEHVIIPTIEA 262
           +KE   K          G+LAT  T+ +G Y+++    G E++ P +   + V+    E 
Sbjct: 111 VKELGFKK--------AGLLATTGTIVSGVYEKEFSKYGVEIMTPTEDEQKDVMRGIYEG 162

Query: 263 LNHRDMEGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDALARST 322
           +   +++  R LL    ++L  R    +I G  E+  V+ K D L    IDPMD +A   
Sbjct: 163 VKAGNLKLGRELLLKTAKILEERGAECIIAGCTEV-SVVLKQDDLKVPLIDPMDVIAEVA 221

Query: 323 VTWA 326
           V  A
Sbjct: 222 VKVA 225
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Length = 226 Back     alignment and structure
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Length = 268 Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Length = 231 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Length = 276 Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Length = 269 Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Length = 267 Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Length = 290 Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Length = 274 Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Length = 286 Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Length = 272 Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Length = 254 Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Length = 255 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
3ojc_A231 Putative aspartate/glutamate racemase; structural 100.0
3s81_A268 Putative aspartate racemase; structural genomics, 100.0
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 100.0
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 100.0
3out_A268 Glutamate racemase; structural genomics, center fo 100.0
3ist_A269 Glutamate racemase; structural genomics, cell WALL 100.0
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synth 100.0
3uhf_A274 Glutamate racemase; structural genomics, center fo 100.0
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell sha 100.0
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcu 100.0
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 100.0
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 100.0
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 100.0
2jfn_A285 Glutamate racemase; cell WALL, isomerase, cell sha 100.0
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 100.0
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell sha 100.0
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 99.9
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 99.9
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 99.89
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 99.89
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 99.88
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 96.28
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 96.26
2dwu_A276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 96.16
2jfq_A286 Glutamate racemase; cell WALL, isomerase, cell sha 96.15
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 95.93
3ojc_A231 Putative aspartate/glutamate racemase; structural 95.7
2qh8_A302 Uncharacterized protein; conserved domain protein, 95.69
3out_A268 Glutamate racemase; structural genomics, center fo 95.68
2vvt_A290 Glutamate racemase; isomerase, peptidoglycan synth 95.65
3c3k_A285 Alanine racemase; structural genomics, protein str 95.48
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 95.47
3ist_A269 Glutamate racemase; structural genomics, cell WALL 95.15
3gv0_A288 Transcriptional regulator, LACI family; transcript 95.02
3e61_A277 Putative transcriptional repressor of ribose OPER; 95.0
2jfz_A255 Glutamate racemase; cell WALL, isomerase, cell sha 94.9
3o74_A272 Fructose transport system repressor FRUR; dual tra 94.87
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 94.85
3egc_A291 Putative ribose operon repressor; structural genom 94.63
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 94.51
2oho_A273 Glutamate racemase; isomerase; 2.25A {Streptococcu 94.36
1b73_A254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 94.12
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 94.03
3uhf_A274 Glutamate racemase; structural genomics, center fo 93.93
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 93.89
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 93.77
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 93.59
2zsk_A226 PH1733, 226AA long hypothetical aspartate racemase 93.58
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 93.58
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 93.44
3kke_A303 LACI family transcriptional regulator; structural 93.43
3h5o_A339 Transcriptional regulator GNTR; transcription regu 93.35
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 93.31
3k9c_A289 Transcriptional regulator, LACI family protein; PS 93.3
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 93.24
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 93.21
2jfn_A285 Glutamate racemase; cell WALL, isomerase, cell sha 93.15
3qk7_A294 Transcriptional regulators; structural genomics, N 93.07
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 93.06
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 92.9
2qu7_A288 Putative transcriptional regulator; structural gen 92.89
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 92.86
3bbl_A287 Regulatory protein of LACI family; protein structu 92.71
3jvd_A333 Transcriptional regulators; structural genomics, P 92.64
3ipc_A356 ABC transporter, substrate binding protein (amino; 92.54
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 92.25
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 91.99
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 91.69
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 91.66
3l6u_A293 ABC-type sugar transport system periplasmic compo; 91.59
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 91.53
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 91.51
2q5c_A196 NTRC family transcriptional regulator; structural 91.26
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 91.23
3snr_A362 Extracellular ligand-binding receptor; structural 91.18
3gbv_A304 Putative LACI-family transcriptional regulator; NY 90.9
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 90.89
3n0w_A379 ABC branched chain amino acid family transporter, 90.81
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 90.77
3k4h_A292 Putative transcriptional regulator; structural gen 90.74
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 90.64
3gyb_A280 Transcriptional regulators (LACI-family transcript 90.64
3bil_A348 Probable LACI-family transcriptional regulator; st 90.5
3sg0_A386 Extracellular ligand-binding receptor; structural 90.41
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 90.35
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 90.28
3td9_A366 Branched chain amino acid ABC transporter, peripl 90.22
3hut_A358 Putative branched-chain amino acid ABC transporter 90.0
3lkb_A392 Probable branched-chain amino acid ABC transporter 89.88
3e3m_A355 Transcriptional regulator, LACI family; structural 89.82
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 89.81
1byk_A255 Protein (trehalose operon repressor); LACI family, 89.8
3i45_A387 Twin-arginine translocation pathway signal protei; 89.79
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 89.74
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 89.72
3miz_A301 Putative transcriptional regulator protein, LACI f 89.67
3s81_A268 Putative aspartate racemase; structural genomics, 89.56
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 89.26
3brs_A289 Periplasmic binding protein/LACI transcriptional; 89.25
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 89.25
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 89.2
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 88.85
1jye_A349 Lactose operon repressor; gene regulation, protein 88.84
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 88.71
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 88.51
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 88.45
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 88.24
4evq_A375 Putative ABC transporter subunit, substrate-bindi 88.13
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 88.03
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 87.92
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 87.87
3g85_A289 Transcriptional regulator (LACI family); transcrip 87.38
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 87.0
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 86.25
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 86.24
1pea_A385 Amidase operon; gene regulator, receptor, binding 86.2
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 86.12
3lop_A364 Substrate binding periplasmic protein; protein str 85.69
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 85.48
2iks_A293 DNA-binding transcriptional dual regulator; escher 85.23
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 85.1
2pju_A225 Propionate catabolism operon regulatory protein; s 84.94
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 84.77
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 84.7
1usg_A346 Leucine-specific binding protein; leucine-binding 83.71
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 83.18
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 83.16
2x7x_A325 Sensor protein; transferase, sensor histidine kina 82.61
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 82.23
3h5l_A 419 Putative branched-chain amino acid ABC transporter 81.78
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 81.38
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 80.93
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 80.52
8abp_A306 L-arabinose-binding protein; binding proteins; HET 80.19
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
Probab=100.00  E-value=6.7e-51  Score=382.02  Aligned_cols=225  Identities=25%  Similarity=0.361  Sum_probs=193.2

Q ss_pred             CCeEEEEcCCChHHHHHHHHHHHHHhh-hCCCCCCCeEeecCCcchhHHhhhchhhhccccccCcchHHHHHHHHHHHHH
Q 017159           82 ANTIGIIGGVSVSSTLNFLGKLVWYSA-KDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRA  160 (376)
Q Consensus        82 ~k~IGIIGGmGp~AT~~f~~kI~~~~~-~~dq~~~p~il~s~p~ipd~l~~~s~~~~~~~~~~~~~~~~~i~~~l~~~~~  160 (376)
                      ||+|||||||||+||++||++|++.++ +.||+|.|.++++.++++++...           ....+|+++.+++.+.++
T Consensus         2 mk~iGilGGmg~~at~~~~~~i~~~~~~~~~~~h~~~~~~~s~~~~~~~~~-----------~~~~~~~~~~~~l~~~~~   70 (231)
T 3ojc_A            2 MKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQL-----------QAKGDWQTAAQLLSNAAI   70 (231)
T ss_dssp             CCCEEEEECTTHHHHHHHHHHHHHHHHHHHCTTCCCCEEEEECCHHHHHHH-----------HHTTCHHHHHHHHHHHHH
T ss_pred             CCeEEEEccCCHHHHHHHHHHHHHHhHHhcCCCCCccceeeCCChhhHHHH-----------HHCCChhHHHHHHHHHHH
Confidence            899999999999999999999999997 57888876555555556653221           123456999999999999


Q ss_pred             HHHHcCCcEEEEeCCCchhhHHHHhccCCCCeeccHHHHHHHHHHhcCCCCcCCCCceEEEeecchhhchHHHHHHHHhc
Q 017159          161 FLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAKLKPLEAGSGVRIGVLATDATLSAGFYQEKLQNQ  240 (376)
Q Consensus       161 ~L~~~Gad~IVIaCNTAH~~~d~L~~~~~vPvl~Iveat~~~~~~~g~k~~~~~~~~rVGlLaT~~T~~s~~Y~~~L~~~  240 (376)
                      +|+++|||+|||||||+|++++++++.+++||+||+++++++++..+.        +|||||||++|+++++|++.++++
T Consensus        71 ~L~~~g~~~iviaCNTa~~~~~~l~~~~~iPvi~i~~~~~~~a~~~~~--------~rVgvLaT~~T~~s~~y~~~l~~~  142 (231)
T 3ojc_A           71 SLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGI--------DKIGLLGTRYTMEQGFYRGRLTEK  142 (231)
T ss_dssp             HHHHHTCCEEEECSSGGGGGHHHHHHHHCSCBCCHHHHHHHHHHHTTC--------CEEEEESCHHHHHSTTTHHHHHHT
T ss_pred             HHHhcCCCEEEEeCCchHHHHHHHHHhCCCCEeccHHHHHHHHHHcCC--------CEEEEEcCHHHhhchHHHHHHHhc
Confidence            999999999999999999999999999999999999999999987543        499999999999999999999999


Q ss_pred             -CCceeecCccccccchHHHH-HHHhcCCh-HHHHHHHHHHHHHHhhCCCCEEEECCCccccccCCCCCCCCeeeehHHH
Q 017159          241 -GFEVVLPDKATMEHVIIPTI-EALNHRDM-EGARNLLRIGIQLLLVRAVNAVIIGSDEMQGVLPKDDPLLKKCIDPMDA  317 (376)
Q Consensus       241 -G~evv~p~~~~q~~~l~~~i-e~lk~G~~-~~a~~~l~~~i~~L~~~gaDaVILGCTElpll~~~~~~~~vpvIDp~~~  317 (376)
                       |++++.|+.+.++. +...| ++++.|.. +++++.+.++++.|.++|+|+|||||||||++.+..+ .++|+|||+++
T Consensus       143 ~g~~v~~p~~~~~~~-v~~~I~~~~~~g~~~~~~~~~~~~~~~~l~~~g~d~vILGCTe~pll~~~~~-~~v~viDs~~~  220 (231)
T 3ojc_A          143 HGIEVITPDDTDREA-VNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQD-ASVPVFDTTAI  220 (231)
T ss_dssp             TCCEEECCCHHHHHH-HHHHHHHTGGGTCCCHHHHHHHHHHHHHHHHTTCSCEEECSGGGGGTCCGGG-CSSCEEEHHHH
T ss_pred             CCCEEEecCHHHHHH-HHHHHHHHHHcCCCCHHHHHHHHHHHHHHHHCCCCEEEECCCCHHHhccccc-CCCcEEchHHH
Confidence             99999988765542 33333 45788876 5578899999999999999999999999999987765 45899999999


Q ss_pred             HHHHHHHHHH
Q 017159          318 LARSTVTWAR  327 (376)
Q Consensus       318 lA~a~v~~a~  327 (376)
                      +|+++++++.
T Consensus       221 ~A~~~v~~a~  230 (231)
T 3ojc_A          221 HASAAADYAL  230 (231)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHh
Confidence            9999999985
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli} Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>2jfn_A Glutamate racemase; cell WALL, isomerase, cell shape, UDP- murnac-Ala, peptidoglycan biosynthesis, peptidoglycan synthesis; HET: GLU UMA; 1.9A {Escherichia coli} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 376
d1jfla1115 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Py 1e-23
d1jfla2113 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon 1e-20
d1b74a2147 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex p 4e-06
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/glutamate racemase
family: Aspartate/glutamate racemase
domain: Aspartate racemase
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 92.3 bits (229), Expect = 1e-23
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 13/124 (10%)

Query: 84  TIGIIGGVSVSSTLNFLGKLV-WYSAKDAEECPPFVVCNDPALNEELFHASVHSLKSKTV 142
           TIGI+GG+   +T     ++V    AK  +E P  ++ N+P + +             T 
Sbjct: 3   TIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDR------------TA 50

Query: 143 QLDHIRGAVSQNLRHKRAFLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKE 202
            +          L      LE+ GA  I+MPC+ +HA+  D+ +   IP + + E  AK+
Sbjct: 51  YILGKGEDPRPQLIWTAKRLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKK 110

Query: 203 LKEA 206
           +KE 
Sbjct: 111 VKEL 114
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 113 Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query376
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 99.97
d1jfla2113 Aspartate racemase {Archaeon Pyrococcus horikoshii 99.89
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 99.73
d1b74a1105 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 99.54
d1jfla2113 Aspartate racemase {Archaeon Pyrococcus horikoshii 96.36
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 95.08
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 94.54
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 92.82
d1b74a2147 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 91.09
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 90.21
d2pjua1186 Propionate catabolism operon regulatory protein Pr 89.44
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 89.17
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 82.74
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/glutamate racemase
family: Aspartate/glutamate racemase
domain: Aspartate racemase
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=99.97  E-value=7.5e-33  Score=231.21  Aligned_cols=114  Identities=28%  Similarity=0.465  Sum_probs=100.5

Q ss_pred             CCeEEEEcCCChHHHHHHHHHHHHHhh-hCCCCCCCeEeecCCcchhHHhhhchhhhccccccCcchHHHHHHHHHHHHH
Q 017159           82 ANTIGIIGGVSVSSTLNFLGKLVWYSA-KDAEECPPFVVCNDPALNEELFHASVHSLKSKTVQLDHIRGAVSQNLRHKRA  160 (376)
Q Consensus        82 ~k~IGIIGGmGp~AT~~f~~kI~~~~~-~~dq~~~p~il~s~p~ipd~l~~~s~~~~~~~~~~~~~~~~~i~~~l~~~~~  160 (376)
                      ||+|||||||||+||++||++|++.++ +.||+|++++++|+|++|++.....      ++      |+.....+.+.++
T Consensus         1 Mk~IGIIGGmgp~at~~yy~~i~~~~~~~~d~~~~~~il~s~~~~~~r~~~~~------~~------~~~~~~~l~~~~~   68 (115)
T d1jfla1           1 MKTIGILGGMGPLATAELFRRIVIKTPAKRDQEHPKVIIFNNPQIPDRTAYIL------GK------GEDPRPQLIWTAK   68 (115)
T ss_dssp             CCCEEEEECSSHHHHHHHHHHHHHTCCCSSGGGSCCEEEEECTTSCCHHHHHT------TS------SCCCHHHHHHHHH
T ss_pred             CCEEEEccCcCHHHHHHHHHHHHHHHHHhcCCCCChhheeecCCHHHHHHHHh------cc------ccchHHHHHHHHH
Confidence            899999999999999999999999996 6899999999999999998765331      11      1234456778889


Q ss_pred             HHHHcCCcEEEEeCCCchhhHHHHhccCCCCeeccHHHHHHHHHHhc
Q 017159          161 FLEQAGARCIVMPCHISHAWHGDVSEGCSIPFLHVGECVAKELKEAK  207 (376)
Q Consensus       161 ~L~~~Gad~IVIaCNTAH~~~d~L~~~~~vPvl~Iveat~~~~~~~g  207 (376)
                      +|+++|||+|+|||||+|.|+|++++.+++|++||+++|++++++.|
T Consensus        69 ~Le~~Ga~~i~i~cNT~H~~~d~i~~~~~iP~l~i~~~t~~~i~~~G  115 (115)
T d1jfla1          69 RLEECGADFIIMPCNTAHAFVEDIRKAIKIPIISMIEETAKKVKELG  115 (115)
T ss_dssp             HHHHHTCSEEECSCTGGGGGHHHHHHHCSSCBCCHHHHHHHHHHHTT
T ss_pred             HHHhcCCCEEEEcCcHHHHHHHHHHHHCCCCEecHHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999998764
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b74a2 c.78.2.1 (A:106-252) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure