Citrus Sinensis ID: 018193


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MSSSSDAAARSDSHAPLLRPRDPSVSPNAARPATLALLLGRATGRGHGPSMLVRETAARELEERRADWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRRRNTRRVRDDEMGGEDFRDVNNDSEDEEEDGIVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGNEQV
ccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccHHHHHHHHEEEEEEHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccEEccccccccccccHHHHHHHccccccccccccccccccc
cccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHEEEEEHHHHHHEEHHHEHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccEEEEccccccccccccccEEcccccccccccccEcccccccEEEEEcccccccEEEEccccccccHHHHHHHHHHHccccHHHHHHccccccc
mssssdaaarsdshapllrprdpsvspnaarPATLALLLGRatgrghgpsmLVRETAARELEERradwgyskpvvALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRRrntrrvrddemggedfrdvnndsedeeedgivyrtstrtsFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVagqegaseadlsilpkyrfevqnndeklgvgagkmvpietnggyvanerillpedaecciclssyedgtelhalpcnhhfhSTCIVKWLkmnatcplckynilkgneqv
mssssdaaarsdshapllrprdpsvspnaARPATLALLLGRatgrghgpsmLVRETAARELEerradwgyskPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMeyrrrntrrvrddemggedfrdvnndsedeeedgivyrtstrtsftkrCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGNEQV
MssssdaaarsdshaPLLRPRDPSVSPNaarpatlalllgratgrgHGPSMLVretaareleerraDWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYrrrntrrvrDDEMGGEDFRdvnndsedeeedGIVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLavvflafdvffaifCVVlacligialccclpciiailYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGNEQV
***********************************ALLLG***********************RRADWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRR******************************IVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILK*****
********************************************************************GYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYR***************************************TSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAG**************************************************PEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNIL******
***************PLLRPRDPSVSPNAARPATLALLLGRATGRGHGPSMLVRETAARELEERRADWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRRRNTRRVRDDEMGGEDFRDVN*********GIVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGNEQV
************************************************PSMLV*********ERRADWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRRRNT*********************************TRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQ*************V****N*******RILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILK*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSDAAARSDSHAPLLRPRDPSVSPNAARPATLALLLGRATGRGHGPSMLVRETAARELEERRADWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRRRNTRRVRDDEMGGEDFRDVNNDSEDEEEDGIVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGNEQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query359 2.2.26 [Sep-21-2011]
Q8GUU2359 E3 ubiquitin protein liga no no 0.972 0.972 0.668 1e-135
Q93Z92390 E3 ubiquitin-protein liga no no 0.835 0.769 0.560 9e-85
Q9LN71408 E3 ubiquitin-protein liga no no 0.866 0.762 0.511 2e-81
Q8LDB8381 E3 ubiquitin-protein liga no no 0.855 0.805 0.546 3e-76
Q08CG8448 RING finger protein 44 OS yes no 0.200 0.160 0.333 7e-11
Q6Y290 419 E3 ubiquitin-protein liga yes no 0.250 0.214 0.333 2e-10
Q8VEM1 419 E3 ubiquitin-protein liga yes no 0.250 0.214 0.333 2e-10
Q86XS8 419 E3 ubiquitin-protein liga yes no 0.250 0.214 0.333 3e-10
Q9H0F5515 RING finger protein 38 OS no no 0.200 0.139 0.323 1e-09
Q7L0R7432 RING finger protein 44 OS no no 0.200 0.166 0.323 1e-09
>sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 Back     alignment and function desciption
 Score =  480 bits (1236), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/359 (66%), Positives = 273/359 (76%), Gaps = 10/359 (2%)

Query: 2   SSSSDAAARSDSHAPLLRPRDPSVSPNA---ARPATLALLLGRATGRGHGPSMLVRETAA 58
           S SSD+ A  D HAPLLRPR      ++   ARP  LA+LLGR TG    PSMLVRETAA
Sbjct: 3   SYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLGRITGH-RAPSMLVRETAA 61

Query: 59  RELEERRADWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLV 118
           R LEERR DWGYSKPVVA DI+WN+A V+ SA ML+ T+ ERP+  IR+WIC Y LQCL 
Sbjct: 62  RALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERPNEPIRVWICVYGLQCLF 121

Query: 119 HVVLVWMEYRRRN-TRRVRDDEMGGEDFRDVNNDSEDEEEDGIVYRTSTRTSFTKRCESI 177
           HVVLVW EY RRN TRR RD E    +  ++  D E + +D      ST  SF KRCESI
Sbjct: 122 HVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDSDDN-----STTYSFVKRCESI 176

Query: 178 NTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALC 237
           NT+ SF+WWI+GFYWVV GGD LL  AP LYWL+V+FLA DVFFA+FCVVLACL+GIALC
Sbjct: 177 NTVISFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDVFFAVFCVVLACLVGIALC 236

Query: 238 CCLPCIIAILYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVAN 297
           CCLPCIIA+LYAVAG EG SEA+L +LP Y+F+  +++EK   G GKMVPI  NG  +A 
Sbjct: 237 CCLPCIIALLYAVAGTEGVSEAELGVLPLYKFKAFHSNEKNITGPGKMVPIPINGLCLAT 296

Query: 298 ERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGN 356
           ER LL EDA+CCICLSSYEDG ELHALPCNHHFHSTCIVKWLKM ATCPLCKYNILKG 
Sbjct: 297 ERTLLAEDADCCICLSSYEDGAELHALPCNHHFHSTCIVKWLKMRATCPLCKYNILKGT 355




Probable E3 ubiquitin-protein ligase required for embryo development.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=2 SV=1 Back     alignment and function description
>sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 Back     alignment and function description
>sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 Back     alignment and function description
>sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 Back     alignment and function description
>sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 Back     alignment and function description
>sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 Back     alignment and function description
>sp|Q9H0F5|RNF38_HUMAN RING finger protein 38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 Back     alignment and function description
>sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
359472593 2299 PREDICTED: uncharacterized protein LOC10 0.952 0.148 0.795 1e-152
255570075 963 cleavage and polyadenylation specificity 0.947 0.353 0.756 1e-150
224101895351 predicted protein [Populus trichocarpa] 0.969 0.991 0.752 1e-149
147769549361 hypothetical protein VITISV_014258 [Viti 0.922 0.916 0.791 1e-144
356521151352 PREDICTED: E3 ubiquitin protein ligase R 0.972 0.991 0.734 1e-141
356513054334 PREDICTED: E3 ubiquitin protein ligase R 0.908 0.976 0.721 1e-140
297838553344 hypothetical protein ARALYDRAFT_475916 [ 0.952 0.994 0.674 1e-137
15220639343 C3HC4-type RING finger domain-containing 0.949 0.994 0.679 1e-137
21536719343 putative RING zinc finger protein [Arabi 0.949 0.994 0.676 1e-136
356513052344 PREDICTED: E3 ubiquitin protein ligase R 0.935 0.976 0.724 1e-136
>gi|359472593|ref|XP_002281277.2| PREDICTED: uncharacterized protein LOC100261060 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 276/347 (79%), Positives = 300/347 (86%), Gaps = 5/347 (1%)

Query: 15   APLLRPRDPSVSPNAARPATLALLLGRATGRGHGPSMLVRETAARELEERRADWGYSKPV 74
            APLLRPR    +  +ARP TLALL+GRATGR  GPSMLVRETAARELEERRADWGYSKPV
Sbjct: 1956 APLLRPRQ-GTAEQSARPTTLALLMGRATGR-RGPSMLVRETAARELEERRADWGYSKPV 2013

Query: 75   VALDIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYALQCLVHVVLVWMEYRRRNTRR 134
            VALD+MWN +FVIVS  MLI T  ERP+T IRLWICGYALQC VHVVLVW+EYRRRN RR
Sbjct: 2014 VALDMMWNMSFVIVSIVMLICTARERPNTPIRLWICGYALQCGVHVVLVWLEYRRRNRRR 2073

Query: 135  VRDDEMGGE-DFRDVN-NDSEDEEEDGIVYRTSTRTSFTKRCESINTMASFLWWIVGFYW 192
            VRD+E   +    D + NDSEDE+ +        ++S TKRCES+NTMASFLWWIVGFYW
Sbjct: 2074 VRDEEQQQQPQHSDSDVNDSEDEDGNSSASGGFNQSSVTKRCESVNTMASFLWWIVGFYW 2133

Query: 193  VVSGGDLLLQAAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAG 252
            VVSGG+ LLQ APRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAG
Sbjct: 2134 VVSGGEALLQNAPRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAG 2193

Query: 253  QEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICL 312
            QEGASEADLS+LP+YRFE  NN+EK GVGAG M+P ET+ GY+ANERILLPEDAECCICL
Sbjct: 2194 QEGASEADLSMLPRYRFEA-NNEEKSGVGAGTMIPTETSSGYLANERILLPEDAECCICL 2252

Query: 313  SSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKGNEQV 359
            SSYEDG ELHALPCNHHFHSTCI KWLKMNATCPLCKYNILKG+EQ+
Sbjct: 2253 SSYEDGAELHALPCNHHFHSTCIAKWLKMNATCPLCKYNILKGSEQI 2299




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255570075|ref|XP_002526000.1| cleavage and polyadenylation specificity factor, putative [Ricinus communis] gi|223534732|gb|EEF36424.1| cleavage and polyadenylation specificity factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224101895|ref|XP_002312464.1| predicted protein [Populus trichocarpa] gi|222852284|gb|EEE89831.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147769549|emb|CAN61404.1| hypothetical protein VITISV_014258 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356521151|ref|XP_003529221.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like [Glycine max] Back     alignment and taxonomy information
>gi|356513054|ref|XP_003525229.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|297838553|ref|XP_002887158.1| hypothetical protein ARALYDRAFT_475916 [Arabidopsis lyrata subsp. lyrata] gi|297332999|gb|EFH63417.1| hypothetical protein ARALYDRAFT_475916 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220639|ref|NP_176974.1| C3HC4-type RING finger domain-containing protein [Arabidopsis thaliana] gi|12324089|gb|AAG52017.1|AC012563_27 putative RING zinc finger protein; 27623-28978 [Arabidopsis thaliana] gi|90093276|gb|ABD85151.1| At1g68070 [Arabidopsis thaliana] gi|332196622|gb|AEE34743.1| C3HC4-type RING finger domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21536719|gb|AAM61051.1| putative RING zinc finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356513052|ref|XP_003525228.1| PREDICTED: E3 ubiquitin protein ligase RIE1-like isoform 1 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query359
TAIR|locus:2200301343 AT1G68070 [Arabidopsis thalian 0.838 0.877 0.540 1.8e-87
TAIR|locus:1005452975359 RIE1 "RING-finger protein for 0.930 0.930 0.514 3.3e-86
TAIR|locus:2195077408 AT1G12760 [Arabidopsis thalian 0.518 0.455 0.471 2.6e-63
TAIR|locus:2139717390 AT4G11680 [Arabidopsis thalian 0.849 0.782 0.431 1.8e-62
TAIR|locus:2098916379 AT3G61180 [Arabidopsis thalian 0.844 0.799 0.403 2.2e-57
TAIR|locus:2015248381 AT1G63170 [Arabidopsis thalian 0.523 0.493 0.466 1.6e-40
TAIR|locus:2125652453 AT4G32600 [Arabidopsis thalian 0.281 0.222 0.403 1.2e-26
TAIR|locus:2034210407 AT1G80400 [Arabidopsis thalian 0.259 0.228 0.41 3.8e-25
TAIR|locus:2133877335 AT4G26580 [Arabidopsis thalian 0.133 0.143 0.479 2.1e-18
TAIR|locus:2161740343 AT5G55970 [Arabidopsis thalian 0.222 0.233 0.35 1.7e-17
TAIR|locus:2200301 AT1G68070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 874 (312.7 bits), Expect = 1.8e-87, P = 1.8e-87
 Identities = 168/311 (54%), Positives = 196/311 (63%)

Query:    48 GPSMLVXXXXXXXXXXXXXDWGYSKPVVALDIMWNSAFVIVSAAMLIITINERPSTRIRL 107
             G SM+V             DWGYSKPVVALD++WN+AFV+V+  ML++   E+P+  IR+
Sbjct:    42 GASMVVRETAAQELEERRADWGYSKPVVALDMLWNTAFVLVAIVMLLVFKEEKPNVPIRI 101

Query:   108 WICGYALQCLVHVVLVWMEYXXXXXXXXXDDEMGGEDFRXXXXXXXXXXXXGIVYRTSTR 167
             WICGYA+QCLVHVVLVW+E+          D    +                       R
Sbjct:   102 WICGYAIQCLVHVVLVWLEFRKRNARSRPGDLEAAQATNQDSEDED----------NDER 151

Query:   168 TSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLXXXXXXXXXXXXXXCVV 227
                TK CES+NT+ SF+WWIVGFYW+VSGGD+LLQ A  LYWL              CVV
Sbjct:   152 FLSTKTCESMNTIISFVWWIVGFYWLVSGGDILLQNATHLYWLTFVFLAFDVFFAIFCVV 211

Query:   228 XXXXXXXXXXXXXXXXXXXXYAVAGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVP 287
                                 YAVAGQEGASEADLSILPKYRF   NNDEK   G GKM+P
Sbjct:   212 LACLIGIALCCCLPCIIALLYAVAGQEGASEADLSILPKYRFHTMNNDEKQSDGGGKMIP 271

Query:   288 IETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPL 347
             ++     + NER+LLPEDA+CCICLSSYEDG EL +LPCNHHFHSTCIVKWLKMNATCPL
Sbjct:   272 VDAASENLGNERVLLPEDADCCICLSSYEDGAELVSLPCNHHFHSTCIVKWLKMNATCPL 331

Query:   348 CKYNILKGNEQ 358
             CK+NILKGNEQ
Sbjct:   332 CKFNILKGNEQ 342




GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0006661 "phosphatidylinositol biosynthetic process" evidence=RCA
TAIR|locus:1005452975 RIE1 "RING-finger protein for embryogenesis" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195077 AT1G12760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139717 AT4G11680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098916 AT3G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015248 AT1G63170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125652 AT4G32600 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034210 AT1G80400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133877 AT4G26580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161740 AT5G55970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00030590001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (355 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-15
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 6e-09
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 1e-08
smart0018440 smart00184, RING, Ring finger 2e-08
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-07
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 7e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 1e-04
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 3e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 7e-04
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.001
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 68.6 bits (168), Expect = 3e-15
 Identities = 23/43 (53%), Positives = 29/43 (67%)

Query: 307 ECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCK 349
           EC ICL  +E G E+  LPC H FH  C+ KWL+ + TCPLC+
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCR 44


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 359
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.76
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.58
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.42
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.35
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.33
PHA02929238 N1R/p28-like protein; Provisional 99.3
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.03
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.0
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.99
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.93
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.93
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.93
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.92
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
PHA02926242 zinc finger-like protein; Provisional 98.76
PF1463444 zf-RING_5: zinc-RING finger domain 98.76
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.73
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.72
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.72
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.67
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.67
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.66
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.62
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.48
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.48
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.4
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.35
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.29
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.23
COG52191525 Uncharacterized conserved protein, contains RING Z 98.17
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.16
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.13
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.06
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.89
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.86
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.86
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.81
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.74
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.64
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.54
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.51
KOG1941518 consensus Acetylcholine receptor-associated protei 97.29
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.23
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 97.06
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.05
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.95
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.89
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.72
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.63
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.48
PHA02862156 5L protein; Provisional 96.45
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.42
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.4
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.33
PHA02825162 LAP/PHD finger-like protein; Provisional 96.05
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.96
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.9
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.79
COG5152259 Uncharacterized conserved protein, contains RING a 95.6
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.52
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.43
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.35
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.16
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.08
PHA03096284 p28-like protein; Provisional 94.92
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 94.66
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.59
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.54
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 93.95
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.74
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.59
KOG2660 331 consensus Locus-specific chromosome binding protei 93.55
COG5222427 Uncharacterized conserved protein, contains RING Z 93.36
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 92.29
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 92.22
KOG1940276 consensus Zn-finger protein [General function pred 92.14
KOG1609 323 consensus Protein involved in mRNA turnover and st 91.62
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 91.16
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 90.78
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.4
PF04641260 Rtf2: Rtf2 RING-finger 89.02
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.54
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.49
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 88.43
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 88.35
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 87.84
KOG3053 293 consensus Uncharacterized conserved protein [Funct 87.26
KOG3002 299 consensus Zn finger protein [General function pred 85.87
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 85.73
KOG0298 1394 consensus DEAD box-containing helicase-like transc 84.48
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.28
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 84.14
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 83.34
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 83.05
KOG03091081 consensus Conserved WD40 repeat-containing protein 82.53
COG5175 480 MOT2 Transcriptional repressor [Transcription] 81.83
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 81.65
KOG3899381 consensus Uncharacterized conserved protein [Funct 81.6
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 80.41
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.76  E-value=8.4e-19  Score=169.90  Aligned_cols=78  Identities=35%  Similarity=0.779  Sum_probs=66.8

Q ss_pred             cCCCCCHHHhhcCCCceeeeccCcccccCCCCcccccccCCCccccccccCCCCccccccCCCccCCCceEEcCCCceeC
Q 018193          252 GQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHFH  331 (359)
Q Consensus       252 ~~~g~s~~~i~~Lp~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~C~ICL~~~~~~~~lr~LpC~H~FH  331 (359)
                      +.++..+..++++|.+.|+...+++                          .. ..|+||||+|++||++|.|||+|.||
T Consensus       203 ~~~r~~k~~l~~~p~~~f~~~~~~~--------------------------~~-~~CaIClEdY~~GdklRiLPC~H~FH  255 (348)
T KOG4628|consen  203 RRNRLIKRLLKKLPVRTFTKGDDED--------------------------AT-DTCAICLEDYEKGDKLRILPCSHKFH  255 (348)
T ss_pred             hhhhhHHHHHhhCCcEEeccccccC--------------------------CC-ceEEEeecccccCCeeeEecCCCchh
Confidence            5567889999999999998755431                          11 58999999999999999999999999


Q ss_pred             hhhHHHhhhcCC-CCCcccccccCCC
Q 018193          332 STCIVKWLKMNA-TCPLCKYNILKGN  356 (359)
Q Consensus       332 ~~CId~WL~~~~-tCPlCR~~I~~~~  356 (359)
                      ..|||+||..+. .||+||+++.++.
T Consensus       256 ~~CIDpWL~~~r~~CPvCK~di~~~~  281 (348)
T KOG4628|consen  256 VNCIDPWLTQTRTFCPVCKRDIRTDS  281 (348)
T ss_pred             hccchhhHhhcCccCCCCCCcCCCCC
Confidence            999999998875 4999999998754



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 7e-10
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 3e-08
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 1e-07
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 2e-07
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 3e-07
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 3e-06
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-05
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 8e-04
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure

Iteration: 1

Score = 61.2 bits (147), Expect = 7e-10, Method: Composition-based stats. Identities = 22/46 (47%), Positives = 29/46 (63%) Query: 304 EDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCK 349 E C +C+ +E L LPCNH FH+ C+ KWLK N TCP+C+ Sbjct: 22 EQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICR 67
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query359
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 4e-26
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 5e-26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 7e-25
2ect_A78 Ring finger protein 126; metal binding protein, st 1e-21
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-21
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-21
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 3e-20
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 8e-16
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 6e-14
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-12
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 9e-12
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-11
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-11
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-10
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 4e-10
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 5e-10
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-09
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 8e-09
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 1e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-06
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 5e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-06
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 6e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 6e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 8e-05
3nw0_A238 Non-structural maintenance of chromosomes element 1e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 1e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 3e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 6e-04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 6e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 8e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 98.6 bits (246), Expect = 4e-26
 Identities = 22/53 (41%), Positives = 30/53 (56%)

Query: 303 PEDAECCICLSSYEDGTELHALPCNHHFHSTCIVKWLKMNATCPLCKYNILKG 355
            E   C +C+  +E    L  LPCNH FH+ C+ KWLK N TCP+C+ +    
Sbjct: 21  SEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADSGPS 73


>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.71
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.69
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.61
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.58
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.58
2ect_A78 Ring finger protein 126; metal binding protein, st 99.57
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.52
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.5
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.47
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.45
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.45
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.45
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.43
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.43
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.41
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.38
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.37
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.37
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.33
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.33
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.32
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.3
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.3
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.28
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.27
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.23
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.23
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.22
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.2
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.19
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.18
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.18
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.17
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.16
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.16
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.16
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.16
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.11
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.01
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.99
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.97
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.95
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.94
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.9
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.88
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.86
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.86
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.86
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.86
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.85
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.84
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.82
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.8
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.78
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.75
2ea5_A68 Cell growth regulator with ring finger domain prot 98.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.61
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.58
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.54
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.51
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.45
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.39
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.32
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.31
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.06
3nw0_A238 Non-structural maintenance of chromosomes element 97.85
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.69
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.43
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.12
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.97
1we9_A64 PHD finger family protein; structural genomics, PH 91.83
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 89.31
1wil_A89 KIAA1045 protein; ring finger domain, structural g 89.26
2k16_A75 Transcription initiation factor TFIID subunit 3; p 88.8
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.76
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 87.81
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.37
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 85.66
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 83.9
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 83.79
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 83.72
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 83.1
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 82.07
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 80.69
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 80.54
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 80.26
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.71  E-value=8.1e-18  Score=133.57  Aligned_cols=78  Identities=29%  Similarity=0.680  Sum_probs=66.2

Q ss_pred             hcCCCCCHHHhhcCCCceeeeccCcccccCCCCcccccccCCCccccccccCCCCccccccCCCccCCCceEEcCCCcee
Q 018193          251 AGQEGASEADLSILPKYRFEVQNNDEKLGVGAGKMVPIETNGGYVANERILLPEDAECCICLSSYEDGTELHALPCNHHF  330 (359)
Q Consensus       251 ~~~~g~s~~~i~~Lp~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~C~ICL~~~~~~~~lr~LpC~H~F  330 (359)
                      ....|++++.++.||.+.+......                          ..++.+|+||+++|.+++.++.|||+|.|
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~~--------------------------~~~~~~C~IC~~~~~~~~~~~~l~C~H~F   65 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHGA--------------------------VGQEMCCPICCSEYVKGDVATELPCHHYF   65 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCSS--------------------------SSSCSEETTTTEECCTTCEEEEETTTEEE
T ss_pred             cCCCCCCHHHHHhCCCeeecccccc--------------------------cCCCCCCcccChhhcCCCcEEecCCCChH
Confidence            3467899999999998776643211                          13457899999999999999999999999


Q ss_pred             ChhhHHHhhhcCCCCCcccccccC
Q 018193          331 HSTCIVKWLKMNATCPLCKYNILK  354 (359)
Q Consensus       331 H~~CId~WL~~~~tCPlCR~~I~~  354 (359)
                      |..||++|++.+.+||+||+.+..
T Consensus        66 h~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           66 HKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             EHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             HHHHHHHHHHcCCcCcCcCccCCC
Confidence            999999999999999999998864



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 359
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 9e-18
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-13
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 7e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 7e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-08
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 4e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 8e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 8e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 9e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 5e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 9e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 74.1 bits (182), Expect = 9e-18
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 302 LPEDAECCICLSSYEDGTELHALP-CNHHFHSTCIVKWLKMNATCPLCKYNIL 353
           + +  EC +CL+  EDG E   LP C H FH+ C+  WL  ++TCPLC+  ++
Sbjct: 2   MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query359
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.73
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.51
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.48
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.46
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.44
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.43
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.21
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.21
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.12
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.12
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.11
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.95
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.9
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.88
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.69
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.5
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.6
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 92.88
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 91.08
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 89.58
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 88.59
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 86.33
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 86.23
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 86.23
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 84.98
d1wema_76 Death associated transcription factor 1, Datf1 (DI 84.06
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 83.95
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.73  E-value=7.3e-19  Score=125.39  Aligned_cols=51  Identities=43%  Similarity=1.102  Sum_probs=47.0

Q ss_pred             CCCccccccCCCccCCCceEEcC-CCceeChhhHHHhhhcCCCCCccccccc
Q 018193          303 PEDAECCICLSSYEDGTELHALP-CNHHFHSTCIVKWLKMNATCPLCKYNIL  353 (359)
Q Consensus       303 ~~~~~C~ICL~~~~~~~~lr~Lp-C~H~FH~~CId~WL~~~~tCPlCR~~I~  353 (359)
                      +++.+|+||+++|++++.++.+| |+|.||.+||++|++++++||+||++|.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            45678999999999999999886 9999999999999999999999999875



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure