Citrus Sinensis ID: 021857


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MAGAGIHTYHQQWPPAPAPPPPPAAAAAAPPPPPPVPYDNTNRIAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
ccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHccccccEEEEEcccccEEEEEcccHHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHccccccEEEEEEEcccccEEEEEEccHHHHHHHHHHHccccccccccccEEEEccccEEccc
ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHcccccccEEEEEcccccEEEEEEccHHHHHHHHHHHcccEEccccccEEEEEHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHcccccEEEEEEEccccEEEEEEEccHHHHHHHHHHHcccEccccccccEEEEccEEEEEcc
magagihtyhqqwppapapppppaaaaaappppppvpydntnriahdeVRTIFITGLPDDVKERELQNLLRWlpgyeasqvnykgekpmgfaLFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRgivadtnaydqskrlrtggdythtgysapspfhappapvwgphgymapppppydpyggygvppvqmpapapvpapssyvpvqntkdnppcntlfignlgesinEEELRglfsaqpgfkqMKVLRQERHTVcfiefedvnsassvhhnlqgavipssgsvgmriqypfccfccs
MAGAGIHTYHQQWPPAPAPPPPPAAAAAAPPPPPPVPYDNTNRIAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKknlfvkrgivadtnaydqskrlRTGGDYTHTGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
MAGAGIHTYHQQWppapapppppaaaaaappppppVPYDNTNRIAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYsapspfhappapVWgphgymapppppydpyggygvppvqmpapapvpapssyvpvqNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
*******************************************IAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYD*******************************************************************************CNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCC*
***************************************************IFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGP*********************VQM*************PVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
*********HQQW*****************PPPPPVPYDNTNRIAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
****GIHTYHQQWPPAPAPPPPPAAA********************DEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNL************************************HAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQM*********SSY*****TKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGAGIHTYHQQWPPAPAPPPPPAAAAAAPPPPPPVPYDNTNRIAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQYPFCCFCCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q93062196 RNA-binding protein with no no 0.313 0.489 0.395 4e-13
Q9WVB0197 RNA-binding protein with no no 0.313 0.487 0.395 9e-13
Q8VC52206 RNA-binding protein with no no 0.310 0.461 0.416 1e-12
Q6ZRY4209 RNA-binding protein with no no 0.271 0.397 0.445 2e-12
O74452561 Cell wall integrity prote yes no 0.542 0.295 0.311 2e-12
Q9W6I1200 RNA-binding protein with yes no 0.271 0.415 0.445 3e-12
Q9YGP5196 RNA-binding protein with N/A no 0.261 0.408 0.45 2e-11
Q01617738 Protein couch potato OS=D yes no 0.284 0.117 0.423 1e-10
P45429282 U1 small nuclear ribonucl N/A no 0.810 0.879 0.248 4e-10
P34761661 Protein WHI3 OS=Saccharom yes no 0.254 0.118 0.388 1e-09
>sp|Q93062|RBPMS_HUMAN RNA-binding protein with multiple splicing OS=Homo sapiens GN=RBPMS PE=1 SV=1 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 54/96 (56%)

Query: 44  IAHDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAA 103
           +  +EVRT+F++GLP D+K REL  L R   GYE S +    ++P+GF  F +   A AA
Sbjct: 18  LQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAA 77

Query: 104 KDALQEMIFDAETKSVLHTEMAKKNLFVKRGIVADT 139
           K+AL  + FD E    L  E AK N  + +  +  T
Sbjct: 78  KNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113




Acts as a coactivator of transcriptional activity. Required to increase TGFB1/Smad-mediated transactivation. Acts through SMAD2, SMAD3 and SMAD4 to increase transcriptional activity. Increases phosphorylation of SMAD2 and SMAD3 on their C-terminal SSXS motif, possibly through recruitment of TGFBR1. Promotes the nuclear accumulation of SMAD2, SMAD3 and SMAD4 proteins. Binds to poly(A) RNA.
Homo sapiens (taxid: 9606)
>sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=2 Back     alignment and function description
>sp|Q8VC52|RBPS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZRY4|RBPS2_HUMAN RNA-binding protein with multiple splicing 2 OS=Homo sapiens GN=RBPMS2 PE=2 SV=1 Back     alignment and function description
>sp|O74452|SCW1_SCHPO Cell wall integrity protein scw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scw1 PE=1 SV=1 Back     alignment and function description
>sp|Q9W6I1|RBPMS_CHICK RNA-binding protein with multiple splicing OS=Gallus gallus GN=RBPMS PE=2 SV=1 Back     alignment and function description
>sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Back     alignment and function description
>sp|Q01617|CPO_DROME Protein couch potato OS=Drosophila melanogaster GN=cpo PE=2 SV=3 Back     alignment and function description
>sp|P45429|SNRPA_XENLA U1 small nuclear ribonucleoprotein A OS=Xenopus laevis GN=snrpa PE=2 SV=1 Back     alignment and function description
>sp|P34761|WHI3_YEAST Protein WHI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WHI3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
224100531302 predicted protein [Populus trichocarpa] 0.970 0.983 0.799 1e-122
298204782299 unnamed protein product [Vitis vinifera] 0.977 1.0 0.862 1e-120
255568059337 RNA-binding protein with multiple splici 0.973 0.884 0.837 1e-120
225443274328 PREDICTED: cell wall integrity protein s 0.973 0.908 0.862 1e-119
224113311281 predicted protein [Populus trichocarpa] 0.820 0.893 0.876 1e-116
449447968335 PREDICTED: U1 small nuclear ribonucleopr 0.973 0.889 0.832 1e-115
9280223317 unnamed protein product [Arabidopsis tha 0.993 0.958 0.769 1e-113
30686138339 RNA recognition motif-containing protein 0.973 0.879 0.781 1e-112
297835092339 hypothetical protein ARALYDRAFT_479641 [ 0.973 0.879 0.785 1e-109
356526326318 PREDICTED: uncharacterized protein LOC10 0.941 0.905 0.769 1e-108
>gi|224100531|ref|XP_002311913.1| predicted protein [Populus trichocarpa] gi|222851733|gb|EEE89280.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 243/304 (79%), Positives = 267/304 (87%), Gaps = 7/304 (2%)

Query: 1   MAGAGIHTYHQQWPPAPAPPPPPAAAAAAPP---PPPPVPYDNTNRI--AHDEVRTIFIT 55
           MAG GIH YHQQWPPA APPPP A  A  P     PP V +DN+NR    H+EVRTIFIT
Sbjct: 1   MAGTGIHPYHQQWPPAQAPPPPTAPGAPPPSIHHAPPHVLFDNSNRGPPTHEEVRTIFIT 60

Query: 56  GLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMIFDAE 115
           G PDDVKERELQNLLRWLPGYEASQVNYKG+K MGFALFS++Q A+AAKD+LQ+M+FD E
Sbjct: 61  GFPDDVKERELQNLLRWLPGYEASQVNYKGDKAMGFALFSSSQHAIAAKDSLQDMVFDVE 120

Query: 116 TKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGP 175
           TKSVLHTEMAKKNLFVKRGIVAD+NAYDQSKRLRTGGDY+H  Y+ PSPF  PP PVWGP
Sbjct: 121 TKSVLHTEMAKKNLFVKRGIVADSNAYDQSKRLRTGGDYSHAAYTTPSPF-HPPPPVWGP 179

Query: 176 HGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESI 235
           HGYMAP PPPYDPYGGY  P V M  PAP+PAPSSYVP+QNTKDNPPCNTLFIGNLG++I
Sbjct: 180 HGYMAPVPPPYDPYGGYPAPQVPM-PPAPIPAPSSYVPIQNTKDNPPCNTLFIGNLGQNI 238

Query: 236 NEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGMR 295
           NE+ELRGLFS QPGFKQMK+LRQERHTVCFIEFED+NSA++VHH+LQGAVIPSSGS+GMR
Sbjct: 239 NEDELRGLFSVQPGFKQMKILRQERHTVCFIEFEDLNSATNVHHSLQGAVIPSSGSIGMR 298

Query: 296 IQYP 299
           IQYP
Sbjct: 299 IQYP 302




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|298204782|emb|CBI25280.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568059|ref|XP_002525006.1| RNA-binding protein with multiple splicing, putative [Ricinus communis] gi|223535714|gb|EEF37378.1| RNA-binding protein with multiple splicing, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225443274|ref|XP_002273578.1| PREDICTED: cell wall integrity protein scw1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224113311|ref|XP_002316452.1| predicted protein [Populus trichocarpa] gi|222865492|gb|EEF02623.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449447968|ref|XP_004141738.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Cucumis sativus] gi|449515829|ref|XP_004164950.1| PREDICTED: U1 small nuclear ribonucleoprotein A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|9280223|dbj|BAB01713.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30686138|ref|NP_683582.2| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|13605613|gb|AAK32800.1|AF361632_1 At3g21211 [Arabidopsis thaliana] gi|23505943|gb|AAN28831.1| At3g21211/At3g21211 [Arabidopsis thaliana] gi|26451397|dbj|BAC42798.1| unknown protein [Arabidopsis thaliana] gi|110740646|dbj|BAE98426.1| hypothetical protein [Arabidopsis thaliana] gi|222423570|dbj|BAH19754.1| AT3G21215 [Arabidopsis thaliana] gi|332642956|gb|AEE76477.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297835092|ref|XP_002885428.1| hypothetical protein ARALYDRAFT_479641 [Arabidopsis lyrata subsp. lyrata] gi|297331268|gb|EFH61687.1| hypothetical protein ARALYDRAFT_479641 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356526326|ref|XP_003531769.1| PREDICTED: uncharacterized protein LOC100817421 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
TAIR|locus:504955737339 AT3G21215 [Arabidopsis thalian 0.519 0.469 0.672 2.1e-94
TAIR|locus:2060015302 AT2G42240 [Arabidopsis thalian 0.369 0.374 0.456 1.2e-35
WB|WBGene00003172312 mec-8 [Caenorhabditis elegans 0.281 0.275 0.428 1e-21
UNIPROTKB|G5ECJ4312 mec-8 "Protein MEC-8" [Caenorh 0.281 0.275 0.428 1e-21
TAIR|locus:2091526296 AT3G13700 [Arabidopsis thalian 0.245 0.253 0.4 1.9e-16
POMBASE|SPCC16C4.07561 scw1 "RNA-binding protein Scw1 0.271 0.147 0.428 4.6e-16
FB|FBgn0263995738 cpo "couch potato" [Drosophila 0.310 0.128 0.405 6.9e-16
ZFIN|ZDB-GENE-040718-106199 rbpms2a "RNA binding protein w 0.330 0.507 0.411 1.8e-14
UNIPROTKB|Q9YGP5196 rbpms "RNA-binding protein wit 0.326 0.510 0.421 2.3e-14
ZFIN|ZDB-GENE-040426-741200 rbpms2b "RNA binding protein w 0.290 0.445 0.438 3e-14
TAIR|locus:504955737 AT3G21215 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 553 (199.7 bits), Expect = 2.1e-94, Sum P(2) = 2.1e-94
 Identities = 113/168 (67%), Positives = 124/168 (73%)

Query:     1 MAGAGIHTYHQQWXXXXXXXXXXXXXXXXXXXXXXVPY---------DNTNRIAHDEVRT 51
             MAGAGIH YHQQW                      + +         DN NR  +DE+RT
Sbjct:     1 MAGAGIHPYHQQWPPAGAPPPPAAVSSAAPPHPPPIHHHPPPPPVLVDNHNRPPYDELRT 60

Query:    52 IFITGLPDDVKERELQNLLRWLPGYEASQVNYKGEKPMGFALFSTAQLAVAAKDALQEMI 111
             IFI GLPDDVKEREL NLLRWLPGYEASQVN+KGEKPMGFALFSTAQ A+AAKD LQ M+
Sbjct:    61 IFIAGLPDDVKERELLNLLRWLPGYEASQVNFKGEKPMGFALFSTAQFAMAAKDTLQHMV 120

Query:   112 FDAETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGY 159
             FDAE+KSV+HTEMAKKNLFVKRGIV D+NAYDQSKRLRTGGD TH+ Y
Sbjct:   121 FDAESKSVIHTEMAKKNLFVKRGIVGDSNAYDQSKRLRTGGDCTHSVY 168


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
TAIR|locus:2060015 AT2G42240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003172 mec-8 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|G5ECJ4 mec-8 "Protein MEC-8" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2091526 AT3G13700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPCC16C4.07 scw1 "RNA-binding protein Scw1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0263995 cpo "couch potato" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-106 rbpms2a "RNA binding protein with multiple splicing 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YGP5 rbpms "RNA-binding protein with multiple splicing" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-741 rbpms2b "RNA binding protein with multiple splicing 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VIII.2345.1
hypothetical protein (302 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 4e-43
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 3e-32
cd1268376 cd12683, RRM_RBPMS2, RNA recognition motif in vert 6e-13
cd1268483 cd12684, RRM_cpo, RNA recognition motif in Drosoph 9e-13
cd1268276 cd12682, RRM_RBPMS, RNA recognition motif in verte 2e-12
smart0036073 smart00360, RRM, RNA recognition motif 2e-10
cd1248180 cd12481, RRM2_U2B, RNA recognition motif 2 found i 8e-10
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 9e-10
pfam0007670 pfam00076, RRM_1, RNA recognition motif 9e-09
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 1e-08
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-08
cd1248080 cd12480, RRM2_U1A, RNA recognition motif 2 found i 3e-08
cd1247980 cd12479, RRM2_SNF, RNA recognition motif 2 found i 1e-07
cd1224579 cd12245, RRM_scw1_like, RNA recognition motif in y 7e-07
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 1e-06
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-06
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 6e-06
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 7e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 8e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 2e-05
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 4e-05
pfam11221132 pfam11221, Med21, Subunit 21 of Mediator complex 5e-05
smart0036073 smart00360, RRM, RNA recognition motif 6e-05
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-05
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 7e-05
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 7e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 9e-05
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 9e-05
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 9e-05
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-04
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-04
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 1e-04
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 4e-04
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 5e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 7e-04
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 8e-04
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 0.001
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 0.001
pfam1013898 pfam10138, Tellurium_res, Tellurium resistance pro 0.001
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 0.002
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 0.002
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.002
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 0.002
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 0.002
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 0.002
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.002
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 0.003
PRK14965576 PRK14965, PRK14965, DNA polymerase III subunits ga 0.003
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.003
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 0.003
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.003
pfam1013898 pfam10138, Tellurium_res, Tellurium resistance pro 0.004
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.004
cd1222884 cd12228, RRM_ENOX, RNA recognition motif (RRM) in 0.004
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 0.004
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
 Score =  142 bits (360), Expect = 4e-43
 Identities = 42/78 (53%), Positives = 57/78 (73%)

Query: 222 PCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVHHNL 281
           PCNTLF+ NLG +  EEELR LFS QPGF+++K+  +    VCF+EFEDV+ A+   ++L
Sbjct: 1   PCNTLFVANLGPNTTEEELRQLFSRQPGFRRLKMHNKGGGPVCFVEFEDVSFATQALNSL 60

Query: 282 QGAVIPSSGSVGMRIQYP 299
           QGAV+ SS   G+RI+Y 
Sbjct: 61  QGAVLSSSDRGGIRIEYA 78


This subfamily corresponds to the RRM of the family including yeast cell wall integrity protein scw1, yeast Whi3 protein, yeast Whi4 protein and similar proteins. The strong cell wall protein 1, scw1, is a nonessential cytoplasmic RNA-binding protein that regulates septation and cell-wall structure in fission yeast. It may function as an inhibitor of septum formation, such that its loss of function allows weak SIN signaling to promote septum formation. It's RRM domain shows high homology to two budding yeast proteins, Whi3 and Whi4. Whi3 is a dose-dependent modulator of cell size and has been implicated in cell cycle control in the yeast Saccharomyces cerevisiae. It functions as a negative regulator of ceroid-lipofuscinosis, neuronal 3 (Cln3), a G1 cyclin that promotes transcription of many genes to trigger the G1/S transition in budding yeast. It specifically binds the CLN3 mRNA and localizes it into discrete cytoplasmic loci that may locally restrict Cln3 synthesis to modulate cell cycle progression. Moreover, Whi3 plays a key role in cell fate determination in budding yeast. The RRM domain is essential for Whi3 function. Whi4 is a partially redundant homolog of Whi3, also containing one RRM. Some uncharacterized family members of this subfamily contain two RRMs; their RRM1 shows high sequence homology to the RRM of RNA-binding protein with multiple splicing (RBP-MS)-like proteins. Length = 79

>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|241127 cd12683, RRM_RBPMS2, RNA recognition motif in vertebrate RNA-binding protein with multiple splicing 2 (RBP-MS2) Back     alignment and domain information
>gnl|CDD|241128 cd12684, RRM_cpo, RNA recognition motif in Drosophila couch potato (cpo) coding RNA-binding protein and similar proteins Back     alignment and domain information
>gnl|CDD|241126 cd12682, RRM_RBPMS, RNA recognition motif in vertebrate RNA-binding protein with multiple splicing (RBP-MS) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240925 cd12481, RRM2_U2B, RNA recognition motif 2 found in vertebrate U2 small nuclear ribonucleoprotein B" (U2B") Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240924 cd12480, RRM2_U1A, RNA recognition motif 2 found in vertebrate U1 small nuclear ribonucleoprotein A (U1 snRNP A or U1-A or U1A) Back     alignment and domain information
>gnl|CDD|240923 cd12479, RRM2_SNF, RNA recognition motif 2 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240691 cd12245, RRM_scw1_like, RNA recognition motif in yeast cell wall integrity protein scw1 and similar proteins Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|204614 pfam11221, Med21, Subunit 21 of Mediator complex Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|220596 pfam10138, Tellurium_res, Tellurium resistance protein Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|220596 pfam10138, Tellurium_res, Tellurium resistance protein Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240674 cd12228, RRM_ENOX, RNA recognition motif (RRM) in the cell surface Ecto-NOX disulfide-thiol exchanger (ECTO-NOX or ENOX) proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.98
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.97
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.97
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.96
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.96
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.96
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.96
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.96
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.95
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.95
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.95
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.95
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.94
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.94
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.94
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.93
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.93
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.93
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.92
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.92
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.91
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.91
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.91
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.9
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.88
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.85
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.85
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.84
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.81
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.81
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 99.81
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 99.79
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.78
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 99.74
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.73
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 99.73
KOG0110 725 consensus RNA-binding protein (RRM superfamily) [G 99.68
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.67
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.67
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.65
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.63
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 99.63
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.62
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.62
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.61
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.6
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.6
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.56
KOG0107 195 consensus Alternative splicing factor SRp20/9G8 (R 99.55
PLN03120 260 nucleic acid binding protein; Provisional 99.53
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.5
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.49
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.48
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.48
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.47
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.47
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.46
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.46
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.46
PLN03121 243 nucleic acid binding protein; Provisional 99.44
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.43
PLN03120260 nucleic acid binding protein; Provisional 99.42
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.41
PLN03213 759 repressor of silencing 3; Provisional 99.41
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.41
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.4
KOG0122270 consensus Translation initiation factor 3, subunit 99.4
KOG0122270 consensus Translation initiation factor 3, subunit 99.39
smart0036272 RRM_2 RNA recognition motif. 99.39
KOG4206 221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.38
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.38
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.35
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.34
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.34
PLN03213 759 repressor of silencing 3; Provisional 99.32
smart0036071 RRM RNA recognition motif. 99.32
KOG0105 241 consensus Alternative splicing factor ASF/SF2 (RRM 99.31
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.29
KOG0129520 consensus Predicted RNA-binding protein (RRM super 99.28
PLN03121243 nucleic acid binding protein; Provisional 99.27
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.27
KOG0149 247 consensus Predicted RNA-binding protein SEB4 (RRM 99.26
smart0036272 RRM_2 RNA recognition motif. 99.25
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.25
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.25
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.23
KOG4207256 consensus Predicted splicing factor, SR protein su 99.23
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.22
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 99.21
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.2
KOG0111 298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.19
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.18
KOG4207 256 consensus Predicted splicing factor, SR protein su 99.17
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.16
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.14
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.14
COG0724 306 RNA-binding proteins (RRM domain) [General functio 99.14
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.14
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.12
KOG4660 549 consensus Protein Mei2, essential for commitment t 99.12
smart0036071 RRM RNA recognition motif. 99.1
KOG0153377 consensus Predicted RNA-binding protein (RRM super 99.1
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.09
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.08
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 99.07
KOG0131 203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.06
smart0036170 RRM_1 RNA recognition motif. 98.97
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.96
KOG0120 500 consensus Splicing factor U2AF, large subunit (RRM 98.96
KOG1457 284 consensus RNA binding protein (contains RRM repeat 98.94
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.91
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.91
smart0036170 RRM_1 RNA recognition motif. 98.88
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 98.86
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.83
KOG0151 877 consensus Predicted splicing regulator, contains R 98.81
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 98.8
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.8
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.77
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.77
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.72
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.63
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.63
KOG0226290 consensus RNA-binding proteins [General function p 98.63
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.61
KOG4210285 consensus Nuclear localization sequence binding pr 98.6
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.59
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.57
KOG0106 216 consensus Alternative splicing factor SRp55/B52/SR 98.55
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.47
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.44
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 98.43
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.41
KOG4454 267 consensus RNA binding protein (RRM superfamily) [G 98.4
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.4
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.4
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.38
KOG0151 877 consensus Predicted splicing regulator, contains R 98.37
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.35
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.34
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.33
KOG1548 382 consensus Transcription elongation factor TAT-SF1 98.27
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 98.18
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.16
KOG0226290 consensus RNA-binding proteins [General function p 98.09
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.9
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.87
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 97.86
KOG1855 484 consensus Predicted RNA-binding protein [General f 97.85
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.79
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.66
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.59
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.56
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.39
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.34
KOG1995 351 consensus Conserved Zn-finger protein [General fun 97.25
KOG3152 278 consensus TBP-binding protein, activator of basal 97.23
KOG2314 698 consensus Translation initiation factor 3, subunit 97.22
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 97.16
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 97.08
KOG4210285 consensus Nuclear localization sequence binding pr 97.02
KOG2314 698 consensus Translation initiation factor 3, subunit 97.01
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 96.98
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 96.94
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.93
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 96.79
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.76
KOG1995351 consensus Conserved Zn-finger protein [General fun 96.66
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.64
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 96.63
KOG0129520 consensus Predicted RNA-binding protein (RRM super 96.61
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.59
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 96.59
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 96.56
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.51
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 96.46
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.3
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.26
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.2
KOG2068 327 consensus MOT2 transcription factor [Transcription 96.19
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 96.14
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.13
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.95
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 95.94
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 95.93
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 95.9
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.72
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.62
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.6
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.6
KOG3152278 consensus TBP-binding protein, activator of basal 95.4
KOG1855484 consensus Predicted RNA-binding protein [General f 95.37
KOG4410396 consensus 5-formyltetrahydrofolate cyclo-ligase [C 94.06
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.85
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 93.84
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.78
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 93.77
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.6
KOG2068327 consensus MOT2 transcription factor [Transcription 92.19
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 91.81
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 91.68
KOG2591 684 consensus c-Mpl binding protein, contains La domai 91.54
KOG1996378 consensus mRNA splicing factor [RNA processing and 91.32
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 91.24
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 90.96
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 88.32
KOG2318 650 consensus Uncharacterized conserved protein [Funct 87.23
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 85.63
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 83.87
KOG2135526 consensus Proteins containing the RNA recognition 83.82
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 81.66
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 81.54
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
Probab=99.98  E-value=2e-31  Score=242.75  Aligned_cols=157  Identities=18%  Similarity=0.259  Sum_probs=134.2

Q ss_pred             CCCCceEEEcCCCCCCCHHHHHHHHhhcCCCcCcEEEee--------CCcCeEEEEeCCHHHHHHHHHHhcCceeCCCCC
Q 021857           46 HDEVRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYK--------GEKPMGFALFSTAQLAVAAKDALQEMIFDAETK  117 (306)
Q Consensus        46 ~~~~~~LfV~nLp~~~tee~L~~~f~~~~~~~g~iv~~~--------~~kg~aFV~F~~~~~A~~Al~~l~g~~~~~~~g  117 (306)
                      ....++|||+|||+++||++|+++|+.|    |.|+.++        .+||||||+|.+.++|++|++.|+|..+.   +
T Consensus       104 ~~~~~~LfVgnLp~~~te~~L~~lF~~~----G~V~~v~i~~d~~tg~srGyaFVeF~~~e~A~~Ai~~LnG~~l~---g  176 (346)
T TIGR01659       104 NNSGTNLIVNYLPQDMTDRELYALFRTI----GPINTCRIMRDYKTGYSFGYAFVDFGSEADSQRAIKNLNGITVR---N  176 (346)
T ss_pred             CCCCcEEEEeCCCCCCCHHHHHHHHHhc----CCEEEEEEEecCCCCccCcEEEEEEccHHHHHHHHHHcCCCccC---C
Confidence            4568999999999999999999999999    8874431        24699999999999999999999999998   7


Q ss_pred             CeEEEEEccccchhccccccCCccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 021857          118 SVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPV  197 (306)
Q Consensus       118 ~~i~V~~a~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (306)
                      +.|+|.|++......                                                                 
T Consensus       177 r~i~V~~a~p~~~~~-----------------------------------------------------------------  191 (346)
T TIGR01659       177 KRLKVSYARPGGESI-----------------------------------------------------------------  191 (346)
T ss_pred             ceeeeeccccccccc-----------------------------------------------------------------
Confidence            999999874321100                                                                 


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEcCCCCCCCHHHHHHhhccCCCceEEEEEecCC----cceEEEEECCHHH
Q 021857          198 QMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQER----HTVCFIEFEDVNS  273 (306)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~~~~~~~~tLfV~NLp~~~t~e~L~~~F~~~G~i~~vkl~~~~~----~g~aFV~F~~~~~  273 (306)
                                              ..++|||+|||.++|+++|+++|+.||.|+.++|+.+..    +|||||+|++.++
T Consensus       192 ------------------------~~~~lfV~nLp~~vtee~L~~~F~~fG~V~~v~i~~d~~tg~~kG~aFV~F~~~e~  247 (346)
T TIGR01659       192 ------------------------KDTNLYVTNLPRTITDDQLDTIFGKYGQIVQKNILRDKLTGTPRGVAFVRFNKREE  247 (346)
T ss_pred             ------------------------ccceeEEeCCCCcccHHHHHHHHHhcCCEEEEEEeecCCCCccceEEEEEECCHHH
Confidence                                    135699999999999999999999999999999996542    3899999999999


Q ss_pred             HHHHHHHhCCceeCCC-CceeE-EeeC
Q 021857          274 ASSVHHNLQGAVIPSS-GSVGM-RIQY  298 (306)
Q Consensus       274 A~~Ai~~lnG~~i~~~-~~~~i-~~k~  298 (306)
                      |++||+.|||..|.+. .+++| |++.
T Consensus       248 A~~Ai~~lng~~~~g~~~~l~V~~a~~  274 (346)
T TIGR01659       248 AQEAISALNNVIPEGGSQPLTVRLAEE  274 (346)
T ss_pred             HHHHHHHhCCCccCCCceeEEEEECCc
Confidence            9999999999999764 57888 8764



This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4410 consensus 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2u1a_A88 Rna Binding Domain 2 Of Human U1a Protein, Nmr, 20 2e-07
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 3e-07
2b0g_A83 Solution Structure Of Drosophila Melanogaster Snf R 3e-06
>pdb|2U1A|A Chain A, Rna Binding Domain 2 Of Human U1a Protein, Nmr, 20 Structures Length = 88 Back     alignment and structure

Iteration: 1

Score = 52.8 bits (125), Expect = 2e-07, Method: Composition-based stats. Identities = 29/80 (36%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Query: 219 DNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIEFEDVNSASSVH 278 +NPP + LF+ NL E NE L LF+ PGFK+++++ RH + F+EF++ A + Sbjct: 9 ENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLV-PGRHDIAFVEFDNEVQAGAAR 67 Query: 279 HNLQGAVIPSSGSVGMRIQY 298 LQG I + + M+I + Sbjct: 68 DALQGFKITQNNA--MKISF 85
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|2B0G|A Chain A, Solution Structure Of Drosophila Melanogaster Snf Rbd2 Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-30
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 6e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-17
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-10
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-10
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 3e-10
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 6e-04
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-10
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-04
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-09
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-07
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-09
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-09
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 4e-05
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 8e-04
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 6e-09
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 9e-04
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 8e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-07
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-08
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-08
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-05
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 6e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 6e-08
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 8e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-07
2div_A99 TRNA selenocysteine associated protein; structural 1e-07
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-07
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-07
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-07
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-07
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 9e-07
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-07
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-07
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 4e-07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 5e-07
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 6e-07
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-05
3n9u_C156 Cleavage and polyadenylation specificity factor S; 6e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 8e-04
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 8e-07
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 9e-07
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 9e-07
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-05
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-06
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-06
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 6e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-06
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-06
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-06
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 3e-06
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-06
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-06
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 5e-06
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 5e-06
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-06
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-06
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 7e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-06
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 8e-06
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 8e-06
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 8e-06
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 8e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 9e-06
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-05
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-05
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-05
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-05
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 6e-05
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-05
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-05
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-04
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-05
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-05
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-05
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-05
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-05
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-05
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 6e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-04
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-05
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 3e-05
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-05
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 4e-05
1x5o_A114 RNA binding motif, single-stranded interacting pro 5e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-05
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-05
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 6e-05
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 6e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 6e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 6e-05
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 8e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 8e-05
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 8e-05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-04
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 8e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-04
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-04
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-04
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 7e-04
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-04
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-04
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-04
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-04
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 3e-04
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-04
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 5e-04
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-04
1x5p_A97 Negative elongation factor E; structure genomics, 5e-04
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-04
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 5e-04
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 5e-04
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 7e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 7e-04
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 7e-04
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 9e-04
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
 Score =  114 bits (286), Expect = 3e-30
 Identities = 60/273 (21%), Positives = 96/273 (35%), Gaps = 27/273 (9%)

Query: 50  RTIFITGLPDDVKERELQNLLRWL---PGYEASQVNYKGEKPMGFAL--FSTAQLAVAAK 104
            TI+I  L + +K+ EL+  L  +    G     +  +  K  G A   F     A  A 
Sbjct: 10  HTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNAL 69

Query: 105 DALQEMIFD--------AETKSVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTH 156
            ++Q   F         A+T S +  +M    +   R          ++   +       
Sbjct: 70  RSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGG 129

Query: 157 TGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMPAPAPVPAPSSYVPVQN 216
                 +     P               P  P        +  P  AP   P   +P Q 
Sbjct: 130 ATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQ 189

Query: 217 TK-----------DNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCF 265
                        +NPP + LF+ NL E  NE  L  LF+  PGFK++++    RH + F
Sbjct: 190 LMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRL-VPGRHDIAF 248

Query: 266 IEFEDVNSASSVHHNLQGAVIPSSGSVGMRIQY 298
           +EF++   A +    LQG  I  +    M+I +
Sbjct: 249 VEFDNEVQAGAARDALQGFKITQNN--AMKISF 279


>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 100.0
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.98
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.98
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.98
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.97
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.97
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.96
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.96
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.89
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.87
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.84
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.8
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.8
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.78
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.78
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.78
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.78
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.77
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.77
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.77
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.77
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.77
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.76
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.76
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.76
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.76
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.76
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.75
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.75
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.75
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.75
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.75
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.75
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.75
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.75
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.75
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.75
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.75
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.75
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.75
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.75
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.75
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.75
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.75
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.75
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.74
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.74
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.74
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.74
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.74
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.74
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.74
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.74
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.74
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.74
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.74
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.74
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.74
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.74
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.74
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.74
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.74
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.74
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.74
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.73
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.73
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.73
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.73
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.73
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.73
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.73
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.73
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.73
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.73
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.73
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.73
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.73
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.73
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.73
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.73
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.73
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.73
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.73
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.73
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.73
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.73
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.73
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.72
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.72
2div_A99 TRNA selenocysteine associated protein; structural 99.72
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.72
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.72
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.72
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.72
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.72
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.72
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.72
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.72
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.72
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.72
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.72
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.72
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.72
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.72
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.72
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.71
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.71
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.71
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.71
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.71
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.71
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.71
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.71
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.71
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.71
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.71
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.71
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.71
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.71
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.71
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.71
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.71
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.71
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.71
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.71
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.71
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.71
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.71
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.71
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.71
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.71
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.7
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.7
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.7
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.7
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.7
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.7
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.7
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.7
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.7
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.7
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.7
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.7
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.7
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.7
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.7
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.7
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.7
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.7
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.7
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.7
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.7
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.69
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.69
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.69
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.69
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.69
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.69
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.69
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.69
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.69
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.69
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.69
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.69
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.69
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.69
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.69
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.69
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.69
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.68
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.68
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.68
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.68
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.68
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.68
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.68
1x5p_A97 Negative elongation factor E; structure genomics, 99.68
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.68
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.68
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.68
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.68
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.68
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.68
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.68
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.68
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.68
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.68
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.68
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.68
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.68
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.68
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.68
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.68
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.68
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.67
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.67
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.67
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.67
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.67
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.67
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.67
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.67
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.67
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.67
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.67
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.67
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.67
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.67
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.67
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.66
2div_A99 TRNA selenocysteine associated protein; structural 99.66
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.66
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.66
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.66
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.66
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.66
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.66
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.66
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.66
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.66
1x5p_A97 Negative elongation factor E; structure genomics, 99.65
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.65
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.65
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.65
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.65
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.65
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.65
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.65
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.65
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.65
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.65
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.65
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.65
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.65
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.65
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.65
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.65
2dis_A109 Unnamed protein product; structural genomics, RRM 99.65
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.65
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.64
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.64
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.64
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.64
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.64
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.64
2dis_A109 Unnamed protein product; structural genomics, RRM 99.64
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.64
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.64
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.64
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.63
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.63
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.63
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.63
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.63
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.63
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.63
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.63
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.63
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.62
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.62
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.62
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.62
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.62
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.62
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.62
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.62
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.61
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.61
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.61
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.61
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.61
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.61
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.61
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.61
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.61
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.61
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.6
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.6
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.6
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.6
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.6
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.6
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.38
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.59
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.59
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.59
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.59
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.58
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.58
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.58
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.58
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.58
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.58
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.58
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.57
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.57
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.57
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.57
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.57
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.56
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.56
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.56
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.56
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.56
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.56
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.32
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.55
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.55
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.55
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.55
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.55
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.54
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 99.54
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.54
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.53
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.53
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.53
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.53
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 99.53
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.51
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.51
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.5
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.5
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.49
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.48
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.48
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.48
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.47
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.47
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.47
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.47
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.45
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.45
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.45
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.43
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.43
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.42
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.4
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.4
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.4
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.37
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.34
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.32
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.28
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.23
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.23
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.21
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.21
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.21
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.15
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.02
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.99
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.91
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.75
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.68
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.66
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.4
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.2
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.06
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.82
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.75
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.69
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.65
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.65
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.63
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.55
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.2
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.07
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.86
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.79
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.69
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.35
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.9
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.58
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.37
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 92.09
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 90.47
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 88.62
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
Probab=100.00  E-value=7.1e-34  Score=252.93  Aligned_cols=240  Identities=23%  Similarity=0.363  Sum_probs=149.8

Q ss_pred             CCCceEEEcCCCCCCCHHHHH----HHHhhcCCCcCcEEEee-----CCcCeEEEEeCCHHHHHHHHHHhcCceeCCCCC
Q 021857           47 DEVRTIFITGLPDDVKERELQ----NLLRWLPGYEASQVNYK-----GEKPMGFALFSTAQLAVAAKDALQEMIFDAETK  117 (306)
Q Consensus        47 ~~~~~LfV~nLp~~~tee~L~----~~f~~~~~~~g~iv~~~-----~~kg~aFV~F~~~~~A~~Al~~l~g~~~~~~~g  117 (306)
                      .++++|||+|||+++|+++|+    ++|+.|    |.|+.++     ..||||||+|.+.++|++|++.|||..|.   |
T Consensus         7 ~~~~~l~V~nlp~~~~~~~l~~~L~~~F~~~----G~i~~v~~~~~~~~~g~afV~f~~~~~a~~A~~~l~g~~~~---g   79 (282)
T 3pgw_A            7 RPNHTIYINNLNEKIKKDELKKSLYAIFSQF----GQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFY---D   79 (282)
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHHHHhcc----CCeEEEEEcCCCCcceEEEEEECCHHHHHHHHHHhcCCeeC---C
Confidence            568999999999999999987    677777    9986653     24699999999999999999999999998   8


Q ss_pred             CeEEEEEccccchhccccccCCccccccccccCCCCCCC----------------CCCCCCCCCCCC------CC---CC
Q 021857          118 SVLHTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTH----------------TGYSAPSPFHAP------PA---PV  172 (306)
Q Consensus       118 ~~i~V~~a~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~----------------~~~~~~~~~~~~------~~---~~  172 (306)
                      +.|+|.|++.........  .+...++.+..........                ............      +.   .+
T Consensus        80 ~~l~v~~a~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (282)
T 3pgw_A           80 KPMRIQYAKTDSDIIAKM--KGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHM  157 (282)
T ss_pred             cEEEEEEeccCcchhhhh--cCCcccchhhhhhhhccccchhhhhhhccCcCCcccCCCCCCCCCCCCcccccccccccC
Confidence            999999997665421111  1111111110000000000                000000000000      00   00


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEcCCCCCCCHHHHHHhhccCCCce
Q 021857          173 WGPHGYMAPPPPPYDPYGGYGVPP-VQMPAPAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFK  251 (306)
Q Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~tLfV~NLp~~~t~e~L~~~F~~~G~i~  251 (306)
                      .+...++.+  +...+..+..... ...........+...+........+++++|||+|||.++|+++|+++|+.||.|+
T Consensus       158 ~g~~~~~~~--p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nl~~~~~~~~l~~~F~~~G~i~  235 (282)
T 3pgw_A          158 PGQPPYMPP--PGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFK  235 (282)
T ss_pred             CCCCCCCCC--CCCCCCCCCCccccCcccCcccccCccccCccCCccCCCCCCEEEEeCCCCcCCHHHHHHHHHhcCCeE
Confidence            000011100  0000000000000 0000011111122222333344566789999999999999999999999999999


Q ss_pred             EEEEEecCCcceEEEEECCHHHHHHHHHHhCCceeCCCCceeE-EeeC
Q 021857          252 QMKVLRQERHTVCFIEFEDVNSASSVHHNLQGAVIPSSGSVGM-RIQY  298 (306)
Q Consensus       252 ~vkl~~~~~~g~aFV~F~~~~~A~~Ai~~lnG~~i~~~~~~~i-~~k~  298 (306)
                      +|+++. .++|||||+|.+.++|.+|++.|||+.|.++..|+| |+|.
T Consensus       236 ~v~~~~-~~~g~afV~f~~~~~A~~A~~~l~g~~~~~g~~l~v~~akk  282 (282)
T 3pgw_A          236 EVRLVP-GRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK  282 (282)
T ss_pred             EEEEec-CCCcEEEEEeCCHHHHHHHHHHcCCcEeCCCCEEEEEEecC
Confidence            999996 445899999999999999999999999995668999 9984



>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 5e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-04
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-09
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 0.002
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-09
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.002
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 4e-05
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 6e-09
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 7e-09
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-04
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 8e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-04
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 8e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-04
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 9e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 1e-08
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-08
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-05
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 3e-08
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-08
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 3e-08
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-08
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-08
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-06
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 8e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-04
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 9e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 7e-05
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 1e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.002
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-07
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 0.004
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 6e-05
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-07
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 4e-05
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-07
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-07
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-04
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-07
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-04
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 4e-07
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-07
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.001
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 8e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 0.002
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 1e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 2e-04
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 0.002
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 9e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.002
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-06
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 4e-06
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 0.004
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 5e-06
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 0.001
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 6e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 9e-06
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-05
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 0.003
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-04
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 4e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 5e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 7e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-04
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 9e-05
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 0.001
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 2e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-04
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-04
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 4e-04
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 5e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 6e-04
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 0.002
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 7e-04
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 0.001
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 0.001
d2gqba1130 a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { 0.003
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.004
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 0.004
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 0.004
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nucleolysin TIAR
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.9 bits (124), Expect = 2e-09
 Identities = 15/79 (18%), Positives = 35/79 (44%), Gaps = 3/79 (3%)

Query: 208 PSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQERHTVCFIE 267
              +  V N + +P   T++ G +   + ++ +R  FS      +++V  ++ +   F+ 
Sbjct: 4   QLRFEDVVN-QSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGY--SFVR 60

Query: 268 FEDVNSASSVHHNLQGAVI 286
           F    SA+    ++ G  I
Sbjct: 61  FSTHESAAHAIVSVNGTTI 79


>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.96
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.86
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.85
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.82
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.8
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.8
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.79
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.79
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.79
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.79
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.79
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.78
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.78
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.78
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.78
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.78
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.78
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.78
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.78
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.78
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.78
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.78
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.77
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.77
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.77
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.77
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.77
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.77
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.77
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.77
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.77
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.77
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.77
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.76
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.76
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.76
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.76
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.76
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.76
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.75
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.75
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.75
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.75
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.75
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.75
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.75
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.75
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.75
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.74
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.74
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.74
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.74
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.74
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.74
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.74
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.74
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.74
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.74
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.73
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.73
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.73
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.73
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.73
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.73
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.73
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.72
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.72
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.72
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.72
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.72
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.72
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.71
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.71
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.71
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.71
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.71
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.71
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.71
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.71
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.7
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.7
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.7
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.7
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.69
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.69
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.69
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.69
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.69
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.69
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.69
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.69
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.69
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.69
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.68
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.68
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.68
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.68
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.68
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.68
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.68
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.68
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.68
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.68
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.67
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.67
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.67
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.67
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.67
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.67
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.66
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.66
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.66
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.66
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.66
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.65
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.64
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.64
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.63
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.63
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.62
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.62
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.61
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.6
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.59
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.58
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.57
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.57
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.56
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.56
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.53
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.53
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.51
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.46
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.42
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.41
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.4
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.39
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.36
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.34
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.32
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.18
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.7
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.59
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.42
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.37
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.24
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.98
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.31
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.31
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=3.3e-28  Score=200.87  Aligned_cols=157  Identities=17%  Similarity=0.303  Sum_probs=124.4

Q ss_pred             CceEEEcCCCCCCCHHHHHHHHhhcCCCcCcEEEee--------CCcCeEEEEeCCHHHHHHHHHHhcCceeCCCCCCeE
Q 021857           49 VRTIFITGLPDDVKERELQNLLRWLPGYEASQVNYK--------GEKPMGFALFSTAQLAVAAKDALQEMIFDAETKSVL  120 (306)
Q Consensus        49 ~~~LfV~nLp~~~tee~L~~~f~~~~~~~g~iv~~~--------~~kg~aFV~F~~~~~A~~Al~~l~g~~~~~~~g~~i  120 (306)
                      .|||||+|||+.+|+++|+++|++|    |.|+.+.        ..+|||||+|.+.++|.+|+.. .+..+.   ++.+
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~----G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~-~~~~~~---~~~~   77 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQW----GTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNA-RPHKVD---GRVV   77 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGG----SCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHT-CSCEET---TEEC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHc----CCEEEEEeeecccCCCccCceecccCCHHHHHHHHHh-cCCccc---ccch
Confidence            5899999999999999999999999    8885442        2369999999999999999995 455555   4666


Q ss_pred             EEEEccccchhccccccCCccccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q 021857          121 HTEMAKKNLFVKRGIVADTNAYDQSKRLRTGGDYTHTGYSAPSPFHAPPAPVWGPHGYMAPPPPPYDPYGGYGVPPVQMP  200 (306)
Q Consensus       121 ~V~~a~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  200 (306)
                      .+...........                                                                   
T Consensus        78 ~~~~~~~~~~~~~-------------------------------------------------------------------   90 (183)
T d1u1qa_          78 EPKRAVSREDSQR-------------------------------------------------------------------   90 (183)
T ss_dssp             EEEECCCTTGGGS-------------------------------------------------------------------
T ss_pred             hhhhhhhcccccc-------------------------------------------------------------------
Confidence            6555422221110                                                                   


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEEcCCCCCCCHHHHHHhhccCCCceEEEEEecCC----cceEEEEECCHHHHHH
Q 021857          201 APAPVPAPSSYVPVQNTKDNPPCNTLFIGNLGESINEEELRGLFSAQPGFKQMKVLRQER----HTVCFIEFEDVNSASS  276 (306)
Q Consensus       201 ~~~~~~~~~~~~~~~~~~~~~~~~tLfV~NLp~~~t~e~L~~~F~~~G~i~~vkl~~~~~----~g~aFV~F~~~~~A~~  276 (306)
                                      .......++|||+|||..+|+++|+++|+.||.|..++++.+..    +|||||+|.++++|.+
T Consensus        91 ----------------~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A~~  154 (183)
T d1u1qa_          91 ----------------PGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDK  154 (183)
T ss_dssp             ----------------TTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHHHH
T ss_pred             ----------------cccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHHHH
Confidence                            00111367899999999999999999999999999999986432    3899999999999999


Q ss_pred             HHHHhCCceeCCCCceeE-EeeC
Q 021857          277 VHHNLQGAVIPSSGSVGM-RIQY  298 (306)
Q Consensus       277 Ai~~lnG~~i~~~~~~~i-~~k~  298 (306)
                      ||+ ++|..|.| .+++| ++..
T Consensus       155 Al~-~~~~~~~G-~~i~V~~A~~  175 (183)
T d1u1qa_         155 IVI-QKYHTVNG-HNCEVRKALS  175 (183)
T ss_dssp             HHT-SSCEEETT-EEEEEEECCC
T ss_pred             HHH-hCCCeECC-EEEEEEecCC
Confidence            997 79999985 57999 8754



>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure