Citrus Sinensis ID: 023442


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MPSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSVLDSPIEEAPRGREDLFADVHDLLPPPYKAREQEVLYAY
ccccccccHHHcccccccccccccHHHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHcccccccccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccEEEEHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHcc
cccccccccHccccccEEHHHcccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEHHHHHHHHcccccHHccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEcHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHccHHHccccccccccccccHcccHHcccccccccccEEEEEEc
mpscgcpspkvaghgcfgvslmldpkfVGEAMSVIAantnvpvsvkcrigvddhdsynQLCDFIYkvsslsptrhFIIHSRKALlngispaenrtipplkYEYYYALLrdfpdltftlnggiNTVDEVNAALRKGAHHVMVGRaayqnpwytlghvdtaiygapssgltrRQVVEKYQIYGDAilgtygnnrphvrdVMKPLlhffhsepgnglfkrkADAAFQTCKTVKSFLEETIVAipdsvldspieeaprgredlfadvhdllpppykareQEVLYAY
MPSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKallngispaenrtiPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIvaipdsvldspIEEAPRGREDlfadvhdllpppykareqevLYAY
MPSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSVLDSPIEEAPRGREDLFADVHDLLPPPYKAREQEVLYAY
**********VAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSVL**************FADV*******************
MPSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSV*******************HDLLPPPYKARE**VLYAY
*********KVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSVLDSPIEEAPRGREDLFADVHDLLPPPYKAREQEVLYAY
***CGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSVLDS*********EDLFADVHDLLPPPYKAREQEVLYAY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPDSVLDSPIEEAPRGREDLFADVHDLLPPPYKAREQEVLYAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q9CL29327 tRNA-dihydrouridine synth yes no 0.776 0.669 0.411 1e-38
Q8CWK7326 tRNA-dihydrouridine synth yes no 0.833 0.720 0.363 4e-38
Q9KUX9327 tRNA-dihydrouridine synth yes no 0.822 0.709 0.372 1e-37
Q8Z1T1332 tRNA-dihydrouridine synth N/A no 0.826 0.701 0.387 2e-37
P44794327 tRNA-dihydrouridine synth yes no 0.794 0.685 0.389 7e-37
Q8ZKH4332 tRNA-dihydrouridine synth yes no 0.826 0.701 0.383 7e-37
Q7UBC5330 tRNA-dihydrouridine synth yes no 0.730 0.624 0.419 1e-36
P32695330 tRNA-dihydrouridine synth N/A no 0.730 0.624 0.419 1e-36
Q8X5V6330 tRNA-dihydrouridine synth N/A no 0.730 0.624 0.419 1e-36
Q8FB30331 tRNA-dihydrouridine synth yes no 0.730 0.622 0.419 2e-36
>sp|Q9CL29|DUSA_PASMU tRNA-dihydrouridine synthase A OS=Pasteurella multocida (strain Pm70) GN=dusA PE=3 SV=1 Back     alignment and function desciption
 Score =  160 bits (404), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 136/238 (57%), Gaps = 19/238 (7%)

Query: 5   GCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFI 64
           GCPS +V  +G FG  LM     V + +S +    ++PV+VK RIG+DD DSY  LC+F+
Sbjct: 98  GCPSDRVQ-NGMFGACLMAKADLVADCVSAMQTEVSIPVTVKTRIGIDDLDSYEFLCEFV 156

Query: 65  YKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINT 124
            KV   +  + FIIH+RKA L+G+SP ENR IPPL YE  Y L RDFP L  ++NGGI T
Sbjct: 157 QKVHE-AGCQEFIIHARKAWLSGLSPKENREIPPLDYERVYQLKRDFPHLLMSINGGIKT 215

Query: 125 VDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDAI 184
           ++E+   L+     VMVGR AYQNP   LG++D A++      +T R+ VEK   Y +  
Sbjct: 216 LEEMQQHLQY-MDGVMVGREAYQNP-SLLGYIDQALFDPTCPVVTPREAVEKMFPYIEQQ 273

Query: 185 L--GTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKR-------KADAAFQTCKTVKSFL 233
           L  G Y N+      V++ +L  F S  G   ++R       KA A  +  +   SF+
Sbjct: 274 LSQGVYLNH------VVRHMLGAFQSCKGARQWRRYLSENAHKAGAGLEVVEKALSFV 325




Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.
Pasteurella multocida (strain Pm70) (taxid: 272843)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q8CWK7|DUSA_VIBVU tRNA-dihydrouridine synthase A OS=Vibrio vulnificus (strain CMCP6) GN=dusA PE=3 SV=2 Back     alignment and function description
>sp|Q9KUX9|DUSA_VIBCH tRNA-dihydrouridine synthase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q8Z1T1|DUSA_SALTI tRNA-dihydrouridine synthase A OS=Salmonella typhi GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|P44794|DUSA_HAEIN tRNA-dihydrouridine synthase A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q8ZKH4|DUSA_SALTY tRNA-dihydrouridine synthase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dusA PE=3 SV=1 Back     alignment and function description
>sp|Q7UBC5|DUSA_SHIFL tRNA-dihydrouridine synthase A OS=Shigella flexneri GN=dusA PE=3 SV=2 Back     alignment and function description
>sp|P32695|DUSA_ECOLI tRNA-dihydrouridine synthase A OS=Escherichia coli (strain K12) GN=dusA PE=3 SV=3 Back     alignment and function description
>sp|Q8X5V6|DUSA_ECO57 tRNA-dihydrouridine synthase A OS=Escherichia coli O157:H7 GN=dusA PE=3 SV=2 Back     alignment and function description
>sp|Q8FB30|DUSA_ECOL6 tRNA-dihydrouridine synthase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dusA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
255553550375 tRNA-dihydrouridine synthase A, putative 0.989 0.744 0.820 1e-137
225450085 433 PREDICTED: tRNA-dihydrouridine synthase 0.989 0.644 0.804 1e-134
449463996 431 PREDICTED: tRNA-dihydrouridine synthase 0.978 0.640 0.805 1e-134
449516697 431 PREDICTED: tRNA-dihydrouridine synthase 0.978 0.640 0.805 1e-134
297736275 423 unnamed protein product [Vitis vinifera] 0.989 0.659 0.804 1e-134
359487300377 PREDICTED: tRNA-dihydrouridine synthase 0.989 0.740 0.804 1e-134
224055152378 predicted protein [Populus trichocarpa] 0.982 0.732 0.813 1e-132
224106093380 predicted protein [Populus trichocarpa] 0.982 0.728 0.784 1e-129
356525006 430 PREDICTED: tRNA-dihydrouridine synthase 0.975 0.639 0.772 1e-126
21536881 404 unknown [Arabidopsis thaliana] 0.989 0.690 0.753 1e-126
>gi|255553550|ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] gi|223543088|gb|EEF44623.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 229/279 (82%), Positives = 255/279 (91%)

Query: 3   SCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCD 62
           +CGCPSP+VAGHGCFGV LMLDPKFVGEAMSVIAANT+VPVSVKCRIGVD+HDSYN+LCD
Sbjct: 97  NCGCPSPRVAGHGCFGVRLMLDPKFVGEAMSVIAANTDVPVSVKCRIGVDNHDSYNELCD 156

Query: 63  FIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGI 122
           FIYKVSSLSPT+HFIIHSRKALLNGISPAENR IPPLKYEYY+ALLRDFPDL FT+NGGI
Sbjct: 157 FIYKVSSLSPTKHFIIHSRKALLNGISPAENRKIPPLKYEYYFALLRDFPDLRFTINGGI 216

Query: 123 NTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGD 182
           N +DEVN ALR+GAH VMVGRAA+ NPW  LGHVD+AIYGAP SGLTRRQV+E+YQ Y D
Sbjct: 217 NCIDEVNLALREGAHGVMVGRAAFNNPWTVLGHVDSAIYGAPESGLTRRQVLEQYQAYAD 276

Query: 183 AILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPD 242
           AILGTYGNNRP+VRDV+KPLL  F+SEPGNGL+KR+ADAAFQ+C T+KSF EET+VAIPD
Sbjct: 277 AILGTYGNNRPNVRDVVKPLLGLFYSEPGNGLWKRRADAAFQSCTTIKSFFEETLVAIPD 336

Query: 243 SVLDSPIEEAPRGREDLFADVHDLLPPPYKAREQEVLYA 281
           +VLDSPI EAP GR+DLF +V  LLPPPY  REQ+V YA
Sbjct: 337 TVLDSPIAEAPSGRQDLFTNVRGLLPPPYATREQDVAYA 375




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225450085|ref|XP_002277955.1| PREDICTED: tRNA-dihydrouridine synthase A-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449463996|ref|XP_004149715.1| PREDICTED: tRNA-dihydrouridine synthase A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516697|ref|XP_004165383.1| PREDICTED: tRNA-dihydrouridine synthase A-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297736275|emb|CBI24913.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487300|ref|XP_003633563.1| PREDICTED: tRNA-dihydrouridine synthase A-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224055152|ref|XP_002298425.1| predicted protein [Populus trichocarpa] gi|222845683|gb|EEE83230.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106093|ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|222850448|gb|EEE87995.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356525006|ref|XP_003531118.1| PREDICTED: tRNA-dihydrouridine synthase A-like [Glycine max] Back     alignment and taxonomy information
>gi|21536881|gb|AAM61213.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2087408419 AT3G63510 [Arabidopsis thalian 0.989 0.665 0.753 1.8e-117
TAIR|locus:2152758387 AT5G47970 [Arabidopsis thalian 0.982 0.715 0.689 1.3e-107
UNIPROTKB|Q9KUX9327 dusA "tRNA-dihydrouridine synt 0.815 0.703 0.379 1.2e-35
TIGR_CMR|VC_0379327 VC_0379 "TIM-barrel protein, y 0.815 0.703 0.379 1.2e-35
UNIPROTKB|P32695330 dusA "tRNA-dihydrouridine synt 0.730 0.624 0.422 6.5e-35
GENEDB_PFALCIPARUM|PFI0920c577 PFI0920c "Dihydrouridine synth 0.450 0.220 0.5 9.8e-35
UNIPROTKB|Q8I2W5577 PFI0920c "Dihydrouridine synth 0.450 0.220 0.5 9.8e-35
UNIPROTKB|Q48A03335 CPS_0353 "tRNA-dihydrouridine 0.659 0.555 0.429 2.8e-34
TIGR_CMR|CPS_0353335 CPS_0353 "TIM-barrel protein, 0.659 0.555 0.429 2.8e-34
UNIPROTKB|Q607T6360 MCA1669 "tRNA-dihydrouridine s 0.726 0.569 0.401 3.6e-34
TAIR|locus:2087408 AT3G63510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1157 (412.3 bits), Expect = 1.8e-117, P = 1.8e-117
 Identities = 211/280 (75%), Positives = 250/280 (89%)

Query:     3 SCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCD 62
             +CGCPSPKVAGHGCFGVSLML PK VGEAMS IAANTNVPV+VKCRIGVD+HDSY++LCD
Sbjct:   140 NCGCPSPKVAGHGCFGVSLMLKPKLVGEAMSAIAANTNVPVTVKCRIGVDNHDSYDELCD 199

Query:    63 FIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGI 122
             FIYKVS+LSPTRHFI+HSRKALL GISPA+NR IPPLKYEYYYAL+RDFPDL FT+NGGI
Sbjct:   200 FIYKVSTLSPTRHFIVHSRKALLGGISPADNRRIPPLKYEYYYALVRDFPDLRFTINGGI 259

Query:   123 NTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGD 182
              +V +VNAAL++GAH VMVGRAAY NPW TLG VDTA+YG PSSGLTRRQV+E+YQ+YGD
Sbjct:   260 TSVSKVNAALKEGAHGVMVGRAAYNNPWQTLGQVDTAVYGVPSSGLTRRQVLEQYQVYGD 319

Query:   183 AILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAIPD 242
             ++LGT+GN RP+VRD++KPLL+ FHSE GN L+KR+ADAAF+ C++V S LEE++ AIPD
Sbjct:   320 SVLGTHGNGRPNVRDLVKPLLNLFHSENGNSLWKRRADAAFKECRSVGSLLEESLRAIPD 379

Query:   243 SVLDSPIEEAPR-GREDLFADVHDLLPPPYKAREQEVLYA 281
              VLDSPI  +P  G ED+FADVH++LPPPY+A E+ +L A
Sbjct:   380 CVLDSPISGSPESGDEDVFADVHNVLPPPYEAGEEIILCA 419




GO:0003824 "catalytic activity" evidence=IEA
GO:0006808 "regulation of nitrogen utilization" evidence=ISS
GO:0008033 "tRNA processing" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0017150 "tRNA dihydrouridine synthase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016556 "mRNA modification" evidence=RCA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
TAIR|locus:2152758 AT5G47970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUX9 dusA "tRNA-dihydrouridine synthase A" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0379 VC_0379 "TIM-barrel protein, yjbN family" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P32695 dusA "tRNA-dihydrouridine synthase A" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFI0920c PFI0920c "Dihydrouridine synthase, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8I2W5 PFI0920c "Dihydrouridine synthase, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q48A03 CPS_0353 "tRNA-dihydrouridine synthase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0353 CPS_0353 "TIM-barrel protein, yjbN family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q607T6 MCA1669 "tRNA-dihydrouridine synthase" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00028772001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (377 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00008841001
SubName- Full=Chromosome chr13 scaffold_210, whole genome shotgun sequence; (250 aa)
       0.528
GSVIVG00005777001
SubName- Full=Chromosome chr3 scaffold_158, whole genome shotgun sequence; (214 aa)
       0.528
GSVIVG00003012001
RecName- Full=D-tyrosyl-tRNA(Tyr) deacylase; EC=3.1.-.-;; Hydrolyzes D-tyrosyl-tRNA(Tyr) into D [...] (153 aa)
       0.514
GSVIVG00037524001
SubName- Full=Chromosome undetermined scaffold_89, whole genome shotgun sequence; (396 aa)
       0.495
GSVIVG00007295001
SubName- Full=Chromosome chr2 scaffold_187, whole genome shotgun sequence; (265 aa)
       0.428
GSVIVG00020869001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (451 aa)
       0.417
GSVIVG00015180001
RecName- Full=Queuine tRNA-ribosyltransferase; EC=2.4.2.29;; Exchanges the guanine residue with [...] (367 aa)
      0.406
GSVIVG00035363001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (238 aa)
       0.402

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
PRK11815333 PRK11815, PRK11815, tRNA-dihydrouridine synthase A 5e-77
TIGR00742318 TIGR00742, yjbN, tRNA dihydrouridine synthase A 1e-56
cd02801231 cd02801, DUS_like_FMN, Dihydrouridine synthase-lik 5e-38
COG0042323 COG0042, COG0042, tRNA-dihydrouridine synthase [Tr 7e-37
pfam01207309 pfam01207, Dus, Dihydrouridine synthase (Dus) 9e-30
TIGR00737319 TIGR00737, nifR3_yhdG, putative TIM-barrel protein 4e-14
PRK10415321 PRK10415, PRK10415, tRNA-dihydrouridine synthase B 6e-05
PRK10550312 PRK10550, PRK10550, tRNA-dihydrouridine synthase C 6e-04
>gnl|CDD|236991 PRK11815, PRK11815, tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
 Score =  236 bits (606), Expect = 5e-77
 Identities = 89/218 (40%), Positives = 126/218 (57%), Gaps = 16/218 (7%)

Query: 4   CGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDF 63
            GCPS +V  +G FG  LM +P+ V + +  +    ++PV+VK RIG+DD DSY  LCDF
Sbjct: 98  VGCPSDRVQ-NGRFGACLMAEPELVADCVKAMKDAVSIPVTVKHRIGIDDQDSYEFLCDF 156

Query: 64  IYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGIN 123
           +  V+  +    FI+H+RKA L G+SP ENR IPPL Y+  Y L RDFP LT  +NGGI 
Sbjct: 157 VDTVAE-AGCDTFIVHARKAWLKGLSPKENREIPPLDYDRVYRLKRDFPHLTIEINGGIK 215

Query: 124 TVDEVNAALRK--GAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYG 181
           T++E    L+   G   VM+GRAAY NP+  L  VD  ++G P+  L+R +V+E    Y 
Sbjct: 216 TLEEAKEHLQHVDG---VMIGRAAYHNPYL-LAEVDRELFGEPAPPLSRSEVLEAMLPYI 271

Query: 182 DAIL--GTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKR 217
           +  L  G        +  + + +L  F   PG   ++R
Sbjct: 272 ERHLAQGGR------LNHITRHMLGLFQGLPGARAWRR 303


Length = 333

>gnl|CDD|129825 TIGR00742, yjbN, tRNA dihydrouridine synthase A Back     alignment and domain information
>gnl|CDD|239200 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>gnl|CDD|223120 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216365 pfam01207, Dus, Dihydrouridine synthase (Dus) Back     alignment and domain information
>gnl|CDD|129820 TIGR00737, nifR3_yhdG, putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>gnl|CDD|182440 PRK10415, PRK10415, tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|236713 PRK10550, PRK10550, tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 100.0
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 100.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 100.0
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 100.0
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 100.0
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 100.0
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 100.0
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 100.0
KOG2333614 consensus Uncharacterized conserved protein [Gener 100.0
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 99.97
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 99.96
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 99.94
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 99.9
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 99.9
KOG2334 477 consensus tRNA-dihydrouridine synthase [Translatio 99.89
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 99.88
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 99.86
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 99.86
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 99.85
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.85
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 99.84
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 99.82
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 99.82
PRK13523337 NADPH dehydrogenase NamA; Provisional 99.8
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 99.79
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 99.76
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 99.76
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 99.75
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 99.75
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 99.74
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 99.73
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.72
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 99.72
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 99.72
PRK14024241 phosphoribosyl isomerase A; Provisional 99.71
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.7
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 99.69
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 99.62
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 99.61
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 99.57
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.55
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 99.53
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 99.51
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.5
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 99.5
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 99.43
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 99.42
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.42
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 99.42
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 99.42
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 99.4
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 99.38
PRK10605362 N-ethylmaleimide reductase; Provisional 99.38
PLN02826409 dihydroorotate dehydrogenase 99.38
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.35
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 99.35
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 99.35
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 99.27
PLN02411391 12-oxophytodienoate reductase 99.27
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 99.23
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 99.2
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 99.19
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 99.19
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 99.13
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 99.12
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 99.12
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.98
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.92
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 98.91
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.87
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 98.84
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 98.83
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 98.82
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 98.82
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.81
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.81
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.74
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.72
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.72
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.71
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.66
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 98.62
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 98.62
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 98.61
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 98.59
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 98.58
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 98.58
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.56
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 98.55
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 98.52
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 98.52
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 98.47
PLN02535364 glycolate oxidase 98.47
KOG1436398 consensus Dihydroorotate dehydrogenase [Nucleotide 98.46
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 98.46
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.43
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 98.42
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 98.41
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 98.41
PF01645368 Glu_synthase: Conserved region in glutamate syntha 98.38
PRK11197381 lldD L-lactate dehydrogenase; Provisional 98.36
PLN02979366 glycolate oxidase 98.3
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.3
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 98.3
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.29
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.23
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.18
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 98.17
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 98.16
KOG1799471 consensus Dihydropyrimidine dehydrogenase [Nucleot 98.16
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.13
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.13
PRK00208250 thiG thiazole synthase; Reviewed 98.1
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 98.06
PLN02617538 imidazole glycerol phosphate synthase hisHF 98.04
KOG0134400 consensus NADH:flavin oxidoreductase/12-oxophytodi 98.04
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.02
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.0
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.99
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.97
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.95
PRK07695201 transcriptional regulator TenI; Provisional 97.93
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 97.93
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 97.93
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.93
PLN02274505 inosine-5'-monophosphate dehydrogenase 97.88
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 97.88
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.85
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 97.85
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.84
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 97.84
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.83
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 97.79
KOG2334477 consensus tRNA-dihydrouridine synthase [Translatio 97.72
PRK14024241 phosphoribosyl isomerase A; Provisional 97.71
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.64
KOG0538363 consensus Glycolate oxidase [Energy production and 97.63
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 97.62
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 97.62
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.56
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.56
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 97.54
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.51
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 97.48
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 97.46
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.45
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 97.45
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 97.43
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.42
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 97.41
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.35
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.35
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 97.34
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.33
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.3
PLN02591250 tryptophan synthase 97.29
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 97.28
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.24
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.23
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.19
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.18
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.15
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.15
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 97.14
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.11
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 97.1
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.08
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 97.04
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.01
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 97.01
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 97.01
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 96.99
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.98
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 96.97
PLN02617538 imidazole glycerol phosphate synthase hisHF 96.96
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 96.96
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 96.94
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 96.91
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 96.89
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 96.89
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 96.84
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 96.82
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 96.81
PRK04302223 triosephosphate isomerase; Provisional 96.81
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 96.7
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 96.69
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 96.61
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 96.6
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 96.56
PLN02334229 ribulose-phosphate 3-epimerase 96.54
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 96.5
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 96.47
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 96.46
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 96.44
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 96.4
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 96.38
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 96.38
PRK07028430 bifunctional hexulose-6-phosphate synthase/ribonuc 96.36
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.32
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.31
cd04742418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 96.3
PRK07315293 fructose-bisphosphate aldolase; Provisional 96.29
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 96.21
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.21
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 96.2
TIGR02814444 pfaD_fam PfaD family protein. The protein PfaD is 96.17
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 96.16
PRK06806281 fructose-bisphosphate aldolase; Provisional 96.11
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 96.0
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 95.96
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.94
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 95.91
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.9
PRK06801286 hypothetical protein; Provisional 95.75
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 95.74
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 95.74
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 95.73
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 95.71
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 95.7
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 95.68
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 95.66
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 95.66
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 95.64
PLN02460338 indole-3-glycerol-phosphate synthase 95.61
PRK05283257 deoxyribose-phosphate aldolase; Provisional 95.6
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 95.55
PRK08999312 hypothetical protein; Provisional 95.5
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 95.3
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 95.23
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 95.18
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.17
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 95.14
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 95.09
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 95.09
PLN02274505 inosine-5'-monophosphate dehydrogenase 95.09
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 95.07
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 95.06
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 95.05
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 94.99
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 94.99
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 94.9
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 94.87
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 94.76
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 94.75
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 94.61
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 94.61
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 94.57
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 94.53
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 94.52
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 94.48
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 94.43
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 94.42
COG1411229 Uncharacterized protein related to proFAR isomeras 94.42
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 94.42
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 94.4
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 94.32
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 94.28
PRK06852304 aldolase; Validated 94.23
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 94.21
PRK08227264 autoinducer 2 aldolase; Validated 94.18
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 94.18
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 94.15
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 94.06
PLN02535364 glycolate oxidase 94.06
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 93.99
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 93.96
PLN02979366 glycolate oxidase 93.94
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 93.94
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.9
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 93.88
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 93.84
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 93.84
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 93.81
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 93.68
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 93.63
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 93.63
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 93.54
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 93.35
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 93.33
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 93.28
PRK07709285 fructose-bisphosphate aldolase; Provisional 93.18
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 93.02
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 93.0
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.0
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.82
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 92.72
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.66
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 92.58
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 92.57
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 92.54
TIGR01334277 modD putative molybdenum utilization protein ModD. 92.47
PRK08185283 hypothetical protein; Provisional 92.28
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.28
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 92.25
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 92.22
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 92.13
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 92.11
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 92.03
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 92.03
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 91.92
PRK08610286 fructose-bisphosphate aldolase; Reviewed 91.9
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 91.84
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 91.69
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 91.68
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 91.66
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 91.63
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 91.62
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 91.58
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 91.47
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 91.41
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 91.36
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 91.28
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 91.2
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 91.17
PLN02424332 ketopantoate hydroxymethyltransferase 91.11
cd03321355 mandelate_racemase Mandelate racemase (MR) catalyz 91.02
PRK05581220 ribulose-phosphate 3-epimerase; Validated 90.92
PRK14040 593 oxaloacetate decarboxylase; Provisional 90.67
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 90.57
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 90.51
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 90.48
cd03329368 MR_like_4 Mandelate racemase (MR)-like subfamily o 90.48
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 90.38
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 90.37
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 90.35
PRK14567253 triosephosphate isomerase; Provisional 90.3
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 90.14
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 90.09
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 89.87
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 89.62
PLN02460338 indole-3-glycerol-phosphate synthase 89.59
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 89.57
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 89.42
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 89.38
PRK09016296 quinolinate phosphoribosyltransferase; Validated 89.26
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 89.25
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 89.22
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 89.19
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 89.16
PRK08005210 epimerase; Validated 89.14
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 89.05
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.96
PRK09282 592 pyruvate carboxylase subunit B; Validated 88.89
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 88.56
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 88.55
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 88.45
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 88.43
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 88.41
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 88.39
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 88.25
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 87.98
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 87.89
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 87.87
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 87.57
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 87.55
PRK06096284 molybdenum transport protein ModD; Provisional 87.52
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 87.38
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 87.3
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 87.23
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 87.14
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 86.99
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 86.49
PRK14565237 triosephosphate isomerase; Provisional 86.48
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 86.46
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 86.28
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 86.14
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 85.98
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 85.72
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 85.61
KOG4201289 consensus Anthranilate synthase component II [Amin 85.37
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 85.34
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 85.32
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 85.26
PLN02561253 triosephosphate isomerase 84.93
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 84.85
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 84.66
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 84.58
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 84.55
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 84.51
PLN02417280 dihydrodipicolinate synthase 84.5
PRK09250348 fructose-bisphosphate aldolase; Provisional 84.5
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 84.16
PRK11197381 lldD L-lactate dehydrogenase; Provisional 84.16
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 84.1
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 84.05
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 84.05
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 83.83
PRK05835307 fructose-bisphosphate aldolase; Provisional 83.67
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 83.5
PTZ00333255 triosephosphate isomerase; Provisional 83.44
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 83.35
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid m 83.27
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 83.23
PRK00042250 tpiA triosephosphate isomerase; Provisional 82.87
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 82.84
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 82.47
cd03324415 rTSbeta_L-fuconate_dehydratase Human rTS beta is e 82.3
cd03328352 MR_like_3 Mandelate racemase (MR)-like subfamily o 82.17
PRK08091228 ribulose-phosphate 3-epimerase; Validated 81.99
COG1908132 FrhD Coenzyme F420-reducing hydrogenase, delta sub 81.66
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 81.59
KOG0623541 consensus Glutamine amidotransferase/cyclase [Amin 81.54
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 81.52
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 81.29
PRK04147293 N-acetylneuraminate lyase; Provisional 81.17
cd03327341 MR_like_2 Mandelate racemase (MR)-like subfamily o 80.7
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 80.57
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 80.36
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 80.24
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 80.14
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=100.00  E-value=1e-49  Score=371.42  Aligned_cols=221  Identities=28%  Similarity=0.495  Sum_probs=187.1

Q ss_pred             ccccCCchhhcccCcccccccCCHHHHHHHHHHHhhcC-CccEEEEecCCCCCCCcHHHHHHHHHHHHHhCCCCEEEEec
Q 023442            2 PSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANT-NVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHS   80 (282)
Q Consensus         2 lN~GCP~~~v~~~g~yGs~Ll~~p~~~~eiv~~v~~~~-~ipvsvKiR~G~d~~~~~~e~~~~v~~~le~~Gv~~i~VH~   80 (282)
                      ||||||+++|++.|. ||+||++|+++.+||+++++++ ++|||||||+||++.+.   ...+++++++++|+++|+||+
T Consensus        98 lN~GCP~~~V~~~g~-Ga~Ll~~p~lv~~iv~a~~~av~~iPVTVKiRlG~d~~~~---~~~~ia~~~~~~g~~~ltVHg  173 (323)
T COG0042          98 LNCGCPSPKVVKGGA-GAALLKNPELLAEIVKAMVEAVGDIPVTVKIRLGWDDDDI---LALEIARILEDAGADALTVHG  173 (323)
T ss_pred             eeCCCChHHhcCCCc-chhhcCCHHHHHHHHHHHHHhhCCCCeEEEEecccCcccc---cHHHHHHHHHhcCCCEEEEec
Confidence            899999999998775 9999999999999999999999 49999999999998651   123467788999999999999


Q ss_pred             CCcccCCCCcCCcCCCCCccHHHHHHHHhcCCCceEEEccCCCCHHHHHHHHH-cCCCEEEecHHhhhCCccchhhhHhh
Q 023442           81 RKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALR-KGAHHVMVGRAAYQNPWYTLGHVDTA  159 (282)
Q Consensus        81 Rt~~~~G~~~ad~~~i~~~~~~~i~~l~~~~~~ipVi~nGdI~s~eda~~~l~-~g~DgVmIGRgal~nP~if~~~~~~~  159 (282)
                      ||++++|.+++        +|++|+++++..+++|||+||||+|++|++++++ +||||||||||+++||||| .+++..
T Consensus       174 Rtr~~~y~~~a--------d~~~I~~vk~~~~~ipvi~NGdI~s~~~a~~~l~~tg~DgVMigRga~~nP~l~-~~i~~~  244 (323)
T COG0042         174 RTRAQGYLGPA--------DWDYIKELKEAVPSIPVIANGDIKSLEDAKEMLEYTGADGVMIGRGALGNPWLF-RQIDYL  244 (323)
T ss_pred             ccHHhcCCCcc--------CHHHHHHHHHhCCCCeEEeCCCcCCHHHHHHHHHhhCCCEEEEcHHHccCCcHH-HHHHHh
Confidence            99987777654        4899999998865699999999999999999999 9999999999999999997 665222


Q ss_pred             hhCCCCCcccHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHhccCCCChHHHHHHHHHHhhHHHHHHHHHHHHHh
Q 023442          160 IYGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVA  239 (282)
Q Consensus       160 ~~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~rk~~~~y~~~~~~~~~~r~~l~~~~~~~~~~~~~~~~~~~~  239 (282)
                      ..|+.. ++++.++++.+.+|++.+.++||  ..++..+|||+.||+++++++++||+.+++. .+..++.+.++.+..+
T Consensus       245 ~~g~~~-~~~~~e~~~~~~~~~~~~~~~~~--~~~~~~~r~h~~~~~~~~~~a~~~r~~~~~~-~~~~~~~~~l~~~~~~  320 (323)
T COG0042         245 ETGELL-PPTLAEVLDILREHLELLLEYYG--KKGLRRLRKHLGYYLKGLPGARELRRALNKA-EDGAEVRRALEAVFEE  320 (323)
T ss_pred             hcCCCC-CCCHHHHHHHHHHHHHHHHHhcc--ccHHHHHHHHHHHHhhcCccHHHHHHHHhcc-CcHHHHHHHHHHHHhh
Confidence            334432 36788899999999999999998  4689999999999999999999999987543 5666666666555443



>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>KOG1799 consensus Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>KOG0134 consensus NADH:flavin oxidoreductase/12-oxophytodienoate reductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd03321 mandelate_racemase Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd03329 MR_like_4 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 4 Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd03324 rTSbeta_L-fuconate_dehydratase Human rTS beta is encoded by the rTS gene which, through alternative RNA splicing, also encodes rTS alpha whose mRNA is complementary to thymidylate synthase mRNA Back     alignment and domain information
>cd03328 MR_like_3 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 3 Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion] Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd03327 MR_like_2 Mandelate racemase (MR)-like subfamily of the enolase superfamily, subgroup 2 Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3b0p_A350 Trna-Dihydrouridine Synthase From Thermus Thermophi 1e-26
3b0v_C363 Trna-Dihydrouridine Synthase From Thermus Thermophi 2e-24
>pdb|3B0P|A Chain A, Trna-Dihydrouridine Synthase From Thermus Thermophilus Length = 350 Back     alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 71/217 (32%), Positives = 119/217 (54%), Gaps = 14/217 (6%) Query: 3 SCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCD 62 + GCPS K A G +G L+LD V E + + VPV+VK R+G++ ++Y L Sbjct: 90 NLGCPSEK-AQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQ 148 Query: 63 FIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGI 122 + ++ + + F++H+R ALL +S NR IPPL++++ + L DFP LTF NGGI Sbjct: 149 SVEAMAE-AGVKVFVVHARSALL-ALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGI 206 Query: 123 NTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIY-- 180 +++E L++ VM+GRA Y++P + L D ++G P +R +V + + Y Sbjct: 207 RSLEEALFHLKR-VDGVMLGRAVYEDP-FVLEEADRRVFGLPRRP-SRLEVARRMRAYLE 263 Query: 181 GDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKR 217 + + GT P V++ +L+ F P L++R Sbjct: 264 EEVLKGTP----PWA--VLRHMLNLFRGRPKGRLWRR 294
>pdb|3B0V|C Chain C, Trna-Dihydrouridine Synthase From Thermus Thermophilus In Complex With Trna Length = 363 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 2e-94
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Length = 350 Back     alignment and structure
 Score =  281 bits (722), Expect = 2e-94
 Identities = 72/254 (28%), Positives = 122/254 (48%), Gaps = 12/254 (4%)

Query: 4   CGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDF 63
            GCPS K    G +G  L+LD   V E +  +     VPV+VK R+G++  ++Y  L   
Sbjct: 91  LGCPSEKA-QEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQS 149

Query: 64  IYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGIN 123
           +  ++  +  + F++H+R ALL  +S   NR IPPL++++ + L  DFP LTF  NGGI 
Sbjct: 150 VEAMAE-AGVKVFVVHARSALL-ALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIR 207

Query: 124 TVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIYGAPSSGLTRRQVVEKYQIYGDA 183
           +++E    L K    VM+GRA Y++P+  L   D  ++G P    +R +V  + + Y + 
Sbjct: 208 SLEEALFHL-KRVDGVMLGRAVYEDPFV-LEEADRRVFGLPRR-PSRLEVARRMRAYLEE 264

Query: 184 ILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRK--ADAAFQTCKTVKSFLEETIVAIP 241
            +            V++ +L+ F   P   L++R      + Q        +EE +    
Sbjct: 265 EVLKGT----PPWAVLRHMLNLFRGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGEEG 320

Query: 242 DSVLDSPIEEAPRG 255
           +     P  +    
Sbjct: 321 EKEKPGPRGQREAA 334


>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Length = 318 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 100.0
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 100.0
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.89
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.88
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.86
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.84
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 99.84
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 99.83
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 99.83
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 99.82
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.82
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 99.81
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 99.8
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 99.8
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 99.8
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 99.8
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 99.8
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 99.79
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 99.79
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 99.77
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 99.77
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 99.77
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 99.76
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 99.75
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 99.75
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 99.73
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 99.7
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.7
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.69
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 99.65
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 99.62
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 99.57
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 99.55
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.55
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 99.55
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 99.54
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 99.52
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.48
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 99.48
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.48
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 99.47
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.44
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 99.44
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.41
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 99.4
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 99.33
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 99.31
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 99.31
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.29
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.28
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 99.21
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 99.17
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 99.16
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 99.13
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 99.12
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.08
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 99.03
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 99.03
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 98.98
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 98.95
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 98.94
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 98.9
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.89
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 98.88
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.86
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.81
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.78
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.77
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 98.73
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 98.72
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 98.68
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.67
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 98.64
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.62
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 98.62
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 98.61
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.59
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 98.57
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.54
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 98.52
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 98.5
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.47
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.46
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 98.41
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.38
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.36
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 98.35
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.32
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 98.32
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.31
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.27
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 98.24
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.13
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 98.11
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 98.06
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 98.05
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.04
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 98.03
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.0
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 97.99
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 97.97
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 97.95
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 97.92
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 97.79
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.78
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 97.77
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 97.77
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 97.76
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 97.76
3eez_A378 Putative mandelate racemase/muconate lactonizing e 97.71
3oa3_A288 Aldolase; structural genomics, seattle structural 97.69
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 97.69
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 97.68
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 97.68
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 97.63
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 97.63
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 97.61
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.59
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.58
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 97.58
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 97.57
2poz_A392 Putative dehydratase; octamer, structural genomics 97.57
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 97.55
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 97.55
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 97.51
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 97.5
2gl5_A410 Putative dehydratase protein; structural genomics, 97.49
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 97.49
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 97.48
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.46
2qgy_A391 Enolase from the environmental genome shotgun sequ 97.44
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 97.38
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 97.36
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.33
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 97.28
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 97.27
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 97.26
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 97.26
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 97.26
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 97.24
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 97.21
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 97.18
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 97.17
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 97.16
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 97.13
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 97.12
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.11
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 97.09
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 97.08
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 97.07
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 97.06
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 97.04
2oz8_A389 MLL7089 protein; structural genomics, unknown func 97.04
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 97.03
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 97.01
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 97.01
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 97.01
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 96.99
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 96.97
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 96.97
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 96.94
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 96.94
2o56_A407 Putative mandelate racemase; dehydratase, structur 96.94
1tzz_A392 Hypothetical protein L1841; structural genomics, m 96.93
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 96.93
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 96.91
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 96.86
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 96.84
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 96.83
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 96.82
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 96.81
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 96.79
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 96.79
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 96.77
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 96.76
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 96.68
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 96.66
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 96.65
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 96.65
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.65
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 96.64
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 96.64
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 96.61
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 96.61
3kts_A192 Glycerol uptake operon antiterminator regulatory; 96.6
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 96.59
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 96.57
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 96.56
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 96.5
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 96.48
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 96.48
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 96.46
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 96.43
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 96.43
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 96.43
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 96.41
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 96.41
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 96.4
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 96.4
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 96.39
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 96.38
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 96.34
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 96.33
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 96.32
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 96.3
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 96.29
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 96.26
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 96.21
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.18
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 96.17
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 96.16
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 96.11
1ujp_A271 Tryptophan synthase alpha chain; riken structural 96.1
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.07
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 96.05
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 96.04
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 96.02
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 96.01
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 95.96
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 95.95
3r0u_A379 Enzyme of enolase superfamily; structural genomics 95.93
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 95.89
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.85
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 95.83
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 95.81
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 95.81
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 95.79
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 95.74
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 95.73
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 95.7
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 95.65
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 95.64
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 95.61
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 95.55
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 95.51
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 95.49
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 95.49
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 95.39
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 95.31
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 95.27
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 95.18
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 95.14
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 95.14
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 95.1
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 95.08
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 95.01
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 94.94
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 94.94
3tha_A252 Tryptophan synthase alpha chain; structural genomi 94.93
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 94.91
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 94.9
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 94.81
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 94.76
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 94.59
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.53
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 94.52
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 94.47
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 94.31
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 94.27
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 94.25
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 94.18
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 94.13
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 94.03
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 94.02
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 94.0
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 93.99
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 93.95
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 93.94
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 93.9
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 93.88
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 93.85
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 93.49
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 93.41
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 93.41
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 93.04
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 93.02
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 92.96
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 92.95
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 92.95
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 92.9
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 92.88
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 92.84
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 92.59
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 92.57
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 92.3
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 92.24
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 92.18
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 92.18
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 92.07
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 92.0
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 91.96
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 91.8
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 91.77
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 91.64
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 91.53
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 91.5
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 91.48
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 91.26
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 91.18
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 91.14
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 91.12
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 91.02
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 90.59
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 90.54
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 90.54
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 90.16
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 90.1
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 90.07
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 89.86
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 89.76
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 89.74
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 89.24
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 89.09
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 89.07
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 89.05
2chr_A370 Chloromuconate cycloisomerase; 3.00A {Cupriavidus 88.95
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 88.42
1wuf_A393 Hypothetical protein LIN2664; structural genomics, 88.36
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 88.32
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 88.13
4hpn_A378 Putative uncharacterized protein; enolase, enzyme 88.12
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 87.75
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 87.73
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 86.91
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 86.84
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 86.79
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 86.74
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 86.74
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 86.53
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 86.42
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 86.41
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 86.28
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 86.19
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 86.09
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 86.06
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 85.97
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 85.92
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 85.85
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 85.68
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 85.6
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 85.49
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 85.41
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 85.23
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 85.11
2pge_A377 MENC; OSBS, NYSGXRC, PSI-II, structural genomics, 84.99
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 84.99
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 84.77
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 84.47
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 84.41
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 84.4
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 84.39
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 84.33
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 84.18
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 84.17
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 84.15
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 84.04
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 83.95
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 83.94
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 83.78
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 83.73
3tqp_A428 Enolase; energy metabolism, lyase; 2.20A {Coxiella 83.61
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 83.52
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 83.28
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 83.26
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 83.25
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 83.24
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 83.22
1yya_A250 Triosephosphate isomerase; riken structural genomi 83.22
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 83.11
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 83.01
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 82.86
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 82.8
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 82.78
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 82.74
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 82.49
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 82.36
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 82.2
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 82.11
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 82.11
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 82.04
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 81.98
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 81.8
4h1z_A412 Enolase Q92ZS5; dehydratase, magnesium binding sit 81.74
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 81.54
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 81.51
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 81.49
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 81.41
1wue_A386 Mandelate racemase/muconate lactonizing enzyme FA 81.34
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 81.28
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 81.04
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 81.02
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 81.0
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 80.99
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 80.91
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 80.9
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 80.76
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 80.59
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 80.57
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 80.41
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 80.41
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 80.34
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 80.32
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 80.23
3fxg_A455 Rhamnonate dehydratase; structural gemomics, enola 80.16
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 80.09
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 80.02
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 80.01
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
Probab=100.00  E-value=3.9e-41  Score=316.02  Aligned_cols=228  Identities=29%  Similarity=0.548  Sum_probs=188.5

Q ss_pred             ccccCCchhhcccCcccccccCCHHHHHHHHHHHhhcCCccEEEEecCCCCCCCcHHHHHHHHHHHHHhCCCCEEEEecC
Q 023442            2 PSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSR   81 (282)
Q Consensus         2 lN~GCP~~~v~~~g~yGs~Ll~~p~~~~eiv~~v~~~~~ipvsvKiR~G~d~~~~~~e~~~~v~~~le~~Gv~~i~VH~R   81 (282)
                      ||+|||++++.+ ++||++|+++++++.+|++++++++++||++|+|+||++..+.+++.+ +++.++++|+++|+||+|
T Consensus        89 In~gcP~~~~~~-d~~G~~l~~~~~~~~eiv~av~~~v~~PV~vKiR~g~~~~~~~~~~~~-~a~~l~~aG~d~I~V~~r  166 (350)
T 3b0p_A           89 LNLGCPSEKAQE-GGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQ-SVEAMAEAGVKVFVVHAR  166 (350)
T ss_dssp             EEECCCSHHHHH-TTCGGGGGGCHHHHHHHHHHHHHHCSSCEEEEEESCBTTCCCHHHHHH-HHHHHHHTTCCEEEEECS
T ss_pred             ECCcCCCCcCcC-CCcchhHHhCHHHHHHHHHHHHHHhCCceEEEEecCcCccccHHHHHH-HHHHHHHcCCCEEEEecC
Confidence            799999998885 558999999999999999999999999999999999998655545554 456788999999999999


Q ss_pred             CcccCCCCcCCcCCCCCccHHHHHHHHhcCCCceEEEccCCCCHHHHHHHHHcCCCEEEecHHhhhCCccchhhhHhhhh
Q 023442           82 KALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPWYTLGHVDTAIY  161 (282)
Q Consensus        82 t~~~~G~~~ad~~~i~~~~~~~i~~l~~~~~~ipVi~nGdI~s~eda~~~l~~g~DgVmIGRgal~nP~if~~~~~~~~~  161 (282)
                      +... |.++..++.+++..|+.+.++++..+++|||+||||.|++|+.++++ |||+|||||+++.|||+| .++...++
T Consensus       167 ~~~~-g~~g~~~~~~~~~~~~~i~~ik~~~~~iPVianGgI~s~eda~~~l~-GaD~V~iGRa~l~~P~l~-~~i~~~l~  243 (350)
T 3b0p_A          167 SALL-ALSTKANREIPPLRHDWVHRLKGDFPQLTFVTNGGIRSLEEALFHLK-RVDGVMLGRAVYEDPFVL-EEADRRVF  243 (350)
T ss_dssp             CBC-----------CCCCCHHHHHHHHHHCTTSEEEEESSCCSHHHHHHHHT-TSSEEEECHHHHHCGGGG-TTHHHHTT
T ss_pred             chhc-ccCcccccCCCcccHHHHHHHHHhCCCCeEEEECCcCCHHHHHHHHh-CCCEEEECHHHHhCcHHH-HHHHHHhc
Confidence            8643 43333334456778999999988755899999999999999999998 999999999999999996 77776666


Q ss_pred             CCCCCcccHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHhccCCCChHHHHHHHHHHhhHHHHHHHHHHHHHhC
Q 023442          162 GAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAI  240 (282)
Q Consensus       162 g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~rk~~~~y~~~~~~~~~~r~~l~~~~~~~~~~~~~~~~~~~~~  240 (282)
                      | +.+++++.++++.+++|++.+++ +|+   .++.+|||+.||++++|+++.||+.+++. .+.+.+.+.++++....
T Consensus       244 ~-~~~~~~~~~~~~~~~~~~~~~~~-~g~---~~~~~~kh~~~~~~g~~~~~~~r~~l~~~-~~~~~~~~~l~~~~~~~  316 (350)
T 3b0p_A          244 G-LPRRPSRLEVARRMRAYLEEEVL-KGT---PPWAVLRHMLNLFRGRPKGRLWRRLLSEG-RSLQALDRALRLMEEEV  316 (350)
T ss_dssp             C-CSCCCCHHHHHHHHHHHHHHHHH-HTC---CHHHHHTTSTTTTTTSTTHHHHHHHHHHH-CSHHHHHHHHHHHHHHH
T ss_pred             C-CCCCCCHHHHHHHHHHHHHHHHH-cCc---cHHHHHHHHHHHHccCCCHHHHHHHHHCC-CCHHHHHHHHHHHhhhc
Confidence            6 44556888999999999988776 575   47899999999999999999999999765 67888888887765444



>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2chr_A Chloromuconate cycloisomerase; 3.00A {Cupriavidus necator} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>1wuf_A Hypothetical protein LIN2664; structural genomics, unknown function, nysgxrc target T2186, superfamily, protein structure initiative, PSI; 2.90A {Listeria innocua} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>4hpn_A Putative uncharacterized protein; enolase, enzyme function initiative, EFI, structural genomic isomerase; 1.60A {Agrobacterium tumefaciens} PDB: 4ggb_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>2pge_A MENC; OSBS, NYSGXRC, PSI-II, structural genomics, protein structure initiative; 1.60A {Desulfotalea psychrophila LSV54} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>3tqp_A Enolase; energy metabolism, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1wue_A Mandelate racemase/muconate lactonizing enzyme FA protein; structural genomics, unknown function, nysgxrc target T2185; 2.10A {Enterococcus faecalis} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3fxg_A Rhamnonate dehydratase; structural gemomics, enolase superfamily, NYSGXRC, target 9265J, lyase, structural genomics, PSI-2; 1.90A {Gibberella zeae ph-1} PDB: 2p0i_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1ep3a_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 5e-16
d1vhna_305 c.1.4.1 (A:) Putative flavin oxidoreducatase TM009 2e-10
d1gtea2312 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenas 2e-08
d1ps9a1330 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-ter 1e-05
d1djqa1340 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N- 2e-04
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 311 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Dihydroorotate dehydrogenase
species: Lactococcus lactis, isozyme B [TaxId: 1358]
 Score = 74.3 bits (181), Expect = 5e-16
 Identities = 31/155 (20%), Positives = 55/155 (35%), Gaps = 11/155 (7%)

Query: 1   MPSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQL 60
             +  CP+ K  G          DP+     +    A + VP+ VK    V D     + 
Sbjct: 130 ELNISCPNVKHGGQAF-----GTDPEVAAALVKACKAVSKVPLYVKLSPNVTDIVPIAKA 184

Query: 61  C-----DFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLT 115
                 D +  +++L   R  +   +  L N         I P+  +  + + +D   + 
Sbjct: 185 VEAAGADGLTMINTLMGVRFDLKTRQPILANITGGLSGPAIKPVALKLIHQVAQDVD-IP 243

Query: 116 FTLNGGINTVDEVNAALRKGAHHVMVGRAAYQNPW 150
               GG+    +V      GA  V VG A + +P+
Sbjct: 244 IIGMGGVANAQDVLEMYMAGASAVAVGTANFADPF 278


>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Length = 305 Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Length = 312 Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 340 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 100.0
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.85
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 99.76
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 99.66
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 99.65
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 99.58
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.44
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 99.31
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 99.29
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 99.27
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 99.25
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 99.24
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 99.16
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 99.13
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.08
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 99.02
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.89
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.88
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 98.73
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.7
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.66
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 98.57
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 98.57
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 98.47
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 98.37
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 98.36
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 98.22
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 98.05
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 97.98
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.95
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 97.9
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 97.88
d1ofda2809 Alpha subunit of glutamate synthase, central and F 97.72
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 97.53
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 97.47
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.46
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 97.39
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 97.31
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 97.29
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 97.22
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 97.09
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 97.05
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 97.05
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.99
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 96.98
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 96.97
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.9
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 96.87
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 96.77
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 96.73
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 96.72
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 96.6
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 96.57
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 96.5
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 96.43
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 96.36
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 96.32
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 96.02
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 95.9
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 95.88
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 95.73
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 95.49
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 95.44
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 95.32
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 95.23
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 95.05
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 94.98
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.93
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 94.92
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 94.89
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 94.71
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 94.59
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 94.55
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 94.5
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 94.39
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 94.33
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 94.19
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 94.04
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 93.77
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 93.53
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 93.46
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 92.83
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 92.24
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 92.08
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 91.71
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 91.22
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 91.04
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 91.01
d1n55a_249 Triosephosphate isomerase {Leishmania mexicana [Ta 90.64
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 90.6
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 90.5
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 90.4
d1vr6a1338 3-deoxy-D-arabino-heptulosonate-7-phosphate syntha 90.35
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 89.68
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 89.49
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 89.44
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 88.95
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 88.85
d1mo0a_257 Triosephosphate isomerase {Nematode (Caenorhabditi 88.43
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 88.4
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 88.11
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 88.07
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 88.06
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 88.02
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 87.84
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 87.53
d1kv5a_249 Triosephosphate isomerase {Trypanosoma brucei [Tax 87.07
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 86.95
d1r2ra_246 Triosephosphate isomerase {Rabbit (Oryctolagus cun 86.74
d1o5xa_246 Triosephosphate isomerase {Plasmodium falciparum [ 86.58
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 86.54
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 86.0
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 86.0
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 85.59
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 85.23
d2btma_251 Triosephosphate isomerase {Bacillus stearothermoph 84.76
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 84.51
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 84.42
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 84.19
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 84.08
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 83.59
d1aw1a_255 Triosephosphate isomerase {Vibrio marinus [TaxId: 83.49
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 83.16
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 82.43
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 82.26
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 82.25
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 82.01
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 81.98
d1neya_247 Triosephosphate isomerase {Baker's yeast (Saccharo 81.65
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 81.01
d1qkka_140 Transcriptional regulatory protein DctD, receiver 80.98
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 80.52
d1b9ba_252 Triosephosphate isomerase {Thermotoga maritima [Ta 80.18
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 80.13
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 80.1
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Putative flavin oxidoreducatase TM0096
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=1.6e-52  Score=384.53  Aligned_cols=219  Identities=21%  Similarity=0.350  Sum_probs=188.7

Q ss_pred             ccccCCchhhcccCcccccccCCHHHHHHHHHHHhhcCCccEEEEecCCCCCCCcHHHHHHHHHHHHHhCCCCEEEEecC
Q 023442            2 PSCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSR   81 (282)
Q Consensus         2 lN~GCP~~~v~~~g~yGs~Ll~~p~~~~eiv~~v~~~~~ipvsvKiR~G~d~~~~~~e~~~~v~~~le~~Gv~~i~VH~R   81 (282)
                      ||||||+++|+++|. ||+||++|+++.+|++++++++++|||||+|+|||+.+ ..++    ++.++++|+++|+||||
T Consensus        85 lN~GCP~~~v~~~g~-Ga~Ll~~p~~~~~iv~~~~~~~~~pvsvK~RlG~d~~~-~~~~----~~~l~~~G~~~itvH~R  158 (305)
T d1vhna_          85 LNAGCPVRKVVKEGA-GGALLKDLRHFRYIVRELRKSVSGKFSVKTRLGWEKNE-VEEI----YRILVEEGVDEVFIHTR  158 (305)
T ss_dssp             EEECCCCHHHHHTTC-GGGGGSCHHHHHHHHHHHHHHCSSEEEEEEESCSSSCC-HHHH----HHHHHHTTCCEEEEESS
T ss_pred             EEEEecchhhccccc-ceeeccCHHHHHHHhhhhhhhcccccccccccCcccch-hhHH----HHHHHHhCCcEEEechh
Confidence            899999999998775 99999999999999999999999999999999998754 3333    45678999999999999


Q ss_pred             CcccCCCCcCCcCCCCCccHHHHHHHHhcCCCceEEEccCCCCHHHHHHHHH-cCCCEEEecHHhhhCCccchhhhHhhh
Q 023442           82 KALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALR-KGAHHVMVGRAAYQNPWYTLGHVDTAI  160 (282)
Q Consensus        82 t~~~~G~~~ad~~~i~~~~~~~i~~l~~~~~~ipVi~nGdI~s~eda~~~l~-~g~DgVmIGRgal~nP~if~~~~~~~~  160 (282)
                      |+.+.+.++++|+.|+.++           .++|||+||||+|++|+.++++ +||||||||||++.||||| .+++..+
T Consensus       159 t~~q~~~~~a~~~~i~~~~-----------~~ipvi~NGdI~s~~d~~~~l~~tg~dgVMiGRgal~nP~if-~~i~~~l  226 (305)
T d1vhna_         159 TVVQSFTGRAEWKALSVLE-----------KRIPTFVSGDIFTPEDAKRALEESGCDGLLVARGAIGRPWIF-KQIKDFL  226 (305)
T ss_dssp             CTTTTTSSCCCGGGGGGSC-----------CSSCEEEESSCCSHHHHHHHHHHHCCSEEEESGGGTTCTTHH-HHHHHHH
T ss_pred             hhhhccccchhhhHHHhhh-----------hhhhhhcccccccHHHHHHHHHhcCCCeEehhHHHHHhhhHh-hhhhhhh
Confidence            9877666667765544322           3799999999999999999998 9999999999999999997 7777655


Q ss_pred             hCCCCCcccHHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHhccCCCChHHHHHHHHHHhhHHHHHHHHHHHHHhC
Q 023442          161 YGAPSSGLTRRQVVEKYQIYGDAILGTYGNNRPHVRDVMKPLLHFFHSEPGNGLFKRKADAAFQTCKTVKSFLEETIVAI  240 (282)
Q Consensus       161 ~g~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~rk~~~~y~~~~~~~~~~r~~l~~~~~~~~~~~~~~~~~~~~~  240 (282)
                      .+.+...+++.++++.+.+|++.+.++||+ ..++..+|||+.||++++|++++||+++++ +.+.+++.++++++++++
T Consensus       227 ~~~~~~~~~~~e~~~~~~~~~~~~~~~~g~-~~~l~~~rkhl~~~~kg~p~ak~~R~~l~~-~~~~~el~~~l~~~~~e~  304 (305)
T d1vhna_         227 RSGKYSEPSREEILRTFERHLELLIKTKGE-RKAVVEMRKFLAGYTKDLKGARRFREKVMK-IEEVQILKEMFYNFIKEV  304 (305)
T ss_dssp             HHSCCCCCCHHHHHHHHHHHHHHHHHHHCH-HHHHHHHHTTHHHHTTTCTTHHHHHHHHTT-CCCHHHHHHHHHHHHHHH
T ss_pred             cCCCcccchhHHHHHhHHHHHHHHHHhcCc-chHHHHHHHHHHHHHcCCCcHHHHHHHHHh-CCCHHHHHHHHHHHHHhc
Confidence            544444568889999999999999999997 678899999999999999999999999975 478888888888888775



>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vr6a1 c.1.10.4 (A:1-338) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure