Citrus Sinensis ID: 024194

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MPAIHSSLSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSSASNQNGGRSGARSLSPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
cccccccccccccHHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccccccccEEEEEEEccccEEEEcccccHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccccEEEEccccccccHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHcc
cccEEEEEccccccEEEccccccccccccccHHcccHHHHHHHHccccccccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEccccEEcHHHHHccccHHHEHHHEEEccccccEEEEcccccHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHccEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccHHccc
mpaihsslsfymkplflsnsslfprkftvpkeyllnprslcalssasnqnggrsgarslspspvsddlqkidvnppkgtrdfppedmrLRNWLFHNFQEVsrlfgfeevdfpvleSEALFIRKAGEEIRDQLYCFEdrgnrrvalrpeltPSLARLVIQkgksvslplkwfavGQCWryermtrgrrrehYQWNMDIIGVPAVTVLQEVLrchsipehlfgkVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
mpaihsslsfyMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSSasnqnggrsgarslspspvsddlqkidvnppkgtrdfppEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIqkgksvslplkwfavgqCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
MPAIHSSLSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSSASNQNGGRSGARSLSPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWryermtrgrrrEHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
*******LSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLC**********************************************RLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLT******
**********YMKPLFLSNS*******************************************************PKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
MPAIHSSLSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSS*********************DLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
*PAIHSSLSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSSA**********RSLSPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKS********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAIHSSLSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSSASNQNGGRSGARSLSPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEGWF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
P62371 439 Histidine--tRNA ligase OS yes no 0.671 0.414 0.446 4e-35
Q8F9Y3 439 Histidine--tRNA ligase OS yes no 0.671 0.414 0.446 4e-35
B0SQQ4 437 Histidine--tRNA ligase OS yes no 0.523 0.324 0.482 3e-34
B0SH39 437 Histidine--tRNA ligase OS yes no 0.523 0.324 0.482 3e-34
Q04X87 439 Histidine--tRNA ligase OS yes no 0.501 0.309 0.510 4e-34
Q04WC4 439 Histidine--tRNA ligase OS yes no 0.501 0.309 0.510 4e-34
Q5UXW4 435 Histidine--tRNA ligase OS yes no 0.494 0.308 0.447 2e-30
O58028 431 Histidine--tRNA ligase OS yes no 0.690 0.433 0.359 1e-29
Q9HLX5 426 Histidine--tRNA ligase OS yes no 0.678 0.431 0.342 7e-29
Q97CE6 426 Histidine--tRNA ligase OS yes no 0.667 0.424 0.331 9e-29
>sp|P62371|SYH_LEPIC Histidine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisS PE=3 SV=1 Back     alignment and function desciption
 Score =  148 bits (374), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 83/186 (44%), Positives = 116/186 (62%), Gaps = 4/186 (2%)

Query: 75  PPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRD-QLY 133
           P KGTRDF PEDMRLRNW+F   +E    FG+EE D P+LES  L+  K+GEEI + QLY
Sbjct: 12  PYKGTRDFYPEDMRLRNWMFSVMRETVLSFGYEEYDGPILESFDLYKAKSGEEIVERQLY 71

Query: 134 CFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQW 193
            F D+G RRVA+RPE+TP+LAR+V    +++  P++WF++   WRYE+  +GR REH+Q 
Sbjct: 72  DFIDKGERRVAIRPEMTPTLARMVAGNLRNLPKPVRWFSIPNLWRYEQPGKGRLREHWQL 131

Query: 194 NMDIIGVPAVTV-LQEVLRCHSIPEHLFGKVCIIIDKIE--KLPLDVIKNDLKSAGMSEA 250
           N+D+ GV +    L+ +L   SI +     +     K+   KL    +KN LK  G    
Sbjct: 132 NVDLFGVDSHRAELEILLIADSILKKFGAPIGSYQIKVSHRKLLDSFLKNSLKLNGDQVH 191

Query: 251 AIEELL 256
            + +LL
Sbjct: 192 GVSKLL 197

Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) (taxid: 267671)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1
>sp|Q8F9Y3|SYH_LEPIN Histidine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|B0SQQ4|SYH_LEPBP Histidine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|B0SH39|SYH_LEPBA Histidine--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|Q04X87|SYH_LEPBL Histidine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|Q04WC4|SYH_LEPBJ Histidine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|Q5UXW4|SYH_HALMA Histidine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|O58028|SYH_PYRHO Histidine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hisS PE=3 SV=1 Back     alignment and function description
>sp|Q9HLX5|SYH_THEAC Histidine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hisS PE=1 SV=1 Back     alignment and function description
>sp|Q97CE6|SYH_THEVO Histidine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hisS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
449451054 507 PREDICTED: histidine--tRNA ligase-like [ 0.966 0.516 0.660 1e-105
449482410 507 PREDICTED: histidine--tRNA ligase-like [ 0.963 0.514 0.655 1e-104
225440069 554 PREDICTED: histidyl-tRNA synthetase-like 0.970 0.474 0.671 1e-104
255556918 503 histidyl-tRNA synthetase, putative [Rici 0.974 0.524 0.639 1e-101
297806295 486 histidyl-tRNA synthetase 1 [Arabidopsis 0.955 0.532 0.634 1e-101
356505252 501 PREDICTED: histidyl-tRNA synthetase-like 0.981 0.530 0.625 1e-100
15231337 486 Histidyl-tRNA synthetase 1 [Arabidopsis 0.948 0.528 0.627 1e-97
224068773 441 predicted protein [Populus trichocarpa] 0.804 0.494 0.692 7e-95
297819142 442 histidyl-tRNA synthetase 1 [Arabidopsis 0.940 0.576 0.639 9e-90
79326851263 ATP binding / aminoacyl-tRNA ligase/ his 0.837 0.863 0.617 2e-85
>gi|449451054|ref|XP_004143277.1| PREDICTED: histidine--tRNA ligase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/303 (66%), Positives = 235/303 (77%), Gaps = 41/303 (13%)

Query: 7   SLSFYMKPLFLSNSSL---FPRKFTVPK-EYLLNPR---SLCALSSA-SNQNGGRSGARS 58
           SL+  +KP   S+SSL      +F  PK  + LN     SL A+SSA S  +GG +G RS
Sbjct: 14  SLNLRLKPFIFSSSSLAFSIILRFPFPKPSFFLNRNFHSSLTAVSSAQSVSDGGTTGGRS 73

Query: 59  --LSPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLES 116
             LSP+P +++LQ+IDVNPPKGTRDFPPEDMRLRNWLF+NF+EVSR++GFEEVD+PVLES
Sbjct: 74  GALSPAPTTEELQRIDVNPPKGTRDFPPEDMRLRNWLFNNFREVSRVYGFEEVDYPVLES 133

Query: 117 EALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQC 176
           EALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKS+SLP+KWFA+GQC
Sbjct: 134 EALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSLSLPIKWFAIGQC 193

Query: 177 WRYERMTRGRRREHYQWNMDIIGVPAVT-------------------------------V 205
           WRYERMTRGRRREHYQWNMDI+GVP VT                               V
Sbjct: 194 WRYERMTRGRRREHYQWNMDILGVPGVTAEAELLSSIVTFFKKVGITASDVGFKVSSRKV 253

Query: 206 LQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLT 265
           LQ+VL+C+ IP+++FGKVCIIIDKIEK+PLD +K +LK  G+SE AIEELL+VLS+KSLT
Sbjct: 254 LQDVLKCYGIPQNMFGKVCIIIDKIEKIPLDEMKKELKVVGVSEDAIEELLQVLSVKSLT 313

Query: 266 ELE 268
           +LE
Sbjct: 314 KLE 316

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449482410|ref|XP_004156273.1| PREDICTED: histidine--tRNA ligase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225440069|ref|XP_002277086.1| PREDICTED: histidyl-tRNA synthetase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255556918|ref|XP_002519492.1| histidyl-tRNA synthetase, putative [Ricinus communis] gi|223541355|gb|EEF42906.1| histidyl-tRNA synthetase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297806295|ref|XP_002871031.1| histidyl-tRNA synthetase 1 [Arabidopsis lyrata subsp. lyrata] gi|297316868|gb|EFH47290.1| histidyl-tRNA synthetase 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356505252|ref|XP_003521406.1| PREDICTED: histidyl-tRNA synthetase-like [Glycine max] Back     alignment and taxonomy information
>gi|15231337|ref|NP_190196.1| Histidyl-tRNA synthetase 1 [Arabidopsis thaliana] gi|3659909|gb|AAC61600.1| histidyl-tRNA synthetase [Arabidopsis thaliana] gi|7798998|emb|CAB90937.1| histidyl-tRNA synthetase [Arabidopsis thaliana] gi|15810389|gb|AAL07082.1| putative histidyl-tRNA synthetase [Arabidopsis thaliana] gi|21436315|gb|AAM51327.1| putative histidyl-tRNA synthetase [Arabidopsis thaliana] gi|332644592|gb|AEE78113.1| Histidyl-tRNA synthetase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224068773|ref|XP_002326196.1| predicted protein [Populus trichocarpa] gi|222833389|gb|EEE71866.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297819142|ref|XP_002877454.1| histidyl-tRNA synthetase 1 [Arabidopsis lyrata subsp. lyrata] gi|297323292|gb|EFH53713.1| histidyl-tRNA synthetase 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79326851|ref|NP_001031826.1| ATP binding / aminoacyl-tRNA ligase/ histidine-tRNA ligase/ nucleotide binding protein [Arabidopsis thaliana] gi|332003215|gb|AED90598.1| ATP binding / aminoacyl-tRNA ligase/ histidine-tRNA ligase/ nucleotide binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
TAIR|locus:2075306 486 HRS1 "Histidyl-tRNA synthetase 0.734 0.409 0.654 6.4e-87
TAIR|locus:1009023403263 AT5G03406 [Arabidopsis thalian 0.741 0.764 0.660 1.4e-76
TIGR_CMR|BA_3376 425 BA_3376 "histidyl-tRNA synthet 0.512 0.327 0.274 7e-15
TIGR_CMR|DET_0006 418 DET_0006 "histidyl-tRNA synthe 0.498 0.322 0.280 1.7e-12
TIGR_CMR|CHY_2205 423 CHY_2205 "histidyl-tRNA synthe 0.494 0.316 0.321 2.6e-11
DICTYBASE|DDB_G0274159 481 hisS "histidine-tRNA ligase" [ 0.464 0.261 0.280 2.1e-09
TIGR_CMR|BA_4633 423 BA_4633 "histidyl-tRNA synthet 0.490 0.314 0.257 2.9e-09
TIGR_CMR|NSE_0781 413 NSE_0781 "histidyl-tRNA synthe 0.476 0.312 0.265 6.3e-09
UNIPROTKB|F1NEE7 501 HARS "Uncharacterized protein" 0.505 0.273 0.271 1.7e-08
UNIPROTKB|F1ND13 504 HARS "Uncharacterized protein" 0.505 0.271 0.271 1.8e-08
TAIR|locus:2075306 HRS1 "Histidyl-tRNA synthetase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 680 (244.4 bits), Expect = 6.4e-87, Sum P(2) = 6.4e-87
 Identities = 142/217 (65%), Positives = 167/217 (76%)

Query:     1 MPAIH---SSLSFYMKPLFLSN--SSLFP-RKFTVPKEYLLNPRSLCALSSASNQNGGRS 54
             M AIH   + LS   +P+ L +  SS  P R+F++P+      R +CA   A+N  GGRS
Sbjct:     1 MRAIHIVTTRLSSSFRPILLLDLVSSCSPPRQFSIPR------RLICA---AAN-GGGRS 50

Query:    55 GARSLSPSPVSDDL-QKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPV 113
             G+  ++P    +D  +KIDVNPPKGTRDFPPEDMRLRNWLF++F+EVSRL+G+EEVD+PV
Sbjct:    51 GS-IVAPLVTEEDFHKKIDVNPPKGTRDFPPEDMRLRNWLFNHFKEVSRLYGYEEVDYPV 109

Query:   114 LESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAV 173
             LE+EALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFA+
Sbjct:   110 LETEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAI 169

Query:   174 GQCWXXXXXXXXXXXEHYQWNMDIIGVPAVTVLQEVL 210
             GQCW           EHYQWNMDIIGVP VT   E++
Sbjct:   170 GQCWRYERMTRGRRREHYQWNMDIIGVPQVTAEAELI 206
GO:0000166 "nucleotide binding" evidence=IEA
GO:0004812 "aminoacyl-tRNA ligase activity" evidence=IEA
GO:0004821 "histidine-tRNA ligase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006418 "tRNA aminoacylation for protein translation" evidence=IEA
GO:0006427 "histidyl-tRNA aminoacylation" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:1009023403 AT5G03406 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3376 BA_3376 "histidyl-tRNA synthetase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0006 DET_0006 "histidyl-tRNA synthetase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2205 CHY_2205 "histidyl-tRNA synthetase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274159 hisS "histidine-tRNA ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4633 BA_4633 "histidyl-tRNA synthetase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0781 NSE_0781 "histidyl-tRNA synthetase" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
UNIPROTKB|F1NEE7 HARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ND13 HARS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023243001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (505 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00038605001
SubName- Full=Chromosome chr3 scaffold_95, whole genome shotgun sequence; (468 aa)
•  •  • 0.927
GSVIVG00002274001
RecName- Full=Histidinol dehydrogenase; EC=1.1.1.23;; Catalyzes the sequential NAD-dependent ox [...] (438 aa)
•     • 0.892
GSVIVG00006883001
SubName- Full=Chromosome chr10 scaffold_179, whole genome shotgun sequence; (927 aa)
   •  • 0.844
GSVIVG00019784001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (925 aa)
•  •  • 0.840
GSVIVG00019988001
RecName- Full=Imidazoleglycerol-phosphate dehydratase; EC=4.2.1.19; (180 aa)
•     • 0.826
GSVIVG00025807001
RecName- Full=Translation initiation factor IF-2;; One of the essential components for the init [...] (607 aa)
•  •  • 0.826
GSVIVG00037704001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (529 aa)
•  •  • 0.823
GSVIVG00001677001
SubName- Full=Chromosome chr13 scaffold_120, whole genome shotgun sequence; (946 aa)
•     • 0.813
GSVIVG00036298001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (566 aa)
•  •  • 0.813
GSVIVG00000640001
RecName- Full=DNA topoisomerase 2; EC=5.99.1.3; (661 aa)
•     • 0.809

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
PLN02530 487 PLN02530, PLN02530, histidine-tRNA ligase 1e-142
TIGR00442 397 TIGR00442, hisS, histidyl-tRNA synthetase 3e-50
COG0124 429 COG0124, HisS, Histidyl-tRNA synthetase [Translati 5e-49
cd00773261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA 1e-47
PRK00037 412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 1e-46
pfam00587171 pfam00587, tRNA-synt_2b, tRNA synthetase class II 3e-27
PRK12420 423 PRK12420, PRK12420, histidyl-tRNA synthetase; Prov 7e-26
TIGR00443 313 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltran 7e-24
COG3705 390 COG3705, HisZ, ATP phosphoribosyltransferase invol 2e-19
PLN02972 763 PLN02972, PLN02972, Histidyl-tRNA synthetase 1e-17
pfam13393 308 pfam13393, tRNA-synt_His, Histidyl-tRNA synthetase 3e-17
CHL00201 430 CHL00201, syh, histidine-tRNA synthetase; Provisio 3e-16
PRK12292 391 PRK12292, hisZ, ATP phosphoribosyltransferase regu 3e-14
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA am 8e-08
cd00670235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro 1e-06
PRK12295 373 PRK12295, hisZ, ATP phosphoribosyltransferase regu 2e-06
COG0442 500 COG0442, ProS, Prolyl-tRNA synthetase [Translation 2e-04
pfam01409245 pfam01409, tRNA-synt_2d, tRNA synthetases class II 0.001
TIGR00408 472 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, fam 0.004
>gnl|CDD|178145 PLN02530, PLN02530, histidine-tRNA ligase Back     alignment and domain information 
 Score =  407 bits (1049), Expect = e-142
 Identities = 173/299 (57%), Positives = 200/299 (66%), Gaps = 39/299 (13%)

Query: 2   PAIHSSLSFYMKPLFLSNSSLFPRKFTVPKEYLLNPRSLCALSSASNQNGGRSGARSLSP 61
               S+ +     L LS+   F    + P+         CA S+A    GGRSG  +  P
Sbjct: 7   ATRVSASAIRRPSLPLSSRCSFLLSASSPR------GGRCAASAA--AGGGRSGGTTAPP 58

Query: 62  SPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFI 121
           S   D   KIDVNPPKGTRDFPPEDMRLRNWLF +F+EVSRLFGFEEVD PVLESE L+I
Sbjct: 59  SVQEDGKPKIDVNPPKGTRDFPPEDMRLRNWLFDHFREVSRLFGFEEVDAPVLESEELYI 118

Query: 122 RKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYER 181
           RKAGEEI DQLY FED+G RRVALRPELTPSLARLV+QKGKS+SLPLKWFA+GQCWRYER
Sbjct: 119 RKAGEEITDQLYNFEDKGGRRVALRPELTPSLARLVLQKGKSLSLPLKWFAIGQCWRYER 178

Query: 182 MTRGRRREHYQWNMDIIGVPAVT-------------------------------VLQEVL 210
           MTRGRRREHYQWNMDIIGVP V                                VLQ VL
Sbjct: 179 MTRGRRREHYQWNMDIIGVPGVEAEAELLAAIVTFFKRVGITSSDVGIKVSSRKVLQAVL 238

Query: 211 RCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEG 269
           + + IPE  F  VC+I+DK+EKLP + I+ +L + G+SE AIE +L VLS+KSL +LE 
Sbjct: 239 KSYGIPEESFAPVCVIVDKLEKLPREEIEKELDTLGVSEEAIEGILDVLSLKSLDDLEA 297

Length = 487
>gnl|CDD|213530 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223202 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238396 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|234586 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|216009 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|237097 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|232978 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>gnl|CDD|226228 COG3705, HisZ, ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215525 PLN02972, PLN02972, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|222097 pfam13393, tRNA-synt_His, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|164576 CHL00201, syh, histidine-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|237043 PRK12292, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|238391 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|238359 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|183413 PRK12295, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|223519 COG0442, ProS, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|216483 pfam01409, tRNA-synt_2d, tRNA synthetases class II core domain (F) Back     alignment and domain information
>gnl|CDD|232961 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
PLN02530 487 histidine-tRNA ligase 100.0
KOG1936 518 consensus Histidyl-tRNA synthetase [Translation, r 100.0
COG0124 429 HisS Histidyl-tRNA synthetase [Translation, riboso 100.0
PRK12292 391 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
PRK12421 392 ATP phosphoribosyltransferase regulatory subunit; 100.0
PRK12420 423 histidyl-tRNA synthetase; Provisional 100.0
PLN02972 763 Histidyl-tRNA synthetase 100.0
CHL00201 430 syh histidine-tRNA synthetase; Provisional 100.0
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
TIGR00443 314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 100.0
PF13393 311 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI 100.0
COG3705 390 HisZ ATP phosphoribosyltransferase involved in his 100.0
TIGR00442 397 hisS histidyl-tRNA synthetase. This model finds a 100.0
PRK00037 412 hisS histidyl-tRNA synthetase; Reviewed 100.0
PRK12295 373 hisZ ATP phosphoribosyltransferase regulatory subu 100.0
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetas 100.0
PRK12294272 hisZ ATP phosphoribosyltransferase regulatory subu 99.96
PRK00413 638 thrS threonyl-tRNA synthetase; Reviewed 99.94
PRK12305 575 thrS threonyl-tRNA synthetase; Reviewed 99.93
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class 99.91
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) cla 99.91
PRK09194 565 prolyl-tRNA synthetase; Provisional 99.91
PRK14799 545 thrS threonyl-tRNA synthetase; Provisional 99.91
TIGR00418 563 thrS threonyl-tRNA synthetase. This model represen 99.9
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II 99.9
TIGR00409 568 proS_fam_II prolyl-tRNA synthetase, family II. Pro 99.9
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_t 99.9
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-lik 99.88
PRK12444 639 threonyl-tRNA synthetase; Reviewed 99.87
PRK12325 439 prolyl-tRNA synthetase; Provisional 99.84
PLN02908 686 threonyl-tRNA synthetase 99.83
TIGR02367453 PylS pyrrolysyl-tRNA synthetase. PylS is the archa 99.82
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) 99.8
PF00587173 tRNA-synt_2b: tRNA synthetase class II core domain 99.78
TIGR00408 472 proS_fam_I prolyl-tRNA synthetase, family I. Proly 99.77
PRK04172489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 99.76
PRK08661 477 prolyl-tRNA synthetase; Provisional 99.74
PRK09537417 pylS pyrolysyl-tRNA synthetase; Reviewed 99.7
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl s 99.64
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II 99.61
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosoma 99.59
PTZ00326494 phenylalanyl-tRNA synthetase alpha chain; Provisio 99.54
PLN02837 614 threonine-tRNA ligase 99.5
KOG2324 457 consensus Prolyl-tRNA synthetase [Translation, rib 99.49
PRK04173 456 glycyl-tRNA synthetase; Provisional 99.49
PRK03991 613 threonyl-tRNA synthetase; Validated 99.46
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.42
TIGR00414418 serS seryl-tRNA synthetase. This model represents 99.39
PRK09350 306 poxB regulator PoxA; Provisional 99.33
PRK05431425 seryl-tRNA synthetase; Provisional 99.33
COG0441 589 ThrS Threonyl-tRNA synthetase [Translation, riboso 99.27
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase cl 99.12
PRK00960517 seryl-tRNA synthetase; Provisional 99.08
PF01409247 tRNA-synt_2d: tRNA synthetases class II core domai 99.01
TIGR00468294 pheS phenylalanyl-tRNA synthetase, alpha subunit. 98.97
PLN02678448 seryl-tRNA synthetase 98.95
KOG1637 560 consensus Threonyl-tRNA synthetase [Translation, r 98.94
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (Phe 98.86
TIGR00415520 serS_MJ seryl-tRNA synthetase, Methanococcus janna 98.81
PRK00488339 pheS phenylalanyl-tRNA synthetase subunit alpha; V 98.79
PRK14894 539 glycyl-tRNA synthetase; Provisional 98.77
PLN02320502 seryl-tRNA synthetase 98.74
cd00777 280 AspRS_core Asp tRNA synthetase (aspRS) class II co 98.72
cd00776 322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class 98.69
COG0423 558 GRS1 Glycyl-tRNA synthetase (class II) [Translatio 98.66
PLN02853492 Probable phenylalanyl-tRNA synthetase alpha chain 98.65
TIGR00389 551 glyS_dimeric glycyl-tRNA synthetase, dimeric type. 98.59
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [T 98.54
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, riboso 98.51
TIGR00462 304 genX lysyl-tRNA synthetase-like protein GenX. Many 98.41
PF00152 335 tRNA-synt_2: tRNA synthetases class II (D, K and N 98.39
TIGR00459 583 aspS_bact aspartyl-tRNA synthetase, bacterial type 98.38
cd00775 329 LysRS_core Lys_tRNA synthetase (LysRS) class II co 98.32
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal 98.32
PLN02734 684 glycyl-tRNA synthetase 98.3
PRK06462 335 asparagine synthetase A; Reviewed 98.27
PRK00476 588 aspS aspartyl-tRNA synthetase; Validated 98.27
TIGR00458 428 aspS_arch aspartyl-tRNA synthetase, archaeal type. 98.24
PRK09616552 pheT phenylalanyl-tRNA synthetase subunit beta; Re 98.22
PRK03932 450 asnC asparaginyl-tRNA synthetase; Validated 98.22
PRK00484 491 lysS lysyl-tRNA synthetase; Reviewed 98.21
PLN02903 652 aminoacyl-tRNA ligase 98.19
PRK05159 437 aspC aspartyl-tRNA synthetase; Provisional 98.19
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glu 98.17
COG2269 322 Truncated, possibly inactive, lysyl-tRNA synthetas 98.17
PRK12445 505 lysyl-tRNA synthetase; Reviewed 98.16
PTZ00385 659 lysyl-tRNA synthetase; Provisional 98.09
PTZ00417 585 lysine-tRNA ligase; Provisional 98.07
PLN02502 553 lysyl-tRNA synthetase 98.04
PLN02850 530 aspartate-tRNA ligase 98.0
TIGR00457 453 asnS asparaginyl-tRNA synthetase. In a multiple se 97.98
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheR 97.97
TIGR00499 496 lysS_bact lysyl-tRNA synthetase, eukaryotic and no 97.96
PTZ00425 586 asparagine-tRNA ligase; Provisional 97.9
KOG2411 628 consensus Aspartyl-tRNA synthetase, mitochondrial 97.9
TIGR00470 533 sepS O-phosphoseryl-tRNA(Cys) synthetase. This fam 97.82
PTZ00401 550 aspartyl-tRNA synthetase; Provisional 97.79
PRK02983 1094 lysS lysyl-tRNA synthetase; Provisional 97.73
KOG2509455 consensus Seryl-tRNA synthetase [Translation, ribo 97.71
PLN02603 565 asparaginyl-tRNA synthetase 97.7
COG0017 435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Transl 97.66
PLN02221 572 asparaginyl-tRNA synthetase 97.64
PLN02788 402 phenylalanine-tRNA synthetase 97.61
PLN02532 633 asparagine-tRNA synthetase 97.59
KOG2784483 consensus Phenylalanyl-tRNA synthetase, beta subun 97.55
TIGR00471551 pheT_arch phenylalanyl-tRNA synthetase, beta subun 97.36
PLN02265597 probable phenylalanyl-tRNA synthetase beta chain 97.03
KOG2298 599 consensus Glycyl-tRNA synthetase and related class 96.95
COG1190 502 LysU Lysyl-tRNA synthetase (class II) [Translation 96.75
KOG1885 560 consensus Lysyl-tRNA synthetase (class II) [Transl 96.66
TIGR00472 798 pheT_bact phenylalanyl-tRNA synthetase, beta subun 96.19
COG2024 536 Phenylalanyl-tRNA synthetase alpha subunit (archae 96.03
PRK00629 791 pheT phenylalanyl-tRNA synthetase subunit beta; Re 96.02
CHL00192 704 syfB phenylalanyl-tRNA synthetase beta chain; Prov 95.95
TIGR00469 460 pheS_mito phenylalanyl-tRNA synthetase, mitochondr 95.9
KOG0554 446 consensus Asparaginyl-tRNA synthetase (mitochondri 95.62
KOG0556 533 consensus Aspartyl-tRNA synthetase [Translation, r 95.09
KOG4163 551 consensus Prolyl-tRNA synthetase [Translation, rib 94.49
PRK06253 529 O-phosphoseryl-tRNA synthetase; Reviewed 94.37
PRK07080317 hypothetical protein; Validated 92.98
COG0072 650 PheT Phenylalanyl-tRNA synthetase beta subunit [Tr 91.65
KOG2472578 consensus Phenylalanyl-tRNA synthetase beta subuni 84.53
TIGR00443314 hisZ_biosyn_reg ATP phosphoribosyltransferase, reg 80.81
KOG0555 545 consensus Asparaginyl-tRNA synthetase [Translation 80.1
>PLN02530 histidine-tRNA ligase Back     alignment and domain information 
Probab=100.00  E-value=2.5e-45  Score=358.13  Aligned_cols=221  Identities=71%  Similarity=1.181  Sum_probs=192.2

Q ss_pred             CCCCCCcccCCCCCCCccccccccCCCCCCCCCChHHHHHHHHHHHHHHHHHHHcCCeeecCCcccchHHhhhhhccccc
Q 024194           50 NGGRSGARSLSPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIR  129 (271)
Q Consensus        50 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~G~~d~lp~e~~~~~~i~~~l~~vf~~~Gy~eI~tP~~E~~d~~~~~~g~~~~  129 (271)
                      ..+++++.+..+....+.+.|+++++|+||+||+|+++..+++|++.++++|++|||++|.||+||++++|..+.|+++.
T Consensus        47 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~G~~D~lp~~~~~~~~i~~~~~~~~~~~Gy~~I~tP~lE~~el~~~~~g~~~~  126 (487)
T PLN02530         47 GGGRSGGTTAPPSVQEDGKPKIDVNPPKGTRDFPPEDMRLRNWLFDHFREVSRLFGFEEVDAPVLESEELYIRKAGEEIT  126 (487)
T ss_pred             ccccCCCCCCCCCCccccccccccCCCCCcCcCCHHHHHHHHHHHHHHHHHHHHcCCEeccccccchHHHhccccCcccc
Confidence            44555555555544488889999999999999999999999999999999999999999999999999999987788888


Q ss_pred             cccEEEeeCCCCeEeeCCCChHHHHHHHHHcCCCCCCCeEEEEEeceeecCCCCCCCCcceEEeEEEEEecCcHH-----
Q 024194          130 DQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVT-----  204 (271)
Q Consensus       130 ~~~y~f~D~~G~~laLRPD~T~~iAR~~a~~~~~~~~P~K~yyig~VfR~e~~~~Gr~REf~Q~gvEiiG~~~~~-----  204 (271)
                      ++||+|.|++|+.++||||+|+|+||+++++....+.|+||||+|+|||+++++.||+|||+|+|+|+||.+++.     
T Consensus       127 ~~~y~f~D~~g~~l~LRpD~T~~iaR~~~~~~~~~~~P~r~~y~g~vfR~e~~q~gr~REf~Q~giEiiG~~~~~aDaEv  206 (487)
T PLN02530        127 DQLYNFEDKGGRRVALRPELTPSLARLVLQKGKSLSLPLKWFAIGQCWRYERMTRGRRREHYQWNMDIIGVPGVEAEAEL  206 (487)
T ss_pred             cceEEEECCCCCEEecCCCCcHHHHHHHHhcccccCCCeEEEEEcCEEcCcCCCCCCccceEEcCeeEeCCCCcchhHHH
Confidence            999999999999999999999999999999876667999999999999999999999999999999999998864     


Q ss_pred             --HHHHHHHhCCCCc------------------------cchhhHHHHHHhhhcCCHHHHHHHHHhCCCCHHHHHHHHHH
Q 024194          205 --VLQEVLRCHSIPE------------------------HLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRV  258 (271)
Q Consensus       205 --ll~~~L~~lGi~~------------------------~~~~~v~~~ldkl~~~~~~~i~~~L~~lgLs~~~~~~L~~~  258 (271)
                        ++.++|+.+|+++                        ..+..++..+|++++.+.+.+++.|...|++.+..+.|.++
T Consensus       207 i~l~~~~l~~lgl~~~~~~i~i~~~~i~~~~l~~~~~~~~~~~~v~~~~d~l~k~~~~~l~~~L~~~~~~~~~~~~l~~l  286 (487)
T PLN02530        207 LAAIVTFFKRVGITSSDVGIKVSSRKVLQAVLKSYGIPEESFAPVCVIVDKLEKLPREEIEKELDTLGVSEEAIEGILDV  286 (487)
T ss_pred             HHHHHHHHHHcCCCCCceEEEEcCHHHHHHHHHHcCCchhhHHHHHHHHHhhhhccHHHHHHHHHHcCCCHHHHHHHHHH
Confidence              5667777777752                        22234566788999999999999999999999999999999


Q ss_pred             HhcCCHhHHhcc
Q 024194          259 LSIKSLTELEGW  270 (271)
Q Consensus       259 l~~K~~~~l~~~  270 (271)
                      +..++++.++++
T Consensus       287 ~~~~~~~~l~~~  298 (487)
T PLN02530        287 LSLKSLDDLEAL  298 (487)
T ss_pred             HhccCHHHHHHH
Confidence            987776665543

>KOG1936 consensus Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02972 Histidyl-tRNA synthetase Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>PF13393 tRNA-synt_His: Histidyl-tRNA synthetase; PDB: 3HRI_E 3HRK_A 3LC0_A 1Z7N_A 1Z7M_D 3NET_A 1H4V_B 3OD1_A 4E51_B 3RAC_A Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14799 thrS threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase, family II Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02908 threonyl-tRNA synthetase Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PF00587 tRNA-synt_2b: tRNA synthetase class II core domain (G, H, P, S and T) This Prosite entry contains all class II enzymes Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase, family I Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>PLN02837 threonine-tRNA ligase Back     alignment and domain information
>KOG2324 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>PRK09350 poxB regulator PoxA; Provisional Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF01409 tRNA-synt_2d: tRNA synthetases class II core domain (F); InterPro: IPR002319 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information
>PLN02678 seryl-tRNA synthetase Back     alignment and domain information
>KOG1637 consensus Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase, Methanococcus jannaschii family Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK14894 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02320 seryl-tRNA synthetase Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase-like protein GenX Back     alignment and domain information
>PF00152 tRNA-synt_2: tRNA synthetases class II (D, K and N) ; InterPro: IPR004364 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase, bacterial type Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02734 glycyl-tRNA synthetase Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase, archaeal type Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02903 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00385 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PTZ00417 lysine-tRNA ligase; Provisional Back     alignment and domain information
>PLN02502 lysyl-tRNA synthetase Back     alignment and domain information
>PLN02850 aspartate-tRNA ligase Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase, eukaryotic and non-spirochete bacterial Back     alignment and domain information
>PTZ00425 asparagine-tRNA ligase; Provisional Back     alignment and domain information
>KOG2411 consensus Aspartyl-tRNA synthetase, mitochondrial [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase Back     alignment and domain information
>PTZ00401 aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2509 consensus Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02603 asparaginyl-tRNA synthetase Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02221 asparaginyl-tRNA synthetase Back     alignment and domain information
>PLN02788 phenylalanine-tRNA synthetase Back     alignment and domain information
>PLN02532 asparagine-tRNA synthetase Back     alignment and domain information
>KOG2784 consensus Phenylalanyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit Back     alignment and domain information
>PLN02265 probable phenylalanyl-tRNA synthetase beta chain Back     alignment and domain information
>KOG2298 consensus Glycyl-tRNA synthetase and related class II tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1885 consensus Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00472 pheT_bact phenylalanyl-tRNA synthetase, beta subunit, non-spirochete bacterial Back     alignment and domain information
>COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>CHL00192 syfB phenylalanyl-tRNA synthetase beta chain; Provisional Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase, mitochondrial Back     alignment and domain information
>KOG0554 consensus Asparaginyl-tRNA synthetase (mitochondrial) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0556 consensus Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4163 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK07080 hypothetical protein; Validated Back     alignment and domain information
>COG0072 PheT Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2472 consensus Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00443 hisZ_biosyn_reg ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>KOG0555 consensus Asparaginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3hri_A 456 Histidyl-Trna Synthetase (Apo) From Trypanosoma Bru 5e-50
3hrk_A 456 Histidyl-Trna Synthetase From Trypanosoma Cruzi (Hi 1e-48
1wu7_A 434 Crystal Structure Of Histidyl-Trna Synthetase From 2e-24
1qe0_A 420 Crystal Structure Of Apo S. Aureus Histidyl-Trna Sy 2e-12
4g85_A 517 Crystal Structure Of Human Hisrs Length = 517 2e-08
4g84_A 464 Crystal Structure Of Human Hisrs Length = 464 8e-08
1adj_A 421 Histidyl-Trna Synthetase In Complex With Histidine 2e-07
2el9_A 431 Crystal Structure Of E.Coli Histidyl-Trna Synthetas 2e-07
1kmm_A 424 Histidyl-Trna Synthetase Complexed With Histidyl-Ad 6e-07
1htt_A 423 Histidyl-Trna Synthetase Length = 423 6e-07
4e51_A 467 Crystal Structure Of A Histidyl-Trna Synthetase His 2e-06
3rac_A 373 Crystal Strucutre Of Histidine--Trna Ligase Subunit 4e-04
3od1_A 400 The Crystal Structure Of An Atp Phosphoribosyltrans 6e-04
>pdb|3HRI|A Chain A, Histidyl-Trna Synthetase (Apo) From Trypanosoma Brucei Length = 456 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (493), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 136/239 (56%), Gaps = 31/239 (12%)
Query: 60  SPSPVSDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEAL 119
           +  P S  +  ++  P +G RDFPPE MRLR +LF  F   +R FGFEE D PVLESE L
Sbjct: 16  TQGPGSMQMNMVETEPVQGCRDFPPETMRLRKYLFDVFHSTARKFGFEEYDSPVLESEEL 75
Query: 120 FIRKAGEEIRDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWXX 179
           +IRKAGEEI +Q++ F  +G  RVALRPE+TPSLAR ++ KG+S+ LP KW+++ QCW  
Sbjct: 76  YIRKAGEEITEQMFNFITKGGHRVALRPEMTPSLARQLLAKGRSLLLPAKWYSIPQCWRY 135
Query: 180 XXXXXXXXXEHYQWNMDIIGVPAVT-------------------------------VLQE 208
                    EHYQWNMDIIGV +V+                               +LQ 
Sbjct: 136 EAITRGRRREHYQWNMDIIGVKSVSSEVELVCAACTAMQSLGLSSKDVGVKINSRKILQT 195
Query: 209 VLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTEL 267
           V+    +    F  VC+I+DK+EKLP + +   L + G+    ++ +   LS+K++ E+
Sbjct: 196 VVEQAGVSADKFAPVCVIVDKMEKLPREEVVAQLAAIGLESNVVDAITSTLSLKTIDEI 254
>pdb|3HRK|A Chain A, Histidyl-Trna Synthetase From Trypanosoma Cruzi (Histidyl-Adenylate Complex) Length = 456 Back     alignment and structure
>pdb|1WU7|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Thermoplasma Acidophilum Length = 434 Back     alignment and structure
>pdb|1QE0|A Chain A, Crystal Structure Of Apo S. Aureus Histidyl-Trna Synthetase Length = 420 Back     alignment and structure
>pdb|4G85|A Chain A, Crystal Structure Of Human Hisrs Length = 517 Back     alignment and structure
>pdb|4G84|A Chain A, Crystal Structure Of Human Hisrs Length = 464 Back     alignment and structure
>pdb|1ADJ|A Chain A, Histidyl-Trna Synthetase In Complex With Histidine Length = 421 Back     alignment and structure
>pdb|2EL9|A Chain A, Crystal Structure Of E.Coli Histidyl-Trna Synthetase Complexed With A Histidyl-Adenylate Analogue Length = 431 Back     alignment and structure
>pdb|1KMM|A Chain A, Histidyl-Trna Synthetase Complexed With Histidyl-Adenylate Length = 424 Back     alignment and structure
>pdb|1HTT|A Chain A, Histidyl-Trna Synthetase Length = 423 Back     alignment and structure
>pdb|4E51|A Chain A, Crystal Structure Of A Histidyl-Trna Synthetase Hisrs From Burkholderia Thailandensis Bound To Histidine Length = 467 Back     alignment and structure
>pdb|3RAC|A Chain A, Crystal Strucutre Of Histidine--Trna Ligase Subunit From Alicyclobacillus Acidocaldarius Subsp. Acidocaldarius Dsm 446 Length = 373 Back     alignment and structure
>pdb|3OD1|A Chain A, The Crystal Structure Of An Atp Phosphoribosyltransferase Regulatory SubunitHISTIDYL-Trna Synthetase From Bacillus Halodurans C Length = 400 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 8e-76
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 6e-69
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 1e-66
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 3e-55
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 4e-50
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 2e-49
1z7m_A 344 ATP phosphoribosyltransferase regulatory subunit; 2e-38
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase 5e-30
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase 9e-30
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 2e-29
4e51_A 467 Histidine--tRNA ligase; seattle structural genomic 4e-28
1usy_A 275 ATP phosphoribosyltransferase regulatory subunit; 1e-27
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 3e-09
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Length = 456 Back     alignment and structure
 Score =  236 bits (605), Expect = 8e-76
 Identities = 103/231 (44%), Positives = 141/231 (61%), Gaps = 31/231 (13%)

Query: 69  QKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEI 128
             ++  P +G RDFPPE MR R  LF  F   ++ FGFEE D PVLESE L+IRKAGEEI
Sbjct: 25  NMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEI 84

Query: 129 RDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRR 188
            +Q++ F  +G  RVALRPE+TPSLARL++ KG+S+ LP KW+++ QCWRYE +TRGRRR
Sbjct: 85  TEQMFNFITKGGHRVALRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRR 144

Query: 189 EHYQWNMDIIGVPAVT-------------------------------VLQEVLRCHSIPE 217
           EHYQWNMDI+GV +V+                               VLQ V+    +  
Sbjct: 145 EHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSSKDVGIKVNSRKVLQTVVEQAGVTS 204

Query: 218 HLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELE 268
             F  VC+I+DK+EK+P + ++  L   G+    ++ +   LS+KS+ E+ 
Sbjct: 205 DKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIA 255
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Length = 434 Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 Back     alignment and structure
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Length = 400 Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Length = 373 Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* Length = 290 Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Length = 344 Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Length = 423 Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Length = 420 Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Length = 421 Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Length = 467 Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Length = 275 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Length = 288 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-t 100.0
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; 100.0
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetas 100.0
3rac_A 373 Histidine-tRNA ligase; structural genomics, PSI-bi 100.0
4g85_A 517 Histidine-tRNA ligase, cytoplasmic; synthetase; 3. 100.0
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; 100.0
4g84_A 464 Histidine--tRNA ligase, cytoplasmic; synthetase; 2 100.0
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genom 100.0
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA 100.0
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase 100.0
4e51_A 467 Histidine--tRNA ligase; seattle structural genomic 100.0
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase 99.97
2i4l_A 458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseud 99.94
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; 99.94
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum per 99.94
2j3l_A 572 Prolyl-tRNA synthetase; class II aminoacyl- T synt 99.94
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; cla 99.93
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, 99.93
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase 99.93
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.93
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, m 99.9
1nj1_A 501 PROR, proline-tRNA synthetase, proline--tRNA ligas 99.89
3uh0_A 460 Threonyl-tRNA synthetase, mitochondrial; threonine 99.89
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.88
4hvc_A 519 Bifunctional glutamate/proline--tRNA ligase; ligas 99.86
2zt5_A 693 Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP 99.83
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.81
1ati_A 505 Glycyl-tRNA synthetase; protein biosynthesis, liga 99.81
1ses_A421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 99.78
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 99.75
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-t 99.74
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE 99.71
3qtc_A290 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthet 99.67
3vbb_A 522 Seryl-tRNA synthetase, cytoplasmic; coiled-coil, l 99.6
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 99.59
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.53
3qne_A485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 99.51
3err_A536 Fusion protein of microtubule binding domain from 99.51
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; struc 99.43
1x54_A 434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthe 99.29
1wyd_A 429 Hypothetical aspartyl-tRNA synthetase; archaea, LI 99.25
1g5h_A 454 Mitochondrial DNA polymerase accessory subunit; in 99.25
1n9w_A 422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 99.2
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl- 99.09
1eov_A 487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA sy 99.07
3ikl_A 459 DNA polymerase subunit gamma-2, mitochondrial; tra 99.03
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacy 99.0
3a74_A 493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, 98.99
2du3_A 534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 98.87
1e1o_A 504 Lysyl-tRNA synthetase, heat inducible; ligase, ami 98.84
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enz 98.83
3a5y_A 345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tR 98.81
2du7_A 549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, l 98.74
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterote 98.64
3nem_A 438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, 98.6
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 98.55
2xgt_A 435 Asparaginyl-tRNA synthetase, cytoplasmic; ligase, 98.55
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 98.55
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 98.54
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA s 98.53
3ica_A213 Phenylalanyl-tRNA synthetase beta chain; APC61692. 98.41
3ig2_A213 Phenylalanyl-tRNA synthetase beta chain; phers, MC 98.41
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, lig 98.39
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dim 98.37
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.32
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacyl 98.31
4ex5_A 529 Lysine--tRNA ligase; structural genomics, niaid, n 98.31
3m4p_A 456 Ehasnrs, asparaginyl-tRNA synthetase, putative; am 98.23
4ah6_A 617 Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo 98.21
3i7f_A 548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-bi 98.17
2rhq_B 795 Phenylalanyl-tRNA synthetase beta chain; heterotet 98.16
3pco_A327 Phenylalanyl-tRNA synthetase, alpha subunit; amino 98.05
1b7y_B 785 Phers, protein (phenylalanyl-tRNA synthetase); enz 97.85
3cmq_A 415 Phenylalanyl-tRNA synthetase, mitochondrial; class 97.25
3pco_B 795 Phenylalanyl-tRNA synthetase, beta chain; aminoacy 97.12
>3lc0_A Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA synthetase, ligase, structural G medical structural genomics of pathogenic protozoa; HET: HIS; 1.80A {Trypanosoma cruzi} PDB: 3hrk_A* 3hri_A Back     alignment and structure
Probab=100.00  E-value=1.7e-41  Score=327.39  Aligned_cols=205  Identities=49%  Similarity=0.923  Sum_probs=176.9

Q ss_pred             CccccccccCCCCCCCCCChHHHHHHHHHHHHHHHHHHHcCCeeecCCcccchHHhhhhhccccccccEEEeeCCCCeEe
Q 024194           65 SDDLQKIDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVA  144 (271)
Q Consensus        65 ~~~~~~~~~~~p~G~~d~lp~e~~~~~~i~~~l~~vf~~~Gy~eI~tP~~E~~d~~~~~~g~~~~~~~y~f~D~~G~~la  144 (271)
                      ...+.|+.+++|+|++||+|.+++.+++|++.++++|++|||++|.||+||+.++|.+++|+++.++||+|.|++|+.++
T Consensus        21 ~~~~~m~~~~~p~G~~d~lP~~~~~~~~i~~~i~~~~~~~Gy~eI~tP~lE~~el~~~~~G~~~~~~my~f~D~~g~~l~  100 (456)
T 3lc0_A           21 SMQKNMVETEPVQGCRDFPPEAMRCRRHLFDVFHATAKTFGFEEYDAPVLESEELYIRKAGEEITEQMFNFITKGGHRVA  100 (456)
T ss_dssp             ----CCCCCSCSTTCCCCCHHHHHHHHHHHHHHHHHHHHTTCEECCCCSEEEGGGGCCCSCCHHHHTCEEEECSSSCEEE
T ss_pred             chhhccccccCCCCCcccCHhHHHHHHHHHHHHHHHHHHCCCEEEECCcEeehhhhccccccchhhceEEEEcCCCCEEe
Confidence            34556889999999999999999999999999999999999999999999999999887787778899999999999999


Q ss_pred             eCCCChHHHHHHHHHcCCCCCCCeEEEEEeceeecCCCCCCCCcceEEeEEEEEecCcHH-------HHHHHHHhCCC--
Q 024194          145 LRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVT-------VLQEVLRCHSI--  215 (271)
Q Consensus       145 LRPD~T~~iAR~~a~~~~~~~~P~K~yyig~VfR~e~~~~Gr~REf~Q~gvEiiG~~~~~-------ll~~~L~~lGi--  215 (271)
                      ||||+|+++||+++++....++|+|+||+|+|||+++++.||+|||+|+|+|+||.+++.       ++.++|+.+|+  
T Consensus       101 LRpd~T~~~aR~~~~~~~~~~~P~r~~y~g~vfR~e~~~~gR~ReF~Q~g~ei~G~~~~~~DaEvi~l~~~~l~~lgl~~  180 (456)
T 3lc0_A          101 LRPEMTPSLARLLLGKGRSLLLPAKWYSIPQCWRYEAITRGRRREHYQWNMDIVGVKSVSAEVELVCAACWAMRSLGLSS  180 (456)
T ss_dssp             ECSCSHHHHHHHHHHSCTTCCSSEEEEECCEEECCCC-----CCEEEEEEEEEESCCSTHHHHHHHHHHHHHHHHTTCCT
T ss_pred             cCCcCHHHHHHHHHhcCcccCCCEEEEEeccEEecCCCCCCCccceEEEEEEEEcCCChHhhHHHHHHHHHHHHHcCCCC
Confidence            999999999999999877678899999999999999999999999999999999998754       56677777777  


Q ss_pred             Cc----------------------cchhhHHHHHHhhhcCCHHHHHHHHHhCCCCHHHHHHHHHHHhcCCHhHHhc
Q 024194          216 PE----------------------HLFGKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIKSLTELEG  269 (271)
Q Consensus       216 ~~----------------------~~~~~v~~~ldkl~~~~~~~i~~~L~~lgLs~~~~~~L~~~l~~K~~~~l~~  269 (271)
                      ++                      +....++.++|++++.+++.+++.|..+|++++.++.|.+++..++++.+.+
T Consensus       181 ~~~~i~in~~~il~~~l~~~g~~~~~~~~v~~~idkl~~~~~~~~~~~L~~~~l~~~~~~~l~~~~~~~~~~~l~~  256 (456)
T 3lc0_A          181 KDVGIKVNSRKVLQTVVEQAGVTSDKFAPVCVIVDKMEKIPREEVEAQLAVLGLEPTVVDAITTTLSLKSIDEIAQ  256 (456)
T ss_dssp             TTEEEEEEEHHHHHHHHHHTTCCGGGHHHHHHHHTTTTTSCHHHHHHHHHHTTCCHHHHHHHHHHHTCCSHHHHHH
T ss_pred             CceEEEEcCHHHHHHHHHHcCCCHHHHHHHHHHHHHhcccCHHHHHHHHHHcCCCHHHHHHHHHHhccCCHHHHHH
Confidence            32                      2233567788999999999999999999999999999999998888776654
>3od1_A ATP phosphoribosyltransferase regulatory subunit; structural genomics, PSI-2, protein structure initiative; 1.97A {Bacillus halodurans} Back     alignment and structure
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Back     alignment and structure
>3rac_A Histidine-tRNA ligase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, PSI-BIO; 2.30A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>4g85_A Histidine-tRNA ligase, cytoplasmic; synthetase; 3.11A {Homo sapiens} Back     alignment and structure
>1z7m_A ATP phosphoribosyltransferase regulatory subunit; ATP-PRT, histidine biosynthesis, hiszg, alloste evolution; 2.90A {Lactococcus lactis} SCOP: d.104.1.1 PDB: 1z7n_A* Back     alignment and structure
>4g84_A Histidine--tRNA ligase, cytoplasmic; synthetase; 2.40A {Homo sapiens} Back     alignment and structure
>1wu7_A Histidyl-tRNA synthetase; ligase, structural genomics, dimer; 2.40A {Thermoplasma acidophilum} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>1h4v_B Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synthetase, ATP + L-histidine tRNA(His)-> AMP + PPI + L-histidyl-tRNA(His); 2.4A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1ady_A* 1adj_A Back     alignment and structure
>1htt_A Histidyl-tRNA synthetase; complex (tRNA synthetase/His-adenylate), aminoacyl-tRNA synthase, ligase; HET: HIS AMP; 2.60A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1kmm_A* 1kmn_A* 2el9_A* Back     alignment and structure
>4e51_A Histidine--tRNA ligase; seattle structural genomics center for infectious disease, S aminoacylation, tRNA activation, charged tRNA; HET: HIS; 2.65A {Burkholderia thailandensis} Back     alignment and structure
>1qe0_A Histidyl-tRNA synthetase; class II tRNA synthetase, beta sheet, ligase; 2.70A {Staphylococcus aureus} SCOP: c.51.1.1 d.104.1.1 Back     alignment and structure
>2i4l_A Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomonas palustris} PDB: 2i4m_A* 2i4n_A* 2i4o_A* Back     alignment and structure
>1usy_A ATP phosphoribosyltransferase regulatory subunit; aminoacyl-tRNA synthetase; HET: HIS; 2.52A {Thermotoga maritima} SCOP: d.104.1.1 PDB: 1usy_C* Back     alignment and structure
>3a32_A Probable threonyl-tRNA synthetase 1; aeropyrum pernix K1, protein biosynthesis, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; 2.30A {Aeropyrum pernix} PDB: 3a31_A Back     alignment and structure
>2j3l_A Prolyl-tRNA synthetase; class II aminoacyl- T synthetase, editing, translation; HET: P5A; 2.3A {Enterococcus faecalis} PDB: 2j3m_A* Back     alignment and structure
>1nj8_A Proline-tRNA synthetase, proline--tRNA ligase; class-II tRNA synthetase; 3.20A {Methanocaldococcus jannaschii} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 Back     alignment and structure
>1evl_A Threonyl-tRNA synthetase; amino acid recognition, zinc ION, adenylate analog, deletion mutant, ligase; HET: TSB; 1.55A {Escherichia coli} SCOP: c.51.1.1 d.104.1.1 PDB: 1evk_A* 1fyf_A* 1kog_A* Back     alignment and structure
>1nyr_A Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET: ATP; 2.80A {Staphylococcus aureus} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 PDB: 1nyq_A* Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>1qf6_A THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, mRNA, aminoacylati translational regulation, protein/RNA, ligase-RNA complex; HET: H2U AET G7M 5MU PSU AMP; 2.90A {Escherichia coli} SCOP: c.51.1.1 d.15.10.1 d.67.1.1 d.104.1.1 Back     alignment and structure
>1nj1_A PROR, proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase,; HET: 5CA; 2.55A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>3uh0_A Threonyl-tRNA synthetase, mitochondrial; threonine tRNA, threonyl ADE threonyl sulfamoyl adenylate; HET: TSB; 2.00A {Saccharomyces cerevisiae} PDB: 3ugt_A 3ugq_A* 4eo4_A* Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, RS, translation, ATP-binding, nucleotide-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>4hvc_A Bifunctional glutamate/proline--tRNA ligase; ligase-ligase inhibitor complex; HET: ANP HFG; 2.00A {Homo sapiens} Back     alignment and structure
>2zt5_A Glycyl-tRNA synthetase; ligase, AP4A, glycine, ATP, Gly-AMP, aminoacyl-tRNA synthetase, ATP-binding, charcot-marie-tooth disease, disease mutation; HET: B4P; 2.50A {Homo sapiens} PDB: 2pme_A* 2zt6_A* 2zt7_A* 2zt8_A* 2zxf_A* 2pmf_A 2q5h_A 2q5i_A Back     alignment and structure
>2dq3_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, nationa on protein structural and functional analyses; HET: SSA; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ati_A Glycyl-tRNA synthetase; protein biosynthesis, ligase, aminoacyl-tRNA SYN; 2.75A {Thermus thermophilus} SCOP: c.51.1.1 d.104.1.1 PDB: 1b76_A* 1ggm_A* Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure
>2cja_A Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 2.2A {Methanosarcina barkeri} PDB: 2cim_A* 2cj9_A* 2cjb_A Back     alignment and structure
>3qtc_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP B O-methyl tyrosine binding, magnesium binding, aminoacylatio esterification; HET: 0A1 ANP; 1.75A {Methanosarcina mazei} PDB: 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* 2zin_A* 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 3vqv_A* 3vqw_A* 3vqx_A* 3vqy_A* Back     alignment and structure
>3vbb_A Seryl-tRNA synthetase, cytoplasmic; coiled-coil, ligase; 2.89A {Homo sapiens} Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3lss_A Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, serrs, translation, ATP-binding, nucleotide-binding, structural genomics; HET: ATP; 1.95A {Trypanosoma brucei} PDB: 3lsq_A* Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Back     alignment and structure
>3err_A Fusion protein of microtubule binding domain from mouse cytoplasmic dynein and seryl-tRNA...; coiled coil, ligase; HET: AMP; 2.27A {Mus musculus} PDB: 3j1t_A 3j1u_A Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative, southeast COLL for structural genomics; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 PDB: 3p8t_A 3p8v_A 3p8y_A 3reu_A* 3rex_A* 3rl6_A* Back     alignment and structure
>1x54_A Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics, ligase; HET: 4AD; 1.45A {Pyrococcus horikoshii} PDB: 1x55_A* 1x56_A Back     alignment and structure
>1wyd_A Hypothetical aspartyl-tRNA synthetase; archaea, LIGA; HET: EPE; 2.30A {Sulfolobus tokodaii} Back     alignment and structure
>1g5h_A Mitochondrial DNA polymerase accessory subunit; intermolecular four helix bundle, DNA binding protein; 1.95A {Mus musculus} SCOP: c.51.1.1 d.104.1.1 PDB: 1g5i_A 2g4c_A* 3ikm_B* Back     alignment and structure
>1n9w_A Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A {Thermus thermophilus} SCOP: b.40.4.1 d.104.1.1 PDB: 3kfu_A* Back     alignment and structure
>3mf2_A BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA synthetase, zinc ION, amino acid:[carrier protein] ligase; HET: AMP; 2.15A {Bradyrhizobium japonicum} PDB: 3mey_A* 3mf1_A* 3pzc_A* Back     alignment and structure
>1eov_A ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthetase, tRNA ligase, APO-enzyme, OB-fold,; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.1 d.104.1.1 PDB: 1asy_A* 1asz_A* Back     alignment and structure
>3ikl_A DNA polymerase subunit gamma-2, mitochondrial; transferase; HET: DNA; 3.10A {Homo sapiens} Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>3a74_A Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligase, protein biosynthesis, AMI tRNA synthetase, ATP-binding, magnesium; HET: B4P LYN; 1.80A {Geobacillus stearothermophilus} PDB: 3e9h_A* 3e9i_A* Back     alignment and structure
>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Back     alignment and structure
>1e1o_A Lysyl-tRNA synthetase, heat inducible; ligase, aminoacyl-tRNA synthetase, protein biosynthesis; HET: LYS; 2.12A {Escherichia coli} SCOP: b.40.4.1 d.104.1.1 PDB: 1e1t_A* 1e22_A* 1e24_A* 1lyl_A 1bbu_A* 1bbw_A 1krs_A 1krt_A Back     alignment and structure
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 3teh_A* 2aly_A* 2akw_A* 2amc_A* Back     alignment and structure
>3a5y_A GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA synthetase paralog, translation, lysyl- synthetase, lysyladenylate analog; HET: KAA; 1.90A {Escherichia coli} PDB: 3a5z_A* 3g1z_A* Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>3nem_A Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligase; HET: AMO ATP; 1.89A {Thermococcus kodakarensis} PDB: 3nel_A* 3nen_A 1b8a_A* Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2xgt_A Asparaginyl-tRNA synthetase, cytoplasmic; ligase, ATP-binding, protein biosynthesis; HET: NSS; 1.90A {Brugia malayi} PDB: 2xti_A* Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis} Back     alignment and structure
>3ica_A Phenylalanyl-tRNA synthetase beta chain; APC61692.1, phenylalanyl-tRNA SYNT beta subunit, structural genomics, PSI-2; HET: TAM; 2.44A {Porphyromonas gingivalis} Back     alignment and structure
>3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.09A {Bacteroides fragilis} Back     alignment and structure
>1c0a_A Aspartyl tRNA synthetase; protein-RNA complex, ligase/RNA complex; HET: 4SU H2U QUO G7M 5MU PSU AMP AMO; 2.40A {Escherichia coli} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1il2_A* 1eqr_A* Back     alignment and structure
>1l0w_A Aspartyl-tRNA synthetase; space-grown crystal, dimeric enzyme, flexible domains, ligase; 2.01A {Thermus thermophilus} SCOP: b.40.4.1 d.74.4.1 d.104.1.1 PDB: 1efw_A* 1g51_A Back     alignment and structure
>3bju_A Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- binding, cytoplasm, ligase, nucleotide-binding, phosphoprotein, polymorphism; HET: LYS ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>4ex5_A Lysine--tRNA ligase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LYS; 2.40A {Burkholderia thailandensis} Back     alignment and structure
>3m4p_A Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoacyl-tRNA synthetase, tRNA ligase, AARS, translation, ATP-binding, nucleotide-binding; HET: 4AD; 2.83A {Entamoeba histolytica} PDB: 3m4q_A Back     alignment and structure
>4ah6_A Aspartate--tRNA ligase, mitochondrial; 3.70A {Homo sapiens} Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, LI nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Back     alignment and structure
>3pco_A Phenylalanyl-tRNA synthetase, alpha subunit; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure
>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 3teh_B* 2iy5_B* Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* 3teg_A* 3tup_A Back     alignment and structure
>3pco_B Phenylalanyl-tRNA synthetase, beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix aminoacyl-tRNA synthetase, ATP-binding; HET: PHE AMP; 3.02A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d1kmma2 322 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisR 2e-27
d1wu7a2 327 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisR 2e-26
d1qe0a2 325 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisR 1e-25
d1h4vb2 324 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisR 3e-23
d1z7ma1 318 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase 1e-20
d1usya_ 275 d.104.1.1 (A:) ATP phosphoribosyltransferase regul 4e-19
d1nj8a3268 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) 2e-06
d1hc7a2272 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) 8e-04
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Histidyl-tRNA synthetase (HisRS)
species: Escherichia coli [TaxId: 562]

 Score =  105 bits (263), Expect = 2e-27
 Identities = 43/208 (20%), Positives = 87/208 (41%), Gaps = 9/208 (4%)

Query: 72  DVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEE---I 128
           ++   +G  D+ P +  +   +    + V   +G+ E+  P++E   LF R  GE    +
Sbjct: 1   NIQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAIGEVTDVV 60

Query: 129 RDQLYCFEDRGNRRVALRPELTPSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRR 188
             ++Y FEDR    + LRPE T    R  I+ G   +   + + +G  +R+ER  +GR R
Sbjct: 61  EKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHERPQKGRYR 120

Query: 189 EHYQWNMDIIGVPAVTVLQEVLRCHSIPEHLFGKVCIIIDKIEKLPLDVIKNDLKSA--- 245
           + +Q   ++ G+    +  E++   +      G    +  ++  +     + + + A   
Sbjct: 121 QFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARANYRDALVA 180

Query: 246 ---GMSEAAIEELLRVLSIKSLTELEGW 270
                 E   E+  R +    L  L+  
Sbjct: 181 FLEQHKEKLDEDCKRRMYTNPLRVLDSK 208
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 327 Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Length = 325 Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Length = 324 Back     information, alignment and structure
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Length = 318 Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Length = 275 Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Length = 268 Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Length = 272 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1wu7a2327 Histidyl-tRNA synthetase (HisRS) {Archaeon Thermop 100.0
d1z7ma1 318 ATP phosphoribosyltransferase regulatory subunit H 100.0
d1h4vb2 324 Histidyl-tRNA synthetase (HisRS) {Thermus thermoph 100.0
d1kmma2 322 Histidyl-tRNA synthetase (HisRS) {Escherichia coli 100.0
d1qe0a2 325 Histidyl-tRNA synthetase (HisRS) {Staphylococcus a 100.0
d1usya_ 275 ATP phosphoribosyltransferase regulatory subunit H 99.95
d1nj8a3268 Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanoc 99.73
d1nj1a3265 Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanoth 99.64
d1qf6a4291 Threonyl-tRNA synthetase (ThrRS) {Escherichia coli 99.64
d1nyra4291 Threonyl-tRNA synthetase (ThrRS) {Staphylococcus a 99.62
d1hc7a2272 Prolyl-tRNA synthetase (ProRS) {Thermus thermophil 99.59
d1b76a2331 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 99.55
d1atia2394 Glycyl-tRNA synthetase (GlyRS) {Thermus thermophil 98.89
d1g5ha2290 The aaRS-like accessory subunit of mitochondrial p 98.89
d1seta2311 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 98.79
d1jjca_266 Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS 98.63
d1c0aa3 346 Aspartyl-tRNA synthetase (AspRS) {Escherichia coli 98.58
d1e1oa2 342 Lysyl-tRNA synthetase (LysRS) {Escherichia coli, g 98.47
d1eova2 353 Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (S 98.44
d1b8aa2 335 Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococ 98.41
d1nnha_293 Hypothetical protein PF1951 {Archaeon Pyrococcus f 98.36
d1l0wa3 356 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 98.34
d1n9wa2 304 Aspartyl-tRNA synthetase (AspRS) {Thermus thermoph 98.0
d1jjcb5207 Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, 97.49
>d1wu7a2 d.104.1.1 (A:3-329) Histidyl-tRNA synthetase (HisRS) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain
domain: Histidyl-tRNA synthetase (HisRS)
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]

Probab=100.00  E-value=2e-36  Score=276.89  Aligned_cols=191  Identities=36%  Similarity=0.658  Sum_probs=165.5

Q ss_pred             cccCCCCCCCCCChHHHHHHHHHHHHHHHHHHHcCCeeecCCcccchHHhhhhhccccccccEEEeeCCCCeEeeCCCCh
Q 024194           71 IDVNPPKGTRDFPPEDMRLRNWLFHNFQEVSRLFGFEEVDFPVLESEALFIRKAGEEIRDQLYCFEDRGNRRVALRPELT  150 (271)
Q Consensus        71 ~~~~~p~G~~d~lp~e~~~~~~i~~~l~~vf~~~Gy~eI~tP~~E~~d~~~~~~g~~~~~~~y~f~D~~G~~laLRPD~T  150 (271)
                      +++++|+||+|++|+++..++++++.++++|++|||++|.||+||++|+|..+.|++..+++|+|.|++|+.++||||+|
T Consensus         2 ~~~~~~~G~~D~~p~~~~~~~~i~~~l~~~f~~~Gy~~I~tP~lE~~d~~~~~~g~~~~~~~~~f~D~~g~~l~LRpD~T   81 (327)
T d1wu7a2           2 LQIEKIRGFRDFYPEDMDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSGEELLQQTYSFVDKGGREVTLIPEAT   81 (327)
T ss_dssp             CCCCCCTTCCCBCHHHHHHHHHHHHHHHHHHHHTTCEECBCCSEEETHHHHTTSCTTGGGGSCEEECTTSCEEEECSCSH
T ss_pred             CCCCCCCCCccCCHHHHHHHHHHHHHHHHHHHHcCCeEeECCccchHhhccccCchhHHHHHhhhhcccchhhccccccc
Confidence            56799999999999999999999999999999999999999999999999888788888999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCCCCeEEEEEeceeecCCCCCCCCcceEEeEEEEEecCcHH-------HHHHHHHhCCCCccc-h--
Q 024194          151 PSLARLVIQKGKSVSLPLKWFAVGQCWRYERMTRGRRREHYQWNMDIIGVPAVT-------VLQEVLRCHSIPEHL-F--  220 (271)
Q Consensus       151 ~~iAR~~a~~~~~~~~P~K~yyig~VfR~e~~~~Gr~REf~Q~gvEiiG~~~~~-------ll~~~L~~lGi~~~~-~--  220 (271)
                      +|+||+++++. ..+.|.|+||+|+|||+++++.|+.|||+|+|+|+||.++..       ++.++|+.+|+.+.. +  
T Consensus        82 ~~iar~~~~~~-~~~~p~k~~y~g~VfR~~~~~~g~~re~~Q~G~EiiG~~~~~~D~Eii~l~~~~l~~~~~~~~~~i~l  160 (327)
T d1wu7a2          82 PSTVRMVTSRK-DLQRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEADAEVIALASSILDRLGLQDIYEIRI  160 (327)
T ss_dssp             HHHHHHHTTCT-TCCSSEEEEECCEEECCCCSCSSCCSEEEEEEEEEESCCSHHHHHHHHHHHHHHHHHTTTTTSEEEEE
T ss_pred             chhhhHhhhhh-hccccceeeccCcceeccccccCCcchhhhhhhhhcCCcchHHHHHHHHHHHHHHhccccccceeecc
Confidence            99999988764 457899999999999999999999999999999999998865       667788888875421 1  


Q ss_pred             ------------------hhHHHHHHhhhcCCHHHHHHHHHhCCCCHHHHHHHHHHHhcC
Q 024194          221 ------------------GKVCIIIDKIEKLPLDVIKNDLKSAGMSEAAIEELLRVLSIK  262 (271)
Q Consensus       221 ------------------~~v~~~ldkl~~~~~~~i~~~L~~lgLs~~~~~~L~~~l~~K  262 (271)
                                        ..+...+++.++...+.+.+.|...+...+....+.++...+
T Consensus       161 ~~~~i~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~  220 (327)
T d1wu7a2         161 NSRKIMEEIIGGMTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSMIADLCSGT  220 (327)
T ss_dssp             EEHHHHHHHHHTTCSSCHHHHHHHHHTTTTSCHHHHHHHHHHTTCCHHHHHHHHHHHHSC
T ss_pred             cchhhHHHHHHhhhhhHHHHHHHHHHHHHhhccchhhhhhhhhhhhhHHHhhhhhhcccc
Confidence                              012334456677777888888888888888888888877654
>d1z7ma1 d.104.1.1 (A:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1h4vb2 d.104.1.1 (B:2-325) Histidyl-tRNA synthetase (HisRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kmma2 d.104.1.1 (A:4-325) Histidyl-tRNA synthetase (HisRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qe0a2 d.104.1.1 (A:1-325) Histidyl-tRNA synthetase (HisRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1usya_ d.104.1.1 (A:) ATP phosphoribosyltransferase regulatory subunit HisZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nj8a3 d.104.1.1 (A:0-267) Prolyl-tRNA synthetase (ProRS) {Archaeon (Methanocaldococcus jannaschii) [TaxId: 2190]} Back     information, alignment and structure
>d1nj1a3 d.104.1.1 (A:19-283) Prolyl-tRNA synthetase (ProRS) {Arhaeon (Methanothermobacter thermautotrophicus) [TaxId: 145262]} Back     information, alignment and structure
>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyra4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hc7a2 d.104.1.1 (A:5-276) Prolyl-tRNA synthetase (ProRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b76a2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1atia2 d.104.1.1 (A:1-394) Glycyl-tRNA synthetase (GlyRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g5ha2 d.104.1.1 (A:41-330) The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1seta2 d.104.1.1 (A:111-421) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1jjca_ d.104.1.1 (A:) Phenyl-tRNA synthetase (PheRS) alpha subunit, PheS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c0aa3 d.104.1.1 (A:107-287,A:421-585) Aspartyl-tRNA synthetase (AspRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e1oa2 d.104.1.1 (A:161-502) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]} Back     information, alignment and structure
>d1eova2 d.104.1.1 (A:205-557) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b8aa2 d.104.1.1 (A:104-438) Aspartyl-tRNA synthetase (AspRS) {Archaeon Pyrococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1nnha_ d.104.1.1 (A:) Hypothetical protein PF1951 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l0wa3 d.104.1.1 (A:105-294,A:415-580) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]} Back     information, alignment and structure
>d1n9wa2 d.104.1.1 (A:111-414) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-2 [TaxId: 274]} Back     information, alignment and structure
>d1jjcb5 d.104.1.1 (B:475-681) Phenyl-tRNA synthetase (PheRS) beta subunit, PheT, central domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure