Citrus Sinensis ID: 024287

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENELKFKSEELTLQTQC
cccHHHHHccccccccccEEEEEEcccccccccccccHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEEccccccccEEEEEEEcccccHHHHHHHHHccccccEEEEEEcccccHHHHccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHccccccccccccc
cccHHHHHHcccccHHHEEEEEEcHHHHHHHccccHHHHHHHHHHcccHHHHcEEEEEccccHHHHHHHHHHHHcccccccEEEEEEccccccccEEEEEEEcccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHcccccHHHHHHHHHHHHccccEEEEEEHHHHcccccccccEEEEEccccccHHHEEEEcccccccccccccEEEEEEcccHHHHHHHHHHHHHHHcccccccccc
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSScnnrqtvfasasipqHRRFLHNCiqqkwtksdVVHVHVNaikplpsclhhRFVICGKKMKYQTLLSLIqsdapesgiifvgeqsekskkagnapstTLLVDFLSnsykgssdvLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDiaargidlpetthiynfdlprsAIDYLHRagrtgrkpfsdekwtvtsiitSEELFVLQRYENELKFKSEELTLQTQC
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEqsekskkagnapSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGrtgrkpfsdekwtvtsiitseelfvLQRYENelkfkseeltlqtqc
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNsskqvsslkkllasyssCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENELKFKSEELTLQTQC
***LCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFV****************TLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENEL*************
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENELKFKSEELTLQ***
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQ*********APSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENELKFKSEELTLQTQC
*GSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENELKFKSEE*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYENELKFKSEELTLQTQC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
Q3E9C3472 DEAD-box ATP-dependent RN yes no 0.985 0.561 0.739 1e-118
Q0JFN7438 DEAD-box ATP-dependent RN yes no 0.988 0.607 0.662 1e-107
P0A4D8 524 Probable ATP-dependent RN yes no 0.843 0.433 0.278 1e-18
P0A4D7 524 Probable ATP-dependent RN yes no 0.843 0.433 0.278 1e-18
Q5QYF8425 ATP-dependent RNA helicas yes no 0.739 0.468 0.277 1e-18
Q65N62 487 DEAD-box ATP-dependent RN yes no 0.881 0.486 0.258 5e-18
Q6CLR3627 ATP-dependent RNA helicas yes no 0.765 0.328 0.288 1e-17
P96614 494 DEAD-box ATP-dependent RN yes no 0.884 0.481 0.263 2e-17
Q5L3G9467 DEAD-box ATP-dependent RN yes no 0.884 0.509 0.259 2e-17
Q6HPE6 528 DEAD-box ATP-dependent RN yes no 0.892 0.454 0.253 2e-16
>sp|Q3E9C3|RH58_ARATH DEAD-box ATP-dependent RNA helicase 58, chloroplastic OS=Arabidopsis thaliana GN=RH58 PE=2 SV=1 Back     alignment and function desciption
 Score =  423 bits (1088), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 196/265 (73%), Positives = 231/265 (87%)

Query: 1   MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASAS 60
           + SLC ++EKHIF+++SV+VLV+DEVDFLF SSKQV S++KLL S+SSC+ RQTVFASAS
Sbjct: 208 VASLCHMLEKHIFRIDSVRVLVVDEVDFLFYSSKQVGSVRKLLTSFSSCDKRQTVFASAS 267

Query: 61  IPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDA 120
           IPQH+ F+H+CIQQKWTK DVVHVHV+AI P+P CL HRFV+C K  K+Q LL+L++SDA
Sbjct: 268 IPQHKHFVHDCIQQKWTKRDVVHVHVSAIMPMPLCLLHRFVMCEKTNKHQVLLALLESDA 327

Query: 121 PESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEV 180
           PES IIFVGEQSEKSKKAGN PSTTLL++FL  SYKGS ++LLLE +MNFNSRAASL E+
Sbjct: 328 PESAIIFVGEQSEKSKKAGNDPSTTLLMEFLKTSYKGSLEILLLEGDMNFNSRAASLTEI 387

Query: 181 RQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSI 240
           RQGGG+LLVSTDIAARGIDLPETTHI+NFDLP++  DYLHRAGR GRKPFSD K  V ++
Sbjct: 388 RQGGGFLLVSTDIAARGIDLPETTHIFNFDLPQTVTDYLHRAGRAGRKPFSDRKCIVANL 447

Query: 241 ITSEELFVLQRYENELKFKSEELTL 265
           ITSEE FVLQRYENEL F  EE+ L
Sbjct: 448 ITSEERFVLQRYENELMFSCEEMML 472

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q0JFN7|RH58_ORYSJ DEAD-box ATP-dependent RNA helicase 58, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0970600 PE=2 SV=2 Back     alignment and function description
>sp|P0A4D8|EXP9_STRR6 Probable ATP-dependent RNA helicase exp9 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=exp9 PE=3 SV=1 Back     alignment and function description
>sp|P0A4D7|EXP9_STRPN Probable ATP-dependent RNA helicase exp9 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp9 PE=3 SV=1 Back     alignment and function description
>sp|Q5QYF8|RHLB_IDILO ATP-dependent RNA helicase RhlB OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rhlB PE=3 SV=1 Back     alignment and function description
>sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=cshA PE=3 SV=1 Back     alignment and function description
>sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 Back     alignment and function description
>sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 Back     alignment and function description
>sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 Back     alignment and function description
>sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
225432566 482 PREDICTED: DEAD-box ATP-dependent RNA he 0.992 0.553 0.801 1e-125
297737002 486 unnamed protein product [Vitis vinifera] 0.992 0.549 0.801 1e-125
255552301 476 dead box ATP-dependent RNA helicase, put 0.985 0.556 0.788 1e-124
224111250310 predicted protein [Populus trichocarpa] 0.985 0.854 0.796 1e-123
356520045 472 PREDICTED: DEAD-box ATP-dependent RNA he 0.977 0.557 0.764 1e-118
11385602 425 putative chloroplast RNA helicase VDL' i 0.977 0.618 0.756 1e-117
11385596 466 putative chloroplast RNA helicase VDL' i 0.977 0.564 0.756 1e-117
11385586 466 putative chloroplast RNA helicase VDL is 0.977 0.564 0.752 1e-117
42573431 472 DEAD-box ATP-dependent RNA helicase 58 [ 0.985 0.561 0.739 1e-116
30687194315 DEAD-box ATP-dependent RNA helicase 58 [ 0.985 0.841 0.739 1e-116
>gi|225432566|ref|XP_002277780.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 58, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/267 (80%), Positives = 235/267 (88%)

Query: 3   SLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIP 62
           SLCQ++EK IFKLES++VLVIDEVDF+FN+SKQV SL+KLL SYSS NNRQTVFASASIP
Sbjct: 216 SLCQMLEKQIFKLESMRVLVIDEVDFMFNASKQVGSLRKLLTSYSSTNNRQTVFASASIP 275

Query: 63  QHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPE 122
           QHRRFLH+CIQQKWTKSDVVHVHVN I+P+PS LHHRFVIC K  + QTLLSL+ SDAPE
Sbjct: 276 QHRRFLHDCIQQKWTKSDVVHVHVNPIEPMPSSLHHRFVICNKYERRQTLLSLLHSDAPE 335

Query: 123 SGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEVRQ 182
            GIIFVGEQSEKSKKAGNAPS TLL+DFL  SY G  D+LLLEE+MNFN RAASL EVRQ
Sbjct: 336 CGIIFVGEQSEKSKKAGNAPSATLLIDFLKTSYGGCPDILLLEEDMNFNLRAASLSEVRQ 395

Query: 183 GGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIIT 242
            GGYLL+STDIAARG+DLPETTHIYNFDLPR+ +DYLHRAGR  RKPFSD+K  VT+IIT
Sbjct: 396 RGGYLLISTDIAARGVDLPETTHIYNFDLPRTVVDYLHRAGRAARKPFSDQKCCVTNIIT 455

Query: 243 SEELFVLQRYENELKFKSEELTLQTQC 269
           SEE FVLQRYENEL F  EEL L TQC
Sbjct: 456 SEERFVLQRYENELMFHCEELFLSTQC 482

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737002|emb|CBI26203.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255552301|ref|XP_002517195.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223543830|gb|EEF45358.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224111250|ref|XP_002315792.1| predicted protein [Populus trichocarpa] gi|222864832|gb|EEF01963.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356520045|ref|XP_003528676.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 58, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|11385602|gb|AAG34882.1|AF261027_1 putative chloroplast RNA helicase VDL' isoform 4 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|11385596|gb|AAG34879.1|AF261024_1 putative chloroplast RNA helicase VDL' isoform 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|11385586|gb|AAG34873.1|AF261020_1 putative chloroplast RNA helicase VDL isoform 1 [Nicotiana tabacum] gi|11385590|gb|AAG34876.1|AF261021_1 putative chloroplast RNA helicase VDL isoform 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|42573431|ref|NP_974812.1| DEAD-box ATP-dependent RNA helicase 58 [Arabidopsis thaliana] gi|108861900|sp|Q3E9C3.1|RH58_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 58, chloroplastic; Flags: Precursor gi|332005287|gb|AED92670.1| DEAD-box ATP-dependent RNA helicase 58 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30687194|ref|NP_197422.2| DEAD-box ATP-dependent RNA helicase 58 [Arabidopsis thaliana] gi|28393829|gb|AAO42322.1| putative DEAD/DEAH box RNA helicase protein [Arabidopsis thaliana] gi|199589352|gb|ACH90467.1| At5g19210 [Arabidopsis thaliana] gi|332005288|gb|AED92671.1| DEAD-box ATP-dependent RNA helicase 58 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
TAIR|locus:2182202472 AT5G19210 [Arabidopsis thalian 0.985 0.561 0.694 5.8e-98
FB|FBgn0086130536 KH1 "KH1" [Drosophila melanoga 0.884 0.444 0.295 1.2e-17
UNIPROTKB|Q9KU63423 VC_0660 "ATP-dependent RNA hel 0.420 0.267 0.362 1.7e-16
TIGR_CMR|VC_0660423 VC_0660 "ATP-dependent RNA hel 0.420 0.267 0.362 1.7e-16
TIGR_CMR|GSU_0914447 GSU_0914 "ATP-dependent RNA he 0.631 0.380 0.310 1.5e-15
POMBASE|SPBC543.06c453 dbp8 "ATP-dependent RNA helica 0.899 0.534 0.289 1.5e-14
UNIPROTKB|P21507444 srmB "SrmB, DEAD-box RNA helic 0.379 0.229 0.390 1.8e-14
UNIPROTKB|F1NL04542 DDX4 "Uncharacterized protein" 0.776 0.385 0.277 3.6e-14
UNIPROTKB|F1N991568 DDX4 "Uncharacterized protein" 0.776 0.367 0.277 3.9e-14
POMBASE|SPCC1795.11636 sum3 "translation initiation R 0.773 0.327 0.271 7.9e-14
TAIR|locus:2182202 AT5G19210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 973 (347.6 bits), Expect = 5.8e-98, P = 5.8e-98
 Identities = 184/265 (69%), Positives = 216/265 (81%)

Query:     1 MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNXXXXXXXXXXXXXXXXXCNNRQTVFASAS 60
             + SLC ++EKHIF+++SV+VLV+DEVDFLF                  C+ RQTVFASAS
Sbjct:   208 VASLCHMLEKHIFRIDSVRVLVVDEVDFLFYSSKQVGSVRKLLTSFSSCDKRQTVFASAS 267

Query:    61 IPQHRRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDA 120
             IPQH+ F+H+CIQQKWTK DVVHVHV+AI P+P CL HRFV+C K  K+Q LL+L++SDA
Sbjct:   268 IPQHKHFVHDCIQQKWTKRDVVHVHVSAIMPMPLCLLHRFVMCEKTNKHQVLLALLESDA 327

Query:   121 PESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRAASLLEV 180
             PES IIFVGEQSEKSKKAGN PSTTLL++FL  SYKGS ++LLLE +MNFNSRAASL E+
Sbjct:   328 PESAIIFVGEQSEKSKKAGNDPSTTLLMEFLKTSYKGSLEILLLEGDMNFNSRAASLTEI 387

Query:   181 RQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSI 240
             RQGGG+LLVSTDIAARGIDLPETTHI+NFDLP++  DYLHRAGR GRKPFSD K  V ++
Sbjct:   388 RQGGGFLLVSTDIAARGIDLPETTHIFNFDLPQTVTDYLHRAGRAGRKPFSDRKCIVANL 447

Query:   241 ITSEELFVLQRYENELKFKSEELTL 265
             ITSEE FVLQRYENEL F  EE+ L
Sbjct:   448 ITSEERFVLQRYENELMFSCEEMML 472
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
FB|FBgn0086130 KH1 "KH1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KU63 VC_0660 "ATP-dependent RNA helicase SrmB" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0660 VC_0660 "ATP-dependent RNA helicase SrmB" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0914 GSU_0914 "ATP-dependent RNA helicase RhlE" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
POMBASE|SPBC543.06c dbp8 "ATP-dependent RNA helicase Dbp8 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|P21507 srmB "SrmB, DEAD-box RNA helicase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|F1NL04 DDX4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N991 DDX4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
POMBASE|SPCC1795.11 sum3 "translation initiation RNA helicase Sum3" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0JFN7RH58_ORYSJ3, ., 6, ., 4, ., 1, 30.66290.98880.6073yesno
Q3E9C3RH58_ARATH3, ., 6, ., 4, ., 1, 30.73960.98510.5614yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.914
3rd Layer3.6.40.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 3e-31
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-20
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 8e-17
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-15
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-15
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 9e-15
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 1e-14
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 3e-14
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 6e-14
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-11
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 9e-11
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-10
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 8e-10
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-06
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 2e-05
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-05
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-04
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 8e-04
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  120 bits (303), Expect = 3e-31
 Identities = 76/272 (27%), Positives = 132/272 (48%), Gaps = 42/272 (15%)

Query: 2   GSLCQLIEKHIFKLESVQVLVIDEVDFLFNSS--KQVSSLKKLLASYSSCNNRQTVFASA 59
           G L  LI++    L  V+ LV+DE D + +      +  + K L       +RQT+  SA
Sbjct: 159 GRLLDLIKRGKLDLSGVETLVLDEADRMLDMGFIDDIEKILKALP-----PDRQTLLFSA 213

Query: 60  SIPQH-----RRFLHNCIQQKWTKSDVVHVHVNAIKPLPSCLHHRFVIC-GKKMKYQTLL 113
           ++P       RR+L++ ++        + V V  ++     +   ++    ++ K + LL
Sbjct: 214 TMPDDIRELARRYLNDPVE--------IEVSVEKLERTLKKIKQFYLEVESEEEKLELLL 265

Query: 114 SLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYK--GSSDVLLLEEEMNFN 171
            L++ +     I+FV     ++K+         LV+ L+ S +  G   V  L  ++   
Sbjct: 266 KLLKDEDEGRVIVFV-----RTKR---------LVEELAESLRKRGFK-VAALHGDLPQE 310

Query: 172 SRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFS 231
            R  +L + + G   +LV+TD+AARG+D+P+ +H+ N+DLP    DY+HR GRTGR   +
Sbjct: 311 ERDRALEKFKDGELRVLVATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGR---A 367

Query: 232 DEKWTVTSIITS-EELFVLQRYENELKFKSEE 262
             K    S +T  EE+  L+R E  L+ K   
Sbjct: 368 GRKGVAISFVTEEEEVKKLKRIEKRLERKLPS 399

Length = 513
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
PTZ00110545 helicase; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
KOG0346 569 consensus RNA helicase [RNA processing and modific 100.0
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
PRK13767 876 ATP-dependent helicase; Provisional 99.98
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 99.98
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.98
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.97
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.97
PRK02362 737 ski2-like helicase; Provisional 99.97
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.97
PRK00254 720 ski2-like helicase; Provisional 99.97
PHA02653 675 RNA helicase NPH-II; Provisional 99.96
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.96
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.96
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.96
PRK01172 674 ski2-like helicase; Provisional 99.96
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.95
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.95
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.95
PRK10689 1147 transcription-repair coupling factor; Provisional 99.95
COG1201 814 Lhr Lhr-like helicases [General function predictio 99.95
PRK09401 1176 reverse gyrase; Reviewed 99.94
COG1202 830 Superfamily II helicase, archaea-specific [General 99.94
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.94
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.94
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.93
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.93
COG1204 766 Superfamily II helicase [General function predicti 99.93
PHA02558501 uvsW UvsW helicase; Provisional 99.91
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.91
PRK14701 1638 reverse gyrase; Provisional 99.91
PRK04914 956 ATP-dependent helicase HepA; Validated 99.9
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.9
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.89
PRK13766 773 Hef nuclease; Provisional 99.89
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.88
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.88
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.88
KOG0354 746 consensus DEAD-box like helicase [General function 99.86
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.86
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.86
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.86
PRK09694 878 helicase Cas3; Provisional 99.86
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.86
PRK05298652 excinuclease ABC subunit B; Provisional 99.85
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.85
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.84
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.83
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.83
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.83
COG1205 851 Distinct helicase family with a unique C-terminal 99.82
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.82
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.81
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.81
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.81
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.81
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.81
PRK05580 679 primosome assembly protein PriA; Validated 99.79
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.78
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.78
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.76
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.75
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.75
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.75
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.74
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.73
smart0049082 HELICc helicase superfamily c-terminal domain. 99.68
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.66
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.64
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.64
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.6
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.59
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.59
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.51
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.49
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.45
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.41
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.4
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.38
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.38
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.33
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.3
KOG1123776 consensus RNA polymerase II transcription initiati 99.26
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.22
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.12
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.11
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.0
COG4096 875 HsdR Type I site-specific restriction-modification 98.96
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.9
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 98.87
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.81
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.77
PRK12326 764 preprotein translocase subunit SecA; Reviewed 98.76
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 98.71
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 98.63
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.62
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 98.6
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 98.59
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 98.58
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.57
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.54
KOG0387 923 consensus Transcription-coupled repair protein CSB 98.53
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 98.52
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 98.5
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.4
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.35
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 98.35
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.3
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.28
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.21
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 98.2
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.19
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.16
PRK14873 665 primosome assembly protein PriA; Provisional 98.09
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.01
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 97.95
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 97.94
COG4889 1518 Predicted helicase [General function prediction on 97.87
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 97.84
smart00487201 DEXDc DEAD-like helicases superfamily. 97.75
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.48
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 97.36
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 97.34
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.27
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.2
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 97.09
PF13871 278 Helicase_C_4: Helicase_C-like 97.08
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 96.95
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 96.83
KOG4439901 consensus RNA polymerase II transcription terminat 96.76
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 96.63
PRK14873 665 primosome assembly protein PriA; Provisional 96.34
COG1198 730 PriA Primosomal protein N' (replication factor Y) 95.96
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 95.9
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 95.88
KOG1002791 consensus Nucleotide excision repair protein RAD16 95.65
PRK05580 679 primosome assembly protein PriA; Validated 95.63
TIGR00595 505 priA primosomal protein N'. All proteins in this f 95.52
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 95.29
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 95.04
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 94.92
COG0610 962 Type I site-specific restriction-modification syst 94.5
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 94.14
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 93.95
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 93.89
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 93.7
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 93.53
PRK10689 1147 transcription-repair coupling factor; Provisional 93.06
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 92.65
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 91.39
PRK14701 1638 reverse gyrase; Provisional 91.28
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 91.28
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 90.87
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 90.54
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.1
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 89.73
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 89.31
PRK06893229 DNA replication initiation factor; Validated 88.9
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 88.85
KOG0389 941 consensus SNF2 family DNA-dependent ATPase [Chroma 88.56
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 87.91
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 87.81
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 87.74
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 87.34
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 85.03
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 83.99
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 83.72
PRK08084235 DNA replication initiation factor; Provisional 83.65
PRK12422445 chromosomal replication initiation protein; Provis 83.52
PRK08727233 hypothetical protein; Validated 83.18
PRK05642234 DNA replication initiation factor; Validated 83.02
PRK00149450 dnaA chromosomal replication initiation protein; R 82.98
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 82.25
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 81.11
PRK14086617 dnaA chromosomal replication initiation protein; P 80.99
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 80.75
TIGR00362405 DnaA chromosomal replication initiator protein Dna 80.63
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 80.25
PRK14087450 dnaA chromosomal replication initiation protein; P 80.13
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1e-50  Score=317.92  Aligned_cols=242  Identities=24%  Similarity=0.388  Sum_probs=226.2

Q ss_pred             CchhhHHHHhCceecCcccEEEEeccccccCCchhhhHHHHHHhhhccCCCccEEEEeccCCchhhHHHHHHhhhcccCc
Q 024287            1 MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSD   80 (269)
Q Consensus         1 pgrl~~~l~~~~~~l~~~~~lViDE~~~l~~~~~~~~~i~~i~~~~~~~~~~q~i~~SATl~~~~~~l~~~~~~~~~~~~   80 (269)
                      |||++++++++.++.+.++++|+||+|.|++.| +...+..+.+.++  +..|++++|||+|..+....+.++     .+
T Consensus       153 PGrv~dmikr~~L~tr~vkmlVLDEaDemL~kg-fk~Qiydiyr~lp--~~~Qvv~~SATlp~eilemt~kfm-----td  224 (400)
T KOG0328|consen  153 PGRVLDMIKRRSLRTRAVKMLVLDEADEMLNKG-FKEQIYDIYRYLP--PGAQVVLVSATLPHEILEMTEKFM-----TD  224 (400)
T ss_pred             CchHHHHHHhccccccceeEEEeccHHHHHHhh-HHHHHHHHHHhCC--CCceEEEEeccCcHHHHHHHHHhc-----CC
Confidence            999999999999999999999999999999998 5589999999986  899999999999999887765554     67


Q ss_pred             eeEEeecCcccCCCcceeEEEEecCc-chHHHHHHHHhhcCCCceEEEeeccchhhhhcCCCCchHHHHHHHhhhcCCCC
Q 024287           81 VVHVHVNAIKPLPSCLHHRFVICGKK-MKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSS  159 (269)
Q Consensus        81 ~~~~~~~~~~~~~~~i~~~~~~~~~~-~k~~~l~~ll~~~~~~~~lIF~~s~~~~~~~~~~~~~~~~~~~~l~~~~~~~~  159 (269)
                      ++.+.+.+.+.+..++.++|+.+..+ +|++.|.++.....-.+.+|||||+..          +..+.+.+.+.   ++
T Consensus       225 pvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd~LtItQavIFcnTk~k----------VdwLtekm~~~---nf  291 (400)
T KOG0328|consen  225 PVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRK----------VDWLTEKMREA---NF  291 (400)
T ss_pred             ceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhhhhehheEEEEecccch----------hhHHHHHHHhh---Cc
Confidence            88999999999999999999999775 599999999998888899999999885          67788888776   78


Q ss_pred             ceEEecccCChhHHHHHHHHHhcCCccEEEEeccccccCCCCCCCeEEEecCCCCccccccccccCCCCCCCCCCeEEEE
Q 024287          160 DVLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTS  239 (269)
Q Consensus       160 ~v~~~h~~~~~~~r~~~~~~f~~~~~~iLv~T~~~~~Gidi~~~~~Vi~~~~p~~~~~~~qr~GR~gR~~~~~~~g~~~~  239 (269)
                      .+...||+|++++|++++++|++|..++|++||+.+||+|+|.+++|||||+|.+.+.|+||+||.||.|   ++|.++.
T Consensus       292 tVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGiDv~qVslviNYDLP~nre~YIHRIGRSGRFG---RkGvain  368 (400)
T KOG0328|consen  292 TVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFG---RKGVAIN  368 (400)
T ss_pred             eeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccCCcceeEEEEecCCCccHHHHhhhhccccccC---CcceEEE
Confidence            8999999999999999999999999999999999999999999999999999999999999999999999   8999999


Q ss_pred             ecCchhHHHHHHHHHHhcCcccccccc
Q 024287          240 IITSEELFVLQRYENELKFKSEELTLQ  266 (269)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  266 (269)
                      |+..+|...+..+++.+...+.++|++
T Consensus       369 FVk~~d~~~lrdieq~yst~i~emp~n  395 (400)
T KOG0328|consen  369 FVKSDDLRILRDIEQYYSTQIDEMPMN  395 (400)
T ss_pred             EecHHHHHHHHHHHHHHhhhcccccch
Confidence            999999999999999999999999986

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 5e-14
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-12
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 5e-12
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 6e-12
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-11
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-11
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-11
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-11
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-11
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 7e-11
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-10
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-10
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-10
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-10
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 1e-09
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-09
2jgn_A185 Ddx3 Helicase Domain Length = 185 1e-09
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 2e-09
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 5e-09
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 1e-08
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 2e-08
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-08
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 2e-08
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 3e-08
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 4e-08
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 6e-08
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 6e-08
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 6e-08
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 8e-08
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 8e-08
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 9e-07
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 2e-06
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 3e-06
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 1e-05
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-05
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-05
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-05
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 3e-05
1fuu_A394 Yeast Initiation Factor 4a Length = 394 3e-05
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 4e-05
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-05
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 6e-05
3i32_A 300 Dimeric Structure Of A Hera Helicase Fragment Inclu 5e-04
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 6e-04
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 55/86 (63%), Gaps = 3/86 (3%)
Query: 164 LEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAG 223
           LE EM    R  ++  + +G   +LV+TD+AARGID+P+ +H++NFD+PRS   YLHR G
Sbjct: 60  LEGEMVQGKRNEAIKRLTEGRVNVLVATDVAARGIDIPDVSHVFNFDMPRSGDTYLHRIG 119
Query: 224 RTGRKPFSDEKWTVTSIITSEELFVL 249
           RT R   +  K T  S++ + +  +L
Sbjct: 120 RTAR---AGRKGTAISLVEAHDHLLL 142
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-32
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-28
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 6e-28
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 2e-27
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-26
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 3e-26
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-26
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 9e-26
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-25
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-25
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-24
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-24
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 9e-24
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 4e-23
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-22
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-22
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-22
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-22
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 4e-22
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 4e-22
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 5e-21
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 5e-21
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 9e-19
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 1e-18
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 5e-18
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 5e-12
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 7e-08
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 2e-07
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 6e-07
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 3e-06
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 100.0
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 100.0
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.98
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.97
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 99.97
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.97
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.97
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.97
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.97
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.97
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 99.97
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.97
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.97
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.97
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.97
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.96
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.96
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.96
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.96
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.93
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.96
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.95
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.95
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.95
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.95
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.95
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.95
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.95
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.95
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.95
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.94
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.94
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.94
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.94
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.94
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.93
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.93
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.92
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.92
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.91
3h1t_A590 Type I site-specific restriction-modification syst 99.91
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.88
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.87
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.83
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.82
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.82
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.76
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.21
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.19
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.13
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.11
3bor_A237 Human initiation factor 4A-II; translation initiat 99.07
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.06
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.06
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.04
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.02
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.02
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.01
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.99
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 98.96
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.96
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 98.69
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 98.36
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 98.35
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 98.2
3b6e_A216 Interferon-induced helicase C domain-containing P; 98.09
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.96
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 97.72
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.45
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.93
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 94.84
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 93.45
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 91.33
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 91.12
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 87.08
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 84.83
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 82.26
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 82.12
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 81.67
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 81.21
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 80.92
3bor_A237 Human initiation factor 4A-II; translation initiat 80.59
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 80.49
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=8.8e-42  Score=299.50  Aligned_cols=242  Identities=21%  Similarity=0.363  Sum_probs=210.2

Q ss_pred             CchhhHHHHhCceecCcccEEEEeccccccCCchhhhHHHHHHhhhccCCCccEEEEeccCCchhhHHHHHHhhhcccCc
Q 024287            1 MGSLCQLIEKHIFKLESVQVLVIDEVDFLFNSSKQVSSLKKLLASYSSCNNRQTVFASASIPQHRRFLHNCIQQKWTKSD   80 (269)
Q Consensus         1 pgrl~~~l~~~~~~l~~~~~lViDE~~~l~~~~~~~~~i~~i~~~~~~~~~~q~i~~SATl~~~~~~l~~~~~~~~~~~~   80 (269)
                      ||||.+++.++.+.+++++++|+||||++++++ +...+..++..+......|++++|||+|+.+..+...+.     .+
T Consensus       187 p~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~g-f~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l-----~~  260 (434)
T 2db3_A          187 PGRLLDFVDRTFITFEDTRFVVLDEADRMLDMG-FSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFL-----KN  260 (434)
T ss_dssp             HHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTT-THHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTC-----SS
T ss_pred             hHHHHHHHHhCCcccccCCeEEEccHhhhhccC-cHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhc-----cC
Confidence            799999999999999999999999999999998 558888998876445789999999999998776554322     35


Q ss_pred             eeEEeecCcccCCCcceeEEEEecCcchHHHHHHHHhhcCCCceEEEeeccchhhhhcCCCCchHHHHHHHhhhcCCCCc
Q 024287           81 VVHVHVNAIKPLPSCLHHRFVICGKKMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSD  160 (269)
Q Consensus        81 ~~~~~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~~~lIF~~s~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  160 (269)
                      +..+..........++.+.+..+....|...+.+++..... ++||||++++.|+          .+++.|.+.   ++.
T Consensus       261 ~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~~lVF~~t~~~a~----------~l~~~L~~~---~~~  326 (434)
T 2db3_A          261 YVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVETKRGAD----------FLASFLSEK---EFP  326 (434)
T ss_dssp             CEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-TEEEECSSHHHHH----------HHHHHHHHT---TCC
T ss_pred             CEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCC-CEEEEEeCcHHHH----------HHHHHHHhC---CCC
Confidence            66666666666677889999999888999999999987654 5999999999754          477888776   688


Q ss_pred             eEEecccCChhHHHHHHHHHhcCCccEEEEeccccccCCCCCCCeEEEecCCCCccccccccccCCCCCCCCCCeEEEEe
Q 024287          161 VLLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSI  240 (269)
Q Consensus       161 v~~~h~~~~~~~r~~~~~~f~~~~~~iLv~T~~~~~Gidi~~~~~Vi~~~~p~~~~~~~qr~GR~gR~~~~~~~g~~~~~  240 (269)
                      +..+||++++.+|.++++.|++|+.+|||||+++++|+|+|++++||+||+|.+.++|+||+||+||.|   ..|.+++|
T Consensus       327 ~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g---~~G~a~~~  403 (434)
T 2db3_A          327 TTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVG---NNGRATSF  403 (434)
T ss_dssp             EEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTT---CCEEEEEE
T ss_pred             EEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCC---CCCEEEEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999998   88999999


Q ss_pred             cCc-hhHHHHHHHHHHhcCccccccc
Q 024287          241 ITS-EELFVLQRYENELKFKSEELTL  265 (269)
Q Consensus       241 ~~~-~~~~~~~~~~~~~~~~~~~~~~  265 (269)
                      +++ .+......+.+.+....+++|.
T Consensus       404 ~~~~~~~~~~~~l~~~l~~~~~~vp~  429 (434)
T 2db3_A          404 FDPEKDRAIAADLVKILEGSGQTVPD  429 (434)
T ss_dssp             ECTTTCGGGHHHHHHHHHHTTCCCCG
T ss_pred             EeccccHHHHHHHHHHHHHcCCCCCH
Confidence            995 5677788888888777777764
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-15
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 6e-15
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 8e-12
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-10
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 4e-10
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-09
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 9e-09
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 3e-08
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-07
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-07
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 1e-05
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-05
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 2e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-05
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-05
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-04
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 2e-04
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 0.004
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase PF2015
species: Pyrococcus furiosus [TaxId: 2261]

 Score = 72.2 bits (176), Expect = 2e-15
 Identities = 39/247 (15%), Positives = 77/247 (31%), Gaps = 27/247 (10%)

Query: 4   LCQLIEKHIFKLESVQVLVIDEVD---------------FLFNSSKQVSSLKKLLASYSS 48
           L +++   +  L    +L     D                +   +  +  L    A    
Sbjct: 22  LREMLRDALKPLAETGLLESSSPDIPKKEVLRAGQIINEEMAKGNHDLRGLLLYHAMALK 81

Query: 49  CNNRQTVFASASIPQHRRFLHNCIQQKW---TKSDVVHVHVNAIKPLPSCLHHRFVICGK 105
            ++   +  +  +   R ++    ++     TK+         +K   S L     I   
Sbjct: 82  LHHAIELLETQGLSALRAYIKKLYEEAKAGSTKASKEIFSDKRMKKAISLLVQAKEIGLD 141

Query: 106 KMKYQTLLSLIQ----SDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDV 161
             K   L  +I+           I+F   +    K         +            +D 
Sbjct: 142 HPKMDKLKEIIREQLQRKQNSKIIVFTNYRETAKKIVNELVKDGIKAKRFVGQASKEND- 200

Query: 162 LLLEEEMNFNSRAASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHR 221
                 ++   +   L E  +G   +LV+T +   G+D+PE   +  ++   SAI  + R
Sbjct: 201 ----RGLSQREQKLILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQR 256

Query: 222 AGRTGRK 228
            GRTGR 
Sbjct: 257 RGRTGRH 263
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 100.0
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.97
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.94
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.94
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.91
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.9
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.89
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.87
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.87
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.85
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.84
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.84
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 99.8
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.56
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.55
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.48
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.42
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.41
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.36
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.36
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.35
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.34
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.33
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.26
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.2
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.16
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.52
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.39
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.32
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.26
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.25
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.87
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 97.8
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.25
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 96.89
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.63
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 96.4
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.9
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 92.25
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 90.5
d2gc6a1129 Folylpolyglutamate synthetase, C-terminal domain { 89.35
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 82.9
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 82.46
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 81.55
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Initiation factor 4a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=4.2e-36  Score=226.14  Aligned_cols=156  Identities=28%  Similarity=0.436  Sum_probs=140.2

Q ss_pred             ceeEEEEecC-cchHHHHHHHHhhcCCCceEEEeeccchhhhhcCCCCchHHHHHHHhhhcCCCCceEEecccCChhHHH
Q 024287           96 LHHRFVICGK-KMKYQTLLSLIQSDAPESGIIFVGEQSEKSKKAGNAPSTTLLVDFLSNSYKGSSDVLLLEEEMNFNSRA  174 (269)
Q Consensus        96 i~~~~~~~~~-~~k~~~l~~ll~~~~~~~~lIF~~s~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~h~~~~~~~r~  174 (269)
                      |+|+|+.+.. +.|++.|.++++.....++||||+|+..++.          +++.|+..   +..+..+||+|++.+|.
T Consensus         1 I~q~~~~v~~~e~K~~~L~~ll~~~~~~k~iIF~~s~~~~~~----------l~~~L~~~---~~~~~~~~~~~~~~~r~   67 (162)
T d1fuka_           1 IKQFYVNVEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEE----------LTTKLRND---KFTVSAIYSDLPQQERD   67 (162)
T ss_dssp             CEEEEEEEESGGGHHHHHHHHHHHTTCSCEEEEESSHHHHHH----------HHHHHHHT---TCCEEEECTTSCHHHHH
T ss_pred             CEEEEEEeCCcHHHHHHHHHHHHhCCCCcEEEEEEEEchHHH----------HHHHHhhc---CceEEEeccCCchhhHH
Confidence            5788888865 5699999999999888999999999997544          77888776   78899999999999999


Q ss_pred             HHHHHHhcCCccEEEEeccccccCCCCCCCeEEEecCCCCccccccccccCCCCCCCCCCeEEEEecCchhHHHHHHHHH
Q 024287          175 ASLLEVRQGGGYLLVSTDIAARGIDLPETTHIYNFDLPRSAIDYLHRAGRTGRKPFSDEKWTVTSIITSEELFVLQRYEN  254 (269)
Q Consensus       175 ~~~~~f~~~~~~iLv~T~~~~~Gidi~~~~~Vi~~~~p~~~~~~~qr~GR~gR~~~~~~~g~~~~~~~~~~~~~~~~~~~  254 (269)
                      .+++.|+.|+.++||||+++++|+|+|++++||+||+|.+++.|+||+||+||.|   ..|.++.++++.|...+..+++
T Consensus        68 ~~l~~f~~~~~~iLv~Tdv~~rGiDi~~v~~VI~~d~P~~~~~yihR~GR~gR~g---~~g~~i~~~~~~d~~~~~~i~~  144 (162)
T d1fuka_          68 TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFG---RKGVAINFVTNEDVGAMRELEK  144 (162)
T ss_dssp             HHHHHHHTTSCSEEEEEGGGTTTCCCCSCSEEEESSCCSSGGGGGGSSCSCC--------CEEEEEEETTTHHHHHHHHH
T ss_pred             HHHHHHhhcccceeeccccccccccCCCceEEEEeccchhHHHHHhhccccccCC---CccEEEEEcCHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999998   7899999999999999999999


Q ss_pred             HhcCccccccccc
Q 024287          255 ELKFKSEELTLQT  267 (269)
Q Consensus       255 ~~~~~~~~~~~~~  267 (269)
                      .++.+++++|.+-
T Consensus       145 ~~~~~~~~ip~~~  157 (162)
T d1fuka_         145 FYSTQIEELPSDI  157 (162)
T ss_dssp             HSSCCCEECCSCC
T ss_pred             HHcCcCCCCChHH
Confidence            9999999999763
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gc6a1 c.59.1.2 (A:297-425) Folylpolyglutamate synthetase, C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure