Citrus Sinensis ID: 024871


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
cEEEEEccccccHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHEEEcccccHHHHHHccccccEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHcccEEEEEccHHHHHccccEEEEcccccccccHHHHHHHcccccccccHHHHHHcccccEEEEcccccccccccHHHHccccccccccccccHHHHHHHHHHHccc
EEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHHccEEEEEcccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHccHHHHccEEEEEccccccccHHHHHHHHHHHcccEEEEccHHHHHccccEEEEcccccccccccccHHHHccccccEcHHHHHHcccccEEEEcccccEEccEEHHHHccccEcHHHHHHHHHHHHHHHHHHHHcc
msmifakpsmrtrvsFETGFSLLgghaiylgpddiqmgkreeTRDAARVLCRYNDIIMARVFGHQDIldlakfatvpvingltdynhpcqIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIpfhfvcacpkgfepdkETVEKARKAGISkieitndpkevvqgADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMklagpkayfmhclpaergvevtegvieapysivfpqaeNRMHAQNAIMLHALGL
msmifakpsmrtrVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGiskieitndpkevvqGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
************RVSFETGFSLLGGHAIYLGPDDIQMGKR*ETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFE*************ISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHA*NAIM******
MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
********SMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDVWASMG***EAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIVFPQAENRMHAQNAIMLHALGL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q43814375 Ornithine carbamoyltransf N/A no 0.996 0.693 0.876 1e-138
O50039375 Ornithine carbamoyltransf yes no 1.0 0.696 0.854 1e-136
Q5JI16315 Ornithine carbamoyltransf yes no 0.996 0.825 0.520 3e-78
Q51742315 Ornithine carbamoyltransf yes no 0.996 0.825 0.520 3e-78
O93656317 Ornithine carbamoyltransf yes no 0.996 0.820 0.517 2e-77
O58457317 Ornithine carbamoyltransf yes no 0.996 0.820 0.517 6e-77
A3CU82309 Ornithine carbamoyltransf yes no 0.980 0.828 0.501 3e-76
Q39Z73303 Ornithine carbamoyltransf yes no 0.992 0.854 0.494 4e-75
Q8KDE2338 Ornithine carbamoyltransf yes no 0.980 0.757 0.511 1e-74
Q7M8B5307 Ornithine carbamoyltransf yes no 0.977 0.830 0.521 8e-74
>sp|Q43814|OTC_PEA Ornithine carbamoyltransferase, chloroplastic OS=Pisum sativum GN=ARGF PE=2 SV=1 Back     alignment and function desciption
 Score =  490 bits (1262), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/260 (87%), Positives = 247/260 (95%)

Query: 1   MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMAR 60
           MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGP+DIQMGKREETRD ARVL RYNDIIMAR
Sbjct: 115 MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPNDIQMGKREETRDVARVLSRYNDIIMAR 174

Query: 61  VFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 120
           VF HQDILDLAK+A+VPVINGLTDYNHP QIMADALT+IEH+GR EGTKVVYVGDGNNIV
Sbjct: 175 VFSHQDILDLAKYASVPVINGLTDYNHPVQIMADALTMIEHIGRFEGTKVVYVGDGNNIV 234

Query: 121 HSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDV 180
           HSWLL+A+V+PFHFVCACPKGFEPD +TVEKARKAGISKIEI++DPKE V+GADVVYSDV
Sbjct: 235 HSWLLLAAVVPFHFVCACPKGFEPDAKTVEKARKAGISKIEISHDPKEAVRGADVVYSDV 294

Query: 181 WASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIV 240
           WASMGQKEEAAYR++AF+GFQVD+ LM  AG KA+FMHCLPAERGVEVT+ V+EAPYSIV
Sbjct: 295 WASMGQKEEAAYRREAFKGFQVDQNLMDAAGSKAFFMHCLPAERGVEVTDEVVEAPYSIV 354

Query: 241 FPQAENRMHAQNAIMLHALG 260
           FPQAENRMHAQNAIMLH LG
Sbjct: 355 FPQAENRMHAQNAIMLHVLG 374





Pisum sativum (taxid: 3888)
EC: 2EC: .EC: 1EC: .EC: 3EC: .EC: 3
>sp|O50039|OTC_ARATH Ornithine carbamoyltransferase, chloroplastic OS=Arabidopsis thaliana GN=OTC PE=1 SV=2 Back     alignment and function description
>sp|Q5JI16|OTC_PYRKO Ornithine carbamoyltransferase OS=Pyrococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argF PE=3 SV=1 Back     alignment and function description
>sp|Q51742|OTC_PYRFU Ornithine carbamoyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argF PE=1 SV=6 Back     alignment and function description
>sp|O93656|OTC_PYRAB Ornithine carbamoyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argF PE=3 SV=4 Back     alignment and function description
>sp|O58457|OTC_PYRHO Ornithine carbamoyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argF PE=3 SV=3 Back     alignment and function description
>sp|A3CU82|OTC_METMJ Ornithine carbamoyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=argF PE=3 SV=1 Back     alignment and function description
>sp|Q39Z73|OTC_GEOMG Ornithine carbamoyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argF PE=3 SV=1 Back     alignment and function description
>sp|Q8KDE2|OTC_CHLTE Ornithine carbamoyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=argF PE=3 SV=1 Back     alignment and function description
>sp|Q7M8B5|OTC_WOLSU Ornithine carbamoyltransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argF PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
224085690 374 predicted protein [Populus trichocarpa] 1.0 0.697 0.915 1e-141
118482555 378 unknown [Populus trichocarpa] 1.0 0.690 0.915 1e-141
225458227 378 PREDICTED: ornithine carbamoyltransferas 1.0 0.690 0.892 1e-139
255538702 378 ornithine carbamoyltransferase, putative 1.0 0.690 0.896 1e-139
388505998 369 unknown [Medicago truncatula] 0.996 0.704 0.903 1e-139
222154048 369 plastid ornithine carbamoyltransferase [ 0.996 0.704 0.9 1e-138
449460249 378 PREDICTED: ornithine carbamoyltransferas 1.0 0.690 0.881 1e-138
307136374 378 ornithine carbamoyltransferase [Cucumis 1.0 0.690 0.877 1e-138
449476834 378 PREDICTED: ornithine carbamoyltransferas 1.0 0.690 0.877 1e-137
356510161358 PREDICTED: ornithine carbamoyltransferas 0.996 0.726 0.880 1e-137
>gi|224085690|ref|XP_002307666.1| predicted protein [Populus trichocarpa] gi|222857115|gb|EEE94662.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  506 bits (1303), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 239/261 (91%), Positives = 251/261 (96%)

Query: 1   MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMAR 60
           M+MIFAKPSMRTRVSFETGF LLGGHAIYLGPDDIQMGKREETRD ARVL RYNDIIMAR
Sbjct: 114 MAMIFAKPSMRTRVSFETGFFLLGGHAIYLGPDDIQMGKREETRDVARVLSRYNDIIMAR 173

Query: 61  VFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 120
           VF HQDILDLAK ATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV
Sbjct: 174 VFAHQDILDLAKHATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 233

Query: 121 HSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDV 180
           HSWLL+A+VIPFHFVCACPKGFEPD +TV+KA++AGISKIEITNDP+E V+GADVVYSDV
Sbjct: 234 HSWLLLAAVIPFHFVCACPKGFEPDAKTVQKAQQAGISKIEITNDPQEAVRGADVVYSDV 293

Query: 181 WASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIV 240
           WASMGQKEEAA+R+Q FQGFQVDE LMKLAGPKAYFMHCLPAERGVEVT+GVIEAP SIV
Sbjct: 294 WASMGQKEEAAHRRQVFQGFQVDENLMKLAGPKAYFMHCLPAERGVEVTDGVIEAPNSIV 353

Query: 241 FPQAENRMHAQNAIMLHALGL 261
           FPQAENRMHAQNAIMLHALGL
Sbjct: 354 FPQAENRMHAQNAIMLHALGL 374




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118482555|gb|ABK93198.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225458227|ref|XP_002281919.1| PREDICTED: ornithine carbamoyltransferase, chloroplastic [Vitis vinifera] gi|302142520|emb|CBI19723.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255538702|ref|XP_002510416.1| ornithine carbamoyltransferase, putative [Ricinus communis] gi|223551117|gb|EEF52603.1| ornithine carbamoyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388505998|gb|AFK41065.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|222154048|gb|ACM47214.1| plastid ornithine carbamoyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449460249|ref|XP_004147858.1| PREDICTED: ornithine carbamoyltransferase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307136374|gb|ADN34186.1| ornithine carbamoyltransferase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449476834|ref|XP_004154848.1| PREDICTED: ornithine carbamoyltransferase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356510161|ref|XP_003523808.1| PREDICTED: ornithine carbamoyltransferase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
TAIR|locus:2018467375 OTC "ornithine carbamoyltransf 0.996 0.693 0.857 1.1e-121
TIGR_CMR|GSU_0152303 GSU_0152 "ornithine carbamoylt 0.977 0.841 0.490 1.7e-66
TIGR_CMR|CHY_2261311 CHY_2261 "ornithine carbamoylt 0.996 0.836 0.498 1.6e-63
TIGR_CMR|DET_1394311 DET_1394 "ornithine carbamoylt 0.996 0.836 0.467 3.1e-60
TIGR_CMR|BA_4351316 BA_4351 "ornithine carbamoyltr 0.969 0.800 0.475 6.4e-60
TIGR_CMR|SPO_0963308 SPO_0963 "ornithine carbamoylt 0.992 0.840 0.475 1.5e-58
UNIPROTKB|F1MNG5354 OTC "Ornithine carbamoyltransf 0.988 0.728 0.465 8.4e-58
UNIPROTKB|Q9N1U7354 OTC "Ornithine carbamoyltransf 0.988 0.728 0.461 5.9e-57
UNIPROTKB|E2RD27354 OTC "Uncharacterized protein" 0.988 0.728 0.461 5.9e-57
MGI|MGI:97448354 Otc "ornithine transcarbamylas 0.988 0.728 0.458 5.9e-57
TAIR|locus:2018467 OTC "ornithine carbamoyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1197 (426.4 bits), Expect = 1.1e-121, P = 1.1e-121
 Identities = 223/260 (85%), Positives = 244/260 (93%)

Query:     1 MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMAR 60
             MSMIFAKPSMRTRVSFETGF LLGGHA+YLGP+DIQMGKREETRD ARVL RYNDIIMAR
Sbjct:   115 MSMIFAKPSMRTRVSFETGFFLLGGHALYLGPNDIQMGKREETRDVARVLSRYNDIIMAR 174

Query:    61 VFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 120
             VF HQDILDLA +++VPV+NGLTD+NHPCQIMADALT+IEH+G++EGTKVVYVGDGNN+V
Sbjct:   175 VFAHQDILDLANYSSVPVVNGLTDHNHPCQIMADALTMIEHIGQVEGTKVVYVGDGNNMV 234

Query:   121 HSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDV 180
             HSWL +ASVIPFHFVCACPKG+EPDKE V KA++AG+SKIEITNDPKE V GADVVYSDV
Sbjct:   235 HSWLELASVIPFHFVCACPKGYEPDKERVSKAKQAGLSKIEITNDPKEAVIGADVVYSDV 294

Query:   181 WASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIV 240
             WASMGQK+EA  R++AFQGFQVDE LMKLAG KAYFMHCLPAERGVEVT GV+EAPYSIV
Sbjct:   295 WASMGQKDEAEARRKAFQGFQVDEALMKLAGQKAYFMHCLPAERGVEVTNGVVEAPYSIV 354

Query:   241 FPQAENRMHAQNAIMLHALG 260
             FPQAENRMHAQNAIMLH LG
Sbjct:   355 FPQAENRMHAQNAIMLHLLG 374




GO:0006520 "cellular amino acid metabolic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016597 "amino acid binding" evidence=IEA;ISS
GO:0016743 "carboxyl- or carbamoyltransferase activity" evidence=IEA;ISS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006164 "purine nucleotide biosynthetic process" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
TIGR_CMR|GSU_0152 GSU_0152 "ornithine carbamoyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2261 CHY_2261 "ornithine carbamoyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1394 DET_1394 "ornithine carbamoyltransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4351 BA_4351 "ornithine carbamoyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0963 SPO_0963 "ornithine carbamoyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|F1MNG5 OTC "Ornithine carbamoyltransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9N1U7 OTC "Ornithine carbamoyltransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD27 OTC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:97448 Otc "ornithine transcarbamylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4XLM2OTC_CALS82, ., 1, ., 3, ., 30.49230.97700.8279yesno
A5VNP2OTC_BRUO22, ., 1, ., 3, ., 30.49420.98460.8237yesno
Q67JZ8OTC_SYMTH2, ., 1, ., 3, ., 30.51150.96930.8161yesno
Q8TKT5OTC_METAC2, ., 1, ., 3, ., 30.47490.98850.8543yesno
Q606D8OTC_METCA2, ., 1, ., 3, ., 30.47840.96160.8422yesno
Q8G2L7OTC_BRUSU2, ., 1, ., 3, ., 30.49800.98460.8237yesno
Q2FPP7OTC_METHJ2, ., 1, ., 3, ., 30.47300.99230.8576yesno
Q3A9W4OTC_CARHZ2, ., 1, ., 3, ., 30.50190.99610.8360yesno
Q39Z73OTC_GEOMG2, ., 1, ., 3, ., 30.49420.99230.8547yesno
O29013OTC_ARCFU2, ., 1, ., 3, ., 30.49230.99230.8436yesno
A6QC22OTC_SULNB2, ., 1, ., 3, ., 30.48460.97310.8300yesno
O93656OTC_PYRAB2, ., 1, ., 3, ., 30.51710.99610.8201yesno
A1VEP9OTC_DESVV2, ., 1, ., 3, ., 30.49210.96930.8433yesno
Q5JI16OTC_PYRKO2, ., 1, ., 3, ., 30.52090.99610.8253yesno
A2BM26OTC_HYPBU2, ., 1, ., 3, ., 30.50570.97700.8121yesno
A5UMK3OTC_METS32, ., 1, ., 3, ., 30.49610.99230.8604yesno
Q1QVM7OTC_CHRSD2, ., 1, ., 3, ., 30.46660.96160.8229yesno
O87319OTC_NOSP72, ., 1, ., 3, ., 30.47320.99610.8496yesno
Q30TL4OTC_SULDN2, ., 1, ., 3, ., 30.48260.97700.8173yesno
Q8KDE2OTC_CHLTE2, ., 1, ., 3, ., 30.51170.98080.7573yesno
Q7U5V5OTC_SYNPX2, ., 1, ., 3, ., 30.48090.99610.8176yesno
A1WUZ6OTC_HALHL2, ., 1, ., 3, ., 30.46660.96160.8366yesno
O58457OTC_PYRHO2, ., 1, ., 3, ., 30.51710.99610.8201yesno
Q74GU2OTC_GEOSL2, ., 1, ., 3, ., 30.49010.97700.8415yesno
A3CU82OTC_METMJ2, ., 1, ., 3, ., 30.50190.98080.8284yesno
A1ATU5OTC_PELPD2, ., 1, ., 3, ., 30.49610.99610.8524yesno
A7ZCL8OTC_CAMC12, ., 1, ., 3, ., 30.51150.96550.8262yesno
O27495OTC_METTH2, ., 1, ., 3, ., 30.50570.99230.8604yesno
Q2LT98OTC_SYNAS2, ., 1, ., 3, ., 30.48620.97700.8443yesno
Q8Q0J1OTC_METMA2, ., 1, ., 3, ., 30.48640.98850.8543yesno
A6Q1W6OTC_NITSB2, ., 1, ., 3, ., 30.50960.97700.8252yesno
O50039OTC_ARATH2, ., 1, ., 3, ., 30.85441.00.696yesno
Q7V8G9OTC_PROMM2, ., 1, ., 3, ., 30.46180.99610.8176yesno
A5V656OTC_SPHWW2, ., 1, ., 3, ., 30.50.98850.8349yesno
Q18E28OTC_HALWD2, ., 1, ., 3, ., 30.47490.98080.8533yesno
Q9YAE7OTC_AERPE2, ., 1, ., 3, ., 30.47870.97700.8121yesno
B7GM02OTC_ANOFW2, ., 1, ., 3, ., 30.51520.99230.8248yesno
A0RR73OTC_CAMFF2, ., 1, ., 3, ., 30.49030.98080.8284yesno
Q6L135OTC_PICTO2, ., 1, ., 3, ., 30.47900.99610.8637yesno
Q465R0OTC_METBF2, ., 1, ., 3, ., 30.47490.98850.8543yesno
Q6AR58OTC_DESPS2, ., 1, ., 3, ., 30.45760.99610.8580yesno
Q7M8B5OTC_WOLSU2, ., 1, ., 3, ., 30.52120.97700.8306yesno
Q72D35OTC_DESVH2, ., 1, ., 3, ., 30.49210.96930.8433yesno
Q3A1V3OTC_PELCD2, ., 1, ., 3, ., 30.47450.97310.8410yesno
A7GZL8OTC_CAMC52, ., 1, ., 3, ., 30.50570.96930.8322yesno
Q30YB7OTC_DESDG2, ., 1, ., 3, ., 30.52170.96550.84yesno
Q8ET05OTC_OCEIH2, ., 1, ., 3, ., 30.52320.97700.7919yesno
Q51742OTC_PYRFU2, ., 1, ., 3, ., 30.52090.99610.8253yesno
Q43814OTC_PEA2, ., 1, ., 3, ., 30.87690.99610.6933N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.30.976
3rd Layer2.1.3.30.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.V.1402.1
SubName- Full=Putative uncharacterized protein; (326 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_2320006
hypothetical protein (482 aa)
   0.998
gw1.X.3427.1
hypothetical protein (424 aa)
    0.997
grail3.0090013702
argininosuccinate synthase family protein (EC-6.3.4.5) (470 aa)
    0.997
fgenesh4_pg.C_scaffold_29000089
carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC-6.3.5.5) (390 aa)
    0.990
eugene3.00030549
carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC-6.3.5.5) (429 aa)
    0.986
estExt_fgenesh4_pm.C_LG_II0485
argininosuccinate lyase (EC-4.3.2.1) (461 aa)
    0.984
gw1.130.69.1
N-acetyl-gamma-glutamyl-phosphate reductase (EC-1.2.1.38) (352 aa)
     0.981
gw1.X.4384.1
carbamoyl-phosphate synthase (EC-6.3.4.16) (1081 aa)
    0.979
gw1.XI.2500.1
ornithine-delta-aminotransferase (EC-2.6.1.13) (379 aa)
    0.976
eugene3.00021348
arginase (EC-3.5.3.1) (338 aa)
     0.965

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
PLN02342348 PLN02342, PLN02342, ornithine carbamoyltransferase 0.0
PRK00779304 PRK00779, PRK00779, ornithine carbamoyltransferase 1e-154
COG0078310 COG0078, ArgF, Ornithine carbamoyltransferase [Ami 1e-138
TIGR00658304 TIGR00658, orni_carb_tr, ornithine carbamoyltransf 1e-125
PRK02102331 PRK02102, PRK02102, ornithine carbamoyltransferase 1e-113
PRK02255338 PRK02255, PRK02255, putrescine carbamoyltransferas 1e-101
PRK14805302 PRK14805, PRK14805, ornithine carbamoyltransferase 4e-99
PRK04284332 PRK04284, PRK04284, ornithine carbamoyltransferase 6e-82
PRK03515336 PRK03515, PRK03515, ornithine carbamoyltransferase 9e-67
PRK01713334 PRK01713, PRK01713, ornithine carbamoyltransferase 6e-62
PRK12562334 PRK12562, PRK12562, ornithine carbamoyltransferase 1e-57
pfam00185156 pfam00185, OTCace, Aspartate/ornithine carbamoyltr 1e-55
PRK04523335 PRK04523, PRK04523, N-acetylornithine carbamoyltra 5e-54
pfam02729140 pfam02729, OTCace_N, Aspartate/ornithine carbamoyl 2e-51
PRK14804311 PRK14804, PRK14804, ornithine carbamoyltransferase 5e-50
TIGR03316357 TIGR03316, ygeW, probable carbamoyltransferase Yge 4e-37
COG0540316 COG0540, PyrB, Aspartate carbamoyltransferase, cat 3e-32
PRK00856305 PRK00856, pyrB, aspartate carbamoyltransferase cat 4e-31
TIGR00670301 TIGR00670, asp_carb_tr, aspartate carbamoyltransfe 2e-27
PLN02527306 PLN02527, PLN02527, aspartate carbamoyltransferase 7e-24
PRK08192338 PRK08192, PRK08192, aspartate carbamoyltransferase 2e-22
PRK11891429 PRK11891, PRK11891, aspartate carbamoyltransferase 3e-19
PRK07200395 PRK07200, PRK07200, aspartate/ornithine carbamoylt 6e-17
PRK13814310 PRK13814, pyrB, aspartate carbamoyltransferase cat 3e-06
>gnl|CDD|177976 PLN02342, PLN02342, ornithine carbamoyltransferase Back     alignment and domain information
 Score =  564 bits (1455), Expect = 0.0
 Identities = 225/261 (86%), Positives = 246/261 (94%)

Query: 1   MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMAR 60
           M+MIF KPSMRTRVSFETGF LLGGHA+YLGPDDIQ+GKREETRD ARVL RYNDIIMAR
Sbjct: 88  MAMIFTKPSMRTRVSFETGFFLLGGHALYLGPDDIQLGKREETRDIARVLSRYNDIIMAR 147

Query: 61  VFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 120
           VF HQD+LDLA++++VPVINGLTDYNHPCQIMADALTIIEH+GRLEGTKVVYVGDGNNIV
Sbjct: 148 VFAHQDVLDLAEYSSVPVINGLTDYNHPCQIMADALTIIEHIGRLEGTKVVYVGDGNNIV 207

Query: 121 HSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGADVVYSDV 180
           HSWLL+A+V+PFHFVCACPKG+EPD +TVEKAR AGISKIEITNDP E V+GADVVY+DV
Sbjct: 208 HSWLLLAAVLPFHFVCACPKGYEPDAKTVEKARAAGISKIEITNDPAEAVKGADVVYTDV 267

Query: 181 WASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPYSIV 240
           WASMGQKEEA  RK+AFQGFQV+E LMKLAGP+AYFMHCLPAERGVEVT+GV+EAP SIV
Sbjct: 268 WASMGQKEEAEKRKKAFQGFQVNEALMKLAGPQAYFMHCLPAERGVEVTDGVMEAPNSIV 327

Query: 241 FPQAENRMHAQNAIMLHALGL 261
           FPQAENRMHAQNAIMLH LG 
Sbjct: 328 FPQAENRMHAQNAIMLHQLGK 348


Length = 348

>gnl|CDD|234835 PRK00779, PRK00779, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223156 COG0078, ArgF, Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129743 TIGR00658, orni_carb_tr, ornithine carbamoyltransferase Back     alignment and domain information
>gnl|CDD|179366 PRK02102, PRK02102, ornithine carbamoyltransferase; Validated Back     alignment and domain information
>gnl|CDD|235017 PRK02255, PRK02255, putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237819 PRK14805, PRK14805, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235269 PRK04284, PRK04284, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179587 PRK03515, PRK03515, ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|167263 PRK01713, PRK01713, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|105755 PRK12562, PRK12562, ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|215776 pfam00185, OTCace, Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain Back     alignment and domain information
>gnl|CDD|235304 PRK04523, PRK04523, N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|217204 pfam02729, OTCace_N, Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain Back     alignment and domain information
>gnl|CDD|173265 PRK14804, PRK14804, ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|213796 TIGR03316, ygeW, probable carbamoyltransferase YgeW Back     alignment and domain information
>gnl|CDD|223614 COG0540, PyrB, Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|234849 PRK00856, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|233083 TIGR00670, asp_carb_tr, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|178142 PLN02527, PLN02527, aspartate carbamoyltransferase Back     alignment and domain information
>gnl|CDD|169269 PRK08192, PRK08192, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183362 PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235961 PRK07200, PRK07200, aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>gnl|CDD|139876 PRK13814, pyrB, aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
COG0078310 ArgF Ornithine carbamoyltransferase [Amino acid tr 100.0
PLN02342348 ornithine carbamoyltransferase 100.0
PRK14805302 ornithine carbamoyltransferase; Provisional 100.0
PRK04284332 ornithine carbamoyltransferase; Provisional 100.0
TIGR00658304 orni_carb_tr ornithine carbamoyltransferase. Most 100.0
PRK02255338 putrescine carbamoyltransferase; Provisional 100.0
PRK03515336 ornithine carbamoyltransferase subunit I; Provisio 100.0
PRK12562334 ornithine carbamoyltransferase subunit F; Provisio 100.0
PRK02102331 ornithine carbamoyltransferase; Validated 100.0
PRK00779304 ornithine carbamoyltransferase; Provisional 100.0
PRK01713334 ornithine carbamoyltransferase; Provisional 100.0
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 100.0
PRK00856305 pyrB aspartate carbamoyltransferase catalytic subu 100.0
KOG1504346 consensus Ornithine carbamoyltransferase OTC/ARG3 100.0
PLN02527306 aspartate carbamoyltransferase 100.0
PRK13814310 pyrB aspartate carbamoyltransferase catalytic subu 100.0
PRK04523335 N-acetylornithine carbamoyltransferase; Reviewed 100.0
PRK14804311 ornithine carbamoyltransferase; Provisional 100.0
PRK08192338 aspartate carbamoyltransferase; Provisional 100.0
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members o 100.0
PRK07200395 aspartate/ornithine carbamoyltransferase family pr 100.0
PRK11891429 aspartate carbamoyltransferase; Provisional 100.0
COG0540316 PyrB Aspartate carbamoyltransferase, catalytic cha 100.0
PRK13376 525 pyrB bifunctional aspartate carbamoyltransferase c 100.0
PF00185158 OTCace: Aspartate/ornithine carbamoyltransferase, 100.0
PF02729142 OTCace_N: Aspartate/ornithine carbamoyltransferase 100.0
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 97.45
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 97.32
PLN03139386 formate dehydrogenase; Provisional 97.21
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 97.18
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 97.08
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 97.05
PRK07574385 formate dehydrogenase; Provisional 96.98
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 96.92
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.87
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.86
PLN02928347 oxidoreductase family protein 96.85
PRK06487317 glycerate dehydrogenase; Provisional 96.76
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.72
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.67
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.57
PTZ00075476 Adenosylhomocysteinase; Provisional 96.57
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 96.56
PLN02494477 adenosylhomocysteinase 96.56
PLN02306386 hydroxypyruvate reductase 96.49
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.46
PRK13243333 glyoxylate reductase; Reviewed 96.44
PRK06932314 glycerate dehydrogenase; Provisional 96.41
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.41
PRK12480330 D-lactate dehydrogenase; Provisional 96.36
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.33
PRK08605332 D-lactate dehydrogenase; Validated 96.2
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.18
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.16
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.16
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.12
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.1
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.09
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 96.05
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.03
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.98
PRK06436303 glycerate dehydrogenase; Provisional 95.98
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.95
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.95
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.89
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.87
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.77
TIGR01278511 DPOR_BchB light-independent protochlorophyllide re 95.75
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.71
cd01981430 Pchlide_reductase_B Pchlide_reductase_B: B protein 95.68
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.64
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.63
PRK05479 330 ketol-acid reductoisomerase; Provisional 95.53
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 95.36
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.22
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.2
PRK02910519 light-independent protochlorophyllide reductase su 95.16
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.13
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.12
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.08
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.91
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.82
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.74
PRK07579 245 hypothetical protein; Provisional 94.7
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.69
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.67
PRK00005 309 fmt methionyl-tRNA formyltransferase; Reviewed 94.66
CHL00076513 chlB photochlorophyllide reductase subunit B 94.65
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.56
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 94.54
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.53
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.51
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 94.5
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.46
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.45
TIGR00460 313 fmt methionyl-tRNA formyltransferase. The top-scor 94.44
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.42
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 94.38
COG0565242 LasT rRNA methylase [Translation, ribosomal struct 94.26
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.24
PRK13403 335 ketol-acid reductoisomerase; Provisional 94.18
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.09
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 94.04
cd01974435 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitro 93.89
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.76
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 93.61
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.52
PLN00106 323 malate dehydrogenase 93.34
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.11
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.1
PRK14476455 nitrogenase molybdenum-cofactor biosynthesis prote 92.96
PRK06988 312 putative formyltransferase; Provisional 92.96
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 92.84
cd01968410 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup 92.81
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 92.66
PLN00112 444 malate dehydrogenase (NADP); Provisional 92.59
cd01977415 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: 92.48
TIGR01283456 nifE nitrogenase molybdenum-iron cofactor biosynth 92.44
TIGR01284457 alt_nitrog_alph nitrogenase alpha chain. This mode 92.35
PRK05225 487 ketol-acid reductoisomerase; Validated 92.25
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 92.13
PRK05562223 precorrin-2 dehydrogenase; Provisional 92.02
cd03466429 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup 91.84
COG4087152 Soluble P-type ATPase [General function prediction 91.83
PLN02285 334 methionyl-tRNA formyltransferase 91.79
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 91.79
PRK06719157 precorrin-2 dehydrogenase; Validated 91.75
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 91.66
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 91.56
PLN02256 304 arogenate dehydrogenase 91.42
cd00316399 Oxidoreductase_nitrogenase The nitrogenase enzyme 91.39
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 91.35
PRK10637 457 cysG siroheme synthase; Provisional 91.16
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 91.16
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.13
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 91.07
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 90.96
PRK12862 763 malic enzyme; Reviewed 90.64
TIGR00050233 rRNA_methyl_1 RNA methyltransferase, TrmH family, 90.57
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 90.55
TIGR00639190 PurN phosphoribosylglycinamide formyltransferase, 90.34
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.24
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 90.16
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 90.14
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 89.87
PRK12549284 shikimate 5-dehydrogenase; Reviewed 89.81
KOG0068 406 consensus D-3-phosphoglycerate dehydrogenase, D-is 89.69
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 89.57
PTZ00082 321 L-lactate dehydrogenase; Provisional 89.52
TIGR02931461 anfK_nitrog Fe-only nitrogenase, beta subunit. Nit 89.49
cd01965428 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_l 89.38
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 89.3
PRK13940414 glutamyl-tRNA reductase; Provisional 89.26
PRK04148134 hypothetical protein; Provisional 89.24
PRK06141314 ornithine cyclodeaminase; Validated 89.23
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 89.18
TIGR01862443 N2-ase-Ialpha nitrogenase component I, alpha chain 89.18
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 89.06
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 88.97
PRK08291330 ectoine utilization protein EutC; Validated 88.62
TIGR01757 387 Malate-DH_plant malate dehydrogenase, NADP-depende 88.58
PRK14478475 nitrogenase molybdenum-cofactor biosynthesis prote 88.4
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 88.27
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 88.16
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 88.16
cd05197 425 GH4_glycoside_hydrolases Glycoside Hydrases Family 88.12
PRK12861 764 malic enzyme; Reviewed 88.12
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 88.05
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 87.95
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 87.95
TIGR01759 323 MalateDH-SF1 malate dehydrogenase. This model repr 87.88
TIGR01860461 VNFD nitrogenase vanadium-iron protein, alpha chai 87.81
cd01971427 Nitrogenase_VnfN_like Nitrogenase_vnfN_like: VnfN 87.73
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 87.68
PRK08618325 ornithine cyclodeaminase; Validated 87.53
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 87.3
TIGR01772 312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 87.05
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 86.78
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 86.78
cd00704 323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 86.67
PLN00203 519 glutamyl-tRNA reductase 86.63
cd01338 322 MDH_choloroplast_like Chloroplast-like malate dehy 86.41
PLN02688 266 pyrroline-5-carboxylate reductase 86.38
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.36
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 86.26
cd05298 437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 86.22
PRK08655 437 prephenate dehydrogenase; Provisional 86.17
PLN02712 667 arogenate dehydrogenase 85.97
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 85.95
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.74
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 85.73
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 85.65
TIGR01861513 ANFD nitrogenase iron-iron protein, alpha chain. T 85.58
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 85.5
PLN02477410 glutamate dehydrogenase 85.38
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 85.23
cd02812219 PcrB_like PcrB_like proteins. One member of this f 85.17
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.15
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 85.14
PRK10433228 putative RNA methyltransferase; Provisional 85.09
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 85.06
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 85.03
PRK05647200 purN phosphoribosylglycinamide formyltransferase; 84.95
PTZ00117 319 malate dehydrogenase; Provisional 84.91
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 84.91
PRK07340304 ornithine cyclodeaminase; Validated 84.83
PRK07417 279 arogenate dehydrogenase; Reviewed 84.78
PRK06823315 ornithine cyclodeaminase; Validated 84.44
PRK06407301 ornithine cyclodeaminase; Provisional 84.04
PRK06545 359 prephenate dehydrogenase; Validated 84.01
PRK07589346 ornithine cyclodeaminase; Validated 83.99
COG0223 307 Fmt Methionyl-tRNA formyltransferase [Translation, 83.71
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 83.71
KOG0409 327 consensus Predicted dehydrogenase [General functio 83.71
PRK05442 326 malate dehydrogenase; Provisional 83.43
PLN02602 350 lactate dehydrogenase 83.3
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 83.22
cd01966417 Nitrogenase_NifN_1 Nitrogenase_nifN1: A subgroup o 83.21
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 83.18
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 83.16
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 83.11
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 83.08
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 82.96
COG1486 442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 82.76
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 82.23
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 82.05
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 81.96
PRK15114245 tRNA (cytidine/uridine-2'-O-)-methyltransferase Tr 81.91
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 81.8
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 81.56
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 81.06
TIGR02329 526 propionate_PrpR propionate catabolism operon regul 80.96
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 80.95
cd01972426 Nitrogenase_VnfE_like Nitrogenase_VnfE_like: VnfE 80.94
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 80.77
TIGR01282466 nifD nitrogenase molybdenum-iron protein alpha cha 80.72
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 80.54
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 80.13
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 80.09
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=3e-97  Score=664.22  Aligned_cols=259  Identities=57%  Similarity=0.932  Sum_probs=248.5

Q ss_pred             CEeeccCCChhhHHHHHHHHHhcCCeEEEeCCCCcCCCCCCCHHHHHHHHhhhccEEEEeeCCcchHHHHhhhCCCcEEe
Q 024871            1 MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVIN   80 (261)
Q Consensus         1 l~~lF~~~StRTR~SFe~A~~~LGg~~~~l~~~~s~~~kgEs~~Dt~~~ls~~~D~iv~R~~~~~~~~~~a~~~~vPVIN   80 (261)
                      +||+|++||||||+|||.||.+|||++++++++++|+++|||++||+||||+|+|+|++|++.|..++++|++++|||||
T Consensus        47 laliFeK~STRTR~SFeva~~qlGg~~~~l~~~~~Qlgr~Esi~DTArVLsr~~D~I~~R~~~~~~ve~lA~~s~VPViN  126 (310)
T COG0078          47 LALIFEKTSTRTRVSFEVAATQLGGHAIYLGPGDSQLGRGESIKDTARVLSRMVDAIMIRGFSHETLEELAKYSGVPVIN  126 (310)
T ss_pred             EEEEecCCCchhhhhHHHHHHHcCCCeEEeCCCccccCCCCcHHHHHHHHHhhhheEEEecccHHHHHHHHHhCCCceEc
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhHHHHHHHHHHHHhCCCCCcEEEEEcCCCchHHHHHHHHhcCCcEEEEeCCCCCCCCHHHHHHHHH----hC
Q 024871           81 GLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKARK----AG  156 (261)
Q Consensus        81 a~~~~~HPtQ~L~Dl~Ti~e~~g~l~~~~i~~vGd~~~v~~S~~~~~~~~g~~~~~~~P~~~~~~~~~~~~~~~----~g  156 (261)
                      |++|.+||||+|+|++||+|++|.++|+|++||||+|||+|||+.+++++|+++.+++|++|+|+++++++|++    +|
T Consensus       127 gLtD~~HP~Q~LADl~Ti~E~~g~l~g~k~a~vGDgNNv~nSl~~~~a~~G~dv~ia~Pk~~~p~~~~~~~a~~~a~~~g  206 (310)
T COG0078         127 GLTDEFHPCQALADLMTIKEHFGSLKGLKLAYVGDGNNVANSLLLAAAKLGMDVRIATPKGYEPDPEVVEKAKENAKESG  206 (310)
T ss_pred             ccccccCcHHHHHHHHHHHHhcCcccCcEEEEEcCcchHHHHHHHHHHHhCCeEEEECCCcCCcCHHHHHHHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998875    34


Q ss_pred             CCeEEEEcCHHHHhCCCCEEEEecccCcchhHHHHHHHhhh-cCCcccHHHHHhcCCCcEEeeCCCCCCCcccccccccC
Q 024871          157 ISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAF-QGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEA  235 (261)
Q Consensus       157 ~~~i~~~~d~~~a~~~aDviy~~~w~~~~~~~~~~~~~~~~-~~y~v~~~~~~~a~~~~~~mH~lP~~rg~Ev~~~v~~~  235 (261)
                       +++++++|+++|+++|||||||+|.||||+.+..+++..+ .+||||+++|+.++++++||||||++||+||+++|+++
T Consensus       207 -~~i~~t~d~~eAv~gADvvyTDvWvSMGee~e~~~~~~~~~~~yQVn~~lm~~a~~~~ifmHCLPA~rG~EVTdeV~dg  285 (310)
T COG0078         207 -GKITLTEDPEEAVKGADVVYTDVWVSMGEEAEAEERRIAFLPPYQVNEELMALAGPDAIFMHCLPAHRGEEVTDEVFEG  285 (310)
T ss_pred             -CeEEEecCHHHHhCCCCEEEecCcccCcchhhhHHHHHhhCCCceeCHHHHhhcCCCeEEEeCCCCCCCCccCHHHhCC
Confidence             6899999999999999999999999999988754444445 55999999999999999999999999999999999999


Q ss_pred             CCcchHhHHhccHHHHHHHHHHHhc
Q 024871          236 PYSIVFPQAENRMHAQNAIMLHALG  260 (261)
Q Consensus       236 ~~s~~~~Qa~N~l~~r~All~~~l~  260 (261)
                      |+|++|+|||||+|+|||+|+++||
T Consensus       286 ~~svvfdeAENRlH~qKAvl~~~l~  310 (310)
T COG0078         286 PASVVFDEAENRLHTQKAVLAALLG  310 (310)
T ss_pred             CceeeeehhhhhHHHHHHHHHHhhC
Confidence            9999999999999999999999986



>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>KOG1504 consensus Ornithine carbamoyltransferase OTC/ARG3 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>PF02729 OTCace_N: Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain; InterPro: IPR006132 This entry contains two related enzymes: Aspartate carbamoyltransferase (2 Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01278 DPOR_BchB light-independent protochlorophyllide reductase, B subunit Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd01981 Pchlide_reductase_B Pchlide_reductase_B: B protein of the NB protein complex of Protochlorophyllide (Pchlide)_reductase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK02910 light-independent protochlorophyllide reductase subunit B; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07579 hypothetical protein; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00005 fmt methionyl-tRNA formyltransferase; Reviewed Back     alignment and domain information
>CHL00076 chlB photochlorophyllide reductase subunit B Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00460 fmt methionyl-tRNA formyltransferase Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>COG0565 LasT rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>cd01974 Nitrogenase_MoFe_beta Nitrogenase_MoFe_beta: Nitrogenase MoFe protein, beta subunit Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14476 nitrogenase molybdenum-cofactor biosynthesis protein NifN; Provisional Back     alignment and domain information
>PRK06988 putative formyltransferase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd01968 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of the NifE subunit of the NifEN complex: NifE forms an alpha2beta2 tetramer with NifN Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>cd01977 Nitrogenase_VFe_alpha Nitrogenase_VFe_alpha -like: Nitrogenase VFe protein, alpha subunit like Back     alignment and domain information
>TIGR01283 nifE nitrogenase molybdenum-iron cofactor biosynthesis protein NifE Back     alignment and domain information
>TIGR01284 alt_nitrog_alph nitrogenase alpha chain Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>cd03466 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PLN02285 methionyl-tRNA formyltransferase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>cd00316 Oxidoreductase_nitrogenase The nitrogenase enzyme system catalyzes the ATP-dependent reduction of dinitrogen to ammonia Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>TIGR00050 rRNA_methyl_1 RNA methyltransferase, TrmH family, group 1 Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>KOG0068 consensus D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily [Amino acid transport and metabolism] Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02931 anfK_nitrog Fe-only nitrogenase, beta subunit Back     alignment and domain information
>cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>TIGR01862 N2-ase-Ialpha nitrogenase component I, alpha chain Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK14478 nitrogenase molybdenum-cofactor biosynthesis protein NifE; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK12861 malic enzyme; Reviewed Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>TIGR01860 VNFD nitrogenase vanadium-iron protein, alpha chain Back     alignment and domain information
>cd01971 Nitrogenase_VnfN_like Nitrogenase_vnfN_like: VnfN subunit of the VnfEN complex-like Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01861 ANFD nitrogenase iron-iron protein, alpha chain Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK10433 putative RNA methyltransferase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01966 Nitrogenase_NifN_1 Nitrogenase_nifN1: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK15114 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ; Provisional Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01972 Nitrogenase_VnfE_like Nitrogenase_VnfE_like: VnfE subunit of the VnfEN complex_like Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>TIGR01282 nifD nitrogenase molybdenum-iron protein alpha chain Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1a1s_A314 Ornithine Carbamoyltransferase From Pyrococcus Furi 3e-79
1pvv_A315 Refined Structure Of Pyrococcus Furiosus Ornithine 3e-79
4ep1_A340 Crystal Structure Of Anabolic Ornithine Carbamoyltr 2e-66
1fb5_A320 Low Resolution Structure Of Ovine Ornithine Transca 8e-64
1oth_A321 Crystal Structure Of Human Ornithine Transcarbamoyl 5e-63
4f2g_A309 The Crystal Structure Of Ornithine Carbamoyltransfe 1e-62
3gd5_A323 Crystal Structure Of Ornithine Carbamoyltransferase 3e-62
2ef0_A301 Crystal Structure Of Ornithine Carbamoyltransferase 7e-62
1vlv_A325 Crystal Structure Of Ornithine Carbamoyltransferase 5e-57
2i6u_A307 Crystal Structure Of Ornithine Carbamoyltransferase 1e-55
4a8h_A355 Crystal Structure Of Putrescine Transcarbamylase Fr 9e-55
4a8t_A339 Crystal Structure Of Putrescine Transcarbamylase Fr 1e-54
3txx_A359 Crystal Structure Of Putrescine Transcarbamylase Fr 1e-54
1dxh_A335 Catabolic Ornithine Carbamoyltransferase From Pseud 2e-51
1ort_A335 Ornithine Transcarbamoylase From Pseudomonas Aerugi 3e-51
3tpf_A307 Crystal Structure Of Anabolic Ornithine Carbamoyltr 3e-49
3upd_A358 2.9 Angstrom Crystal Structure Of Ornithine Carbamo 2e-47
1akm_A333 Ornithine Transcarbamylase From Escherichia Coli Le 9e-46
2w37_A359 Crystal Structure Of The Hexameric Catabolic Ornith 1e-45
3sds_A353 Crystal Structure Of A Mitochondrial Ornithine Carb 1e-45
2otc_A333 Ornithine Transcarbamoylase Complexed With N- (Phos 2e-45
3grf_A328 X-Ray Structure Of Ornithine Transcarbamoylase From 3e-43
4amu_A365 Structure Of Ornithine Carbamoyltransferase From My 1e-42
3m5c_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 5e-32
3m5d_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 2e-31
3kzc_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 3e-31
3l05_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 3e-31
3m4n_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 3e-31
3l02_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 4e-31
3l04_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 4e-31
3l06_A359 Crystal Structure Of N-Acetyl-L-Ornithine Transcarb 4e-31
2be7_A326 Crystal Structure Of The Unliganded (T-State) Aspar 7e-18
1ml4_A308 The Pala-Liganded Aspartate Transcarbamoylase Catal 6e-17
2g7m_X338 Crystal Structure Of B. Fragilis N-Succinylornithin 2e-16
1js1_X324 Crystal Structure Of A New Transcarbamylase From Th 3e-16
2fg6_X338 N-Succinyl-L-Ornithine Transcarbamylase From B. Fra 4e-16
2rgw_A306 Catalytic Subunit Of M. Jannaschii Aspartate Transc 2e-15
2yfk_A418 Crystal Structure Of A Putative Transcarbamoylase F 1e-12
3lxm_A335 2.00 Angstrom Resolution Crystal Structure Of A Cat 4e-12
2a0f_A310 Structure Of D236a Mutant E. Coli Aspartate Transca 8e-11
4e2f_I310 Crystal Structure Of E. Coli Aspartate Transcarbamo 1e-10
1sku_A310 E. Coli Aspartate Transcarbamylase 240's Loop Mutan 3e-10
1ezz_A310 Crystal Structure Of E. Coli Aspartate Transcarbamo 3e-10
1ekx_A311 The Isolated, Unregulated Catalytic Trimer Of Aspar 3e-10
9atc_A310 Atcase Y165f Mutant Length = 310 3e-10
1raa_A310 Crystal Structure Of Ctp-Ligated T State Aspartate 4e-10
1i5o_A310 Crystal Structure Of Mutant R105a Of E. Coli Aspart 5e-10
1tth_A310 Aspartate Transcarbamoylase Catalytic Chain Mutant 6e-10
1d09_A310 Aspartate Transcarbamoylase Complexed With N-Phosph 1e-09
3mpu_A310 Crystal Structure Of The C47aA241C DISULFIDE-Linked 1e-09
3d6n_B291 Crystal Structure Of Aquifex Dihydroorotase Activat 2e-09
1xjw_A310 The Structure Of E. Coli Aspartate Transcarbamoylas 2e-09
1at1_A310 Crystal Structures Of Phosphonoacetamide Ligated T 3e-09
3r7d_A304 Crystal Structure Of Unliganded Aspartate Transcarb 4e-09
2be9_A300 Crystal Structure Of The Ctp-Liganded (T-State) Asp 4e-09
1pg5_A299 Crystal Structure Of The Unligated (t-state) Aspart 5e-09
2at2_A300 Molecular Structure Of Bacillus Subtilis Aspartate 9e-09
1acm_A310 Arginine 54 In The Active Site Of Escherichia Coli 2e-08
3q98_A399 Structure Of Ygew Encoded Protein From E. Coli Leng 1e-07
2atc_A305 Crystal And Molecular Structures Of Native And Ctp- 6e-07
>pdb|1A1S|A Chain A, Ornithine Carbamoyltransferase From Pyrococcus Furiosus Length = 314 Back     alignment and structure

Iteration: 1

Score = 291 bits (745), Expect = 3e-79, Method: Compositional matrix adjust. Identities = 137/263 (52%), Positives = 189/263 (71%), Gaps = 3/263 (1%) Query: 1 MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMAR 60 ++MIF KPS RTRVSFE + LGGHA+YL D+Q+ + E D ARVL RY D IMAR Sbjct: 48 LAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMAR 107 Query: 61 VFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 120 V+ H+D+ DLAK+ATVPVINGL+D++HPCQ +AD +TI E G ++G KVVYVGDGNN+ Sbjct: 108 VYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVA 167 Query: 121 HSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGIS---KIEITNDPKEVVQGADVVY 177 HS ++ + + V A P+G+EPD++ ++ A + E+ +DP + V+ ADV+Y Sbjct: 168 HSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIY 227 Query: 178 SDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPY 237 +DVWASMGQ+ EA R++ F+ FQV++ L+K A P FMHCLPA RG EVT+ VI++P Sbjct: 228 TDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPN 287 Query: 238 SIVFPQAENRMHAQNAIMLHALG 260 S+V+ QAENR+HAQ A++ +G Sbjct: 288 SVVWDQAENRLHAQKAVLALVMG 310
>pdb|1PVV|A Chain A, Refined Structure Of Pyrococcus Furiosus Ornithine Carbamoyltransferase At 1.87 A Length = 315 Back     alignment and structure
>pdb|4EP1|A Chain A, Crystal Structure Of Anabolic Ornithine Carbamoyltransferase From Bacillus Anthracis Length = 340 Back     alignment and structure
>pdb|1FB5|A Chain A, Low Resolution Structure Of Ovine Ornithine Transcarbmoylase In The Unliganded State Length = 320 Back     alignment and structure
>pdb|1OTH|A Chain A, Crystal Structure Of Human Ornithine Transcarbamoylase Complexed With N-Phosphonacetyl-L-Ornithine Length = 321 Back     alignment and structure
>pdb|4F2G|A Chain A, The Crystal Structure Of Ornithine Carbamoyltransferase From Burkholderia Thailandensis E264 Length = 309 Back     alignment and structure
>pdb|3GD5|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase From Gloeobacter Violaceus Length = 323 Back     alignment and structure
>pdb|2EF0|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase From Thermus Thermophilus Length = 301 Back     alignment and structure
>pdb|1VLV|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase (tm1097) From Thermotoga Maritima At 2.25 A Resolution Length = 325 Back     alignment and structure
>pdb|2I6U|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase Complexed With Carbamoyl Phosphate And L-Norvaline From Mycobacterium Tuberculosis (Rv1656) At 2.2 A Length = 307 Back     alignment and structure
>pdb|4A8H|A Chain A, Crystal Structure Of Putrescine Transcarbamylase From Enterococcus Faecalis With N-(Phosphonoacetyl)-Putrescine Length = 355 Back     alignment and structure
>pdb|4A8T|A Chain A, Crystal Structure Of Putrescine Transcarbamylase From Enterococcus Faecalis Lacking Its C-Terminal Helix, With Bound N5-(Phosphonoacetyl)-L-Ornithine Length = 339 Back     alignment and structure
>pdb|3TXX|A Chain A, Crystal Structure Of Putrescine Transcarbamylase From Enterococcus Faecalis Length = 359 Back     alignment and structure
>pdb|1DXH|A Chain A, Catabolic Ornithine Carbamoyltransferase From Pseudomonas Aeruginosa Length = 335 Back     alignment and structure
>pdb|1ORT|A Chain A, Ornithine Transcarbamoylase From Pseudomonas Aeruginosa Length = 335 Back     alignment and structure
>pdb|3TPF|A Chain A, Crystal Structure Of Anabolic Ornithine Carbamoyltransferase From Campylobacter Jejuni Subsp. Jejuni Nctc 11168 Length = 307 Back     alignment and structure
>pdb|3UPD|A Chain A, 2.9 Angstrom Crystal Structure Of Ornithine Carbamoyltransferase (Argf) From Vibrio Vulnificus Length = 358 Back     alignment and structure
>pdb|1AKM|A Chain A, Ornithine Transcarbamylase From Escherichia Coli Length = 333 Back     alignment and structure
>pdb|2W37|A Chain A, Crystal Structure Of The Hexameric Catabolic Ornithine Transcarbamylase From Lactobacillus Hilgardii Length = 359 Back     alignment and structure
>pdb|3SDS|A Chain A, Crystal Structure Of A Mitochondrial Ornithine Carbamoyltransferase From Coccidioides Immitis Length = 353 Back     alignment and structure
>pdb|2OTC|A Chain A, Ornithine Transcarbamoylase Complexed With N- (Phosphonacetyl)-L-Ornithine Length = 333 Back     alignment and structure
>pdb|3GRF|A Chain A, X-Ray Structure Of Ornithine Transcarbamoylase From Giardia Lamblia Length = 328 Back     alignment and structure
>pdb|4AMU|A Chain A, Structure Of Ornithine Carbamoyltransferase From Mycoplasma Penetrans With A P321 Space Group Length = 365 Back     alignment and structure
>pdb|3M5C|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302e Mutant Complexed With Palao Length = 359 Back     alignment and structure
>pdb|3M5D|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302r Mutant Complexed With Palao Length = 359 Back     alignment and structure
>pdb|3KZC|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase Length = 359 Back     alignment and structure
>pdb|3L05|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92s Mutant Complexed With Carbamyl Phosphate And N-Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>pdb|3M4N|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase K302a Mutant Complexed With Palao Length = 359 Back     alignment and structure
>pdb|3L02|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92a Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>pdb|3L04|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92p Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>pdb|3L06|A Chain A, Crystal Structure Of N-Acetyl-L-Ornithine Transcarbamylase E92v Mutant Complexed With Carbamyl Phosphate And N- Succinyl-L-Norvaline Length = 359 Back     alignment and structure
>pdb|2BE7|A Chain A, Crystal Structure Of The Unliganded (T-State) Aspartate Transcarbamoylase Of The Psychrophilic Bacterium Moritella Profunda Length = 326 Back     alignment and structure
>pdb|1ML4|A Chain A, The Pala-Liganded Aspartate Transcarbamoylase Catalytic Subunit From Pyrococcus Abyssi Length = 308 Back     alignment and structure
>pdb|2G7M|X Chain X, Crystal Structure Of B. Fragilis N-Succinylornithine Transcarbamylase P90e Mutant Complexed With Carbamoyl Phosphate And N-Acetylnorvaline Length = 338 Back     alignment and structure
>pdb|1JS1|X Chain X, Crystal Structure Of A New Transcarbamylase From The Anaerobic Bacterium Bacteroides Fragilis At 2.0 A Resolution Length = 324 Back     alignment and structure
>pdb|2FG6|X Chain X, N-Succinyl-L-Ornithine Transcarbamylase From B. Fragilis Complexed With Sulfate And N-Succinyl-L-Norvaline Length = 338 Back     alignment and structure
>pdb|2RGW|A Chain A, Catalytic Subunit Of M. Jannaschii Aspartate Transcarbamoylase Length = 306 Back     alignment and structure
>pdb|2YFK|A Chain A, Crystal Structure Of A Putative Transcarbamoylase From Enterococcus Faecalis Length = 418 Back     alignment and structure
>pdb|3LXM|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Catalytic Subunit Of An Aspartate Carbamoyltransferase (Pyrb) From Yersinia Pestis Co92 Length = 335 Back     alignment and structure
>pdb|2A0F|A Chain A, Structure Of D236a Mutant E. Coli Aspartate Transcarbamoylase In Presence Of Phosphonoacetamide At 2.90 A Resolution Length = 310 Back     alignment and structure
>pdb|4E2F|I Chain I, Crystal Structure Of E. Coli Aspartate Transcarbamoylase K164eE239K Mutant In An Intermediate State Length = 310 Back     alignment and structure
>pdb|1SKU|A Chain A, E. Coli Aspartate Transcarbamylase 240's Loop Mutant (K244n) Length = 310 Back     alignment and structure
>pdb|1EZZ|A Chain A, Crystal Structure Of E. Coli Aspartate Transcarbamoylase P268a Mutant In The T-State Length = 310 Back     alignment and structure
>pdb|1EKX|A Chain A, The Isolated, Unregulated Catalytic Trimer Of Aspartate Transcarbamoylase Complexed With Bisubstrate Analog Pala (N-(Phosphonacetyl)-L-Aspartate) Length = 311 Back     alignment and structure
>pdb|9ATC|A Chain A, Atcase Y165f Mutant Length = 310 Back     alignment and structure
>pdb|1RAA|A Chain A, Crystal Structure Of Ctp-Ligated T State Aspartate Transcarbamoylase At 2.5 Angstroms Resolution: Implications For Atcase Mutants And The Mechanism Of Negative Cooperativity Length = 310 Back     alignment and structure
>pdb|1I5O|A Chain A, Crystal Structure Of Mutant R105a Of E. Coli Aspartate Transcarbamoylase Length = 310 Back     alignment and structure
>pdb|1TTH|A Chain A, Aspartate Transcarbamoylase Catalytic Chain Mutant Glu50ala Complexed With N-(Phosphonacetyl-L-Aspartate) (Pala) Length = 310 Back     alignment and structure
>pdb|1D09|A Chain A, Aspartate Transcarbamoylase Complexed With N-Phosphonacetyl-L- Aspartate (Pala) Length = 310 Back     alignment and structure
>pdb|3MPU|A Chain A, Crystal Structure Of The C47aA241C DISULFIDE-Linked E. Coli Aspartate Transcarbamoylase Holoenzyme Length = 310 Back     alignment and structure
>pdb|3D6N|B Chain B, Crystal Structure Of Aquifex Dihydroorotase Activated By Aspartate Transcarbamoylase Length = 291 Back     alignment and structure
>pdb|1XJW|A Chain A, The Structure Of E. Coli Aspartate Transcarbamoylase Q137a Mutant In The R-State Length = 310 Back     alignment and structure
>pdb|1AT1|A Chain A, Crystal Structures Of Phosphonoacetamide Ligated T And Phosphonoacetamide And Malonate Ligated R States Of Aspartate Carbamoyltransferase At 2.8-Angstroms Resolution And Neutral PH Length = 310 Back     alignment and structure
>pdb|3R7D|A Chain A, Crystal Structure Of Unliganded Aspartate Transcarbamoylase From Bacillus Subtilis Length = 304 Back     alignment and structure
>pdb|2BE9|A Chain A, Crystal Structure Of The Ctp-Liganded (T-State) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 300 Back     alignment and structure
>pdb|1PG5|A Chain A, Crystal Structure Of The Unligated (t-state) Aspartate Transcarbamoylase From The Extremely Thermophilic Archaeon Sulfolobus Acidocaldarius Length = 299 Back     alignment and structure
>pdb|2AT2|A Chain A, Molecular Structure Of Bacillus Subtilis Aspartate Transcarbamoylase At 3.0 Angstroms Resolution Length = 300 Back     alignment and structure
>pdb|1ACM|A Chain A, Arginine 54 In The Active Site Of Escherichia Coli Aspartate Transcarbamoylase Is Critical For Catalysis: A Site-Specific Mutagenesis, Nmr And X-Ray Crystallography Study Length = 310 Back     alignment and structure
>pdb|3Q98|A Chain A, Structure Of Ygew Encoded Protein From E. Coli Length = 399 Back     alignment and structure
>pdb|2ATC|A Chain A, Crystal And Molecular Structures Of Native And Ctp-Liganded Aspartate Carbamoyltransferase From Escherichia Coli Length = 305 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 1e-165
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 1e-164
1oth_A321 Protein (ornithine transcarbamoylase); transferase 1e-163
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 1e-163
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 1e-163
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 1e-162
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 1e-162
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 1e-161
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 1e-157
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 1e-155
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 1e-155
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 1e-155
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 1e-151
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 1e-146
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 1e-144
3upd_A358 Otcase, ornithine carbamoyltransferase; structural 1e-144
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 1e-142
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 1e-140
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 1e-136
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 1e-135
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 1e-128
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 1e-127
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 1e-40
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 7e-39
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 2e-38
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 5e-36
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 1e-26
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 7e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Length = 315 Back     alignment and structure
 Score =  459 bits (1183), Expect = e-165
 Identities = 137/263 (52%), Positives = 189/263 (71%), Gaps = 3/263 (1%)

Query: 1   MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMAR 60
           ++MIF KPS RTRVSFE   + LGGHA+YL   D+Q+ + E   D ARVL RY D IMAR
Sbjct: 49  LAMIFQKPSTRTRVSFEVAMAHLGGHALYLNAQDLQLRRGETIADTARVLSRYVDAIMAR 108

Query: 61  VFGHQDILDLAKFATVPVINGLTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDGNNIV 120
           V+ H+D+ DLAK+ATVPVINGL+D++HPCQ +AD +TI E  G ++G KVVYVGDGNN+ 
Sbjct: 109 VYDHKDVEDLAKYATVPVINGLSDFSHPCQALADYMTIWEKKGTIKGVKVVYVGDGNNVA 168

Query: 121 HSWLLMASVIPFHFVCACPKGFEPDKETVEKARKAGI---SKIEITNDPKEVVQGADVVY 177
           HS ++  + +    V A P+G+EPD++ ++ A +         E+ +DP + V+ ADV+Y
Sbjct: 169 HSLMIAGTKLGADVVVATPEGYEPDEKVIKWAEQNAAESGGSFELLHDPVKAVKDADVIY 228

Query: 178 SDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEAPY 237
           +DVWASMGQ+ EA  R++ F+ FQV++ L+K A P   FMHCLPA RG EVT+ VI++P 
Sbjct: 229 TDVWASMGQEAEAEERRKIFRPFQVNKDLVKHAKPDYMFMHCLPAHRGEEVTDDVIDSPN 288

Query: 238 SIVFPQAENRMHAQNAIMLHALG 260
           S+V+ QAENR+HAQ A++   +G
Sbjct: 289 SVVWDQAENRLHAQKAVLALVMG 311


>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Length = 309 Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Length = 321 Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Length = 307 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Length = 323 Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Length = 340 Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 301 Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Length = 307 Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Length = 353 Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Length = 339 Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Length = 355 Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Length = 325 Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Length = 328 Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Length = 359 Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Length = 365 Back     alignment and structure
>3upd_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.91A {Vibrio vulnificus} Length = 358 Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Length = 335 Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Length = 333 Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Length = 324 Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Length = 418 Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Length = 399 Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Length = 308 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Length = 299 Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Length = 306 Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Length = 310 Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Length = 304 Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Length = 291 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
3tpf_A307 Otcase, ornithine carbamoyltransferase; structural 100.0
1pvv_A315 Otcase, ornithine carbamoyltransferase; dodecamer; 100.0
2i6u_A307 Otcase, ornithine carbamoyltransferase; X-RAY crys 100.0
3gd5_A323 Otcase, ornithine carbamoyltransferase; structural 100.0
4f2g_A309 Otcase 1, ornithine carbamoyltransferase 1; struct 100.0
1vlv_A325 Otcase, ornithine carbamoyltransferase; TM1097, st 100.0
4ep1_A340 Otcase, ornithine carbamoyltransferase; structural 100.0
2ef0_A301 Ornithine carbamoyltransferase; TTHA1199, thermus 100.0
4a8t_A339 Putrescine carbamoyltransferase; trabnsferase PALO 100.0
1duv_G333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 100.0
1dxh_A335 Ornithine carbamoyltransferase; transcarbamylase; 100.0
1oth_A321 Protein (ornithine transcarbamoylase); transferase 100.0
3grf_A328 Ornithine carbamoyltransferase; ornithine transcar 100.0
4a8p_A355 Putrescine carbamoyltransferase; ornithine agmatin 100.0
4amu_A365 Ornithine carbamoyltransferase, catabolic; ornithi 100.0
2w37_A359 Ornithine carbamoyltransferase, catabolic; transca 100.0
3sds_A353 Ornithine carbamoyltransferase, mitochondrial; str 100.0
1ml4_A308 Aspartate transcarbamoylase; beta pleated sheet, p 100.0
4h31_A358 Otcase, ornithine carbamoyltransferase; structural 100.0
1zq6_A359 Otcase, ornithine carbamoyltransferase; alpha/beta 100.0
4ekn_B306 Aspartate carbamoyltransferase; atcase, aspartate 100.0
1pg5_A299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 100.0
3csu_A310 Protein (aspartate carbamoyltransferase); transfer 100.0
3r7f_A304 Aspartate carbamoyltransferase; aspartate transcar 100.0
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 100.0
1js1_X324 Transcarbamylase; alpha/beta topology, two domains 100.0
3q98_A399 Transcarbamylase; rossmann fold, transferase; 2.00 100.0
2yfk_A418 Aspartate/ornithine carbamoyltransferase; transcar 100.0
3kzn_A359 Aotcase, N-acetylornithine carbamoyltransferase; t 100.0
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.54
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 97.8
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.64
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.6
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.4
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.33
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.3
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 97.18
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 97.15
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.12
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.09
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.08
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.02
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.0
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 96.97
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.91
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 96.91
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.87
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.86
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 96.81
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 96.8
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.77
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 96.76
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.7
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.65
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 96.64
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.55
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 96.52
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.52
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 96.49
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 96.48
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 96.39
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.38
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 96.37
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.37
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 96.33
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 96.32
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.1
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 95.87
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.78
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 95.74
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 95.65
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 95.59
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 95.57
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 95.48
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 95.47
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 95.3
3l07_A285 Bifunctional protein fold; structural genomics, ID 94.93
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.82
3p2o_A285 Bifunctional protein fold; structural genomics, ce 94.66
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 94.56
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.48
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 94.47
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.37
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 94.21
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 94.17
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 94.0
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 93.79
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 93.73
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 93.65
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 93.57
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.57
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 93.56
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 93.47
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 93.31
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 93.09
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 92.86
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 92.85
2bw0_A 329 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase 92.69
3aek_B525 Light-independent protochlorophyllide reductase S; 92.66
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 92.62
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 92.57
1fmt_A 314 Methionyl-tRNA FMet formyltransferase; initiator t 92.57
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 92.54
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 92.54
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 92.34
3av3_A212 Phosphoribosylglycinamide formyltransferase; struc 92.13
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 92.01
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 92.01
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 92.01
4ezb_A 317 Uncharacterized conserved protein; structural geno 91.83
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 91.45
3qha_A 296 Putative oxidoreductase; seattle structural genomi 91.4
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 91.39
3q0i_A 318 Methionyl-tRNA formyltransferase; structural genom 91.37
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 91.07
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 91.0
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase 90.93
2q5c_A196 NTRC family transcriptional regulator; structural 90.89
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 90.81
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.73
4h7p_A 345 Malate dehydrogenase; ssgcid, structural G seattle 90.62
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 90.52
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 90.48
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 90.02
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 89.95
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 89.83
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 89.78
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 89.64
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 89.57
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 89.52
3tqq_A 314 Methionyl-tRNA formyltransferase; protein synthesi 89.44
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 89.43
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 89.38
2i6t_A 303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 89.34
2pju_A225 Propionate catabolism operon regulatory protein; s 89.29
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 89.24
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 89.05
3dcm_X192 AdoMet, uncharacterized protein TM_1570; trefoil k 88.98
2xdq_B511 Light-independent protochlorophyllide reductase S; 88.92
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 88.91
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 88.88
1mio_A533 Nitrogenase molybdenum iron protein (alpha chain); 88.8
3rfo_A 317 Methionyl-tRNA formyltransferase; structural genom 88.79
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 88.78
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 88.75
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 88.44
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 88.42
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 88.35
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 88.27
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 88.25
1qgu_B519 Protein (nitrogenase molybdenum iron protein); bio 88.24
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 88.15
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 88.15
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 88.15
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 88.13
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 88.04
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 87.89
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 87.85
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 87.82
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 87.8
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 87.74
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 87.73
3u7q_B523 Nitrogenase molybdenum-iron protein beta chain; mu 87.72
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 87.7
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 87.67
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 87.56
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 87.35
2bln_A 305 Protein YFBG; transferase, formyltransferase, L-AR 86.88
1meo_A209 Phosophoribosylglycinamide formyltransferase; puri 86.87
3u95_A 477 Glycoside hydrolase, family 4; hydrolysis, cytosol 86.69
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 86.53
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 86.37
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 86.08
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 85.99
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 85.98
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 85.96
1mio_B458 Nitrogenase molybdenum iron protein (beta chain); 85.79
3tl2_A 315 Malate dehydrogenase; center for structural genomi 85.72
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 85.59
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 85.55
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 84.97
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 84.87
3vtf_A 444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 84.65
3nv9_A 487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 84.61
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 84.6
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 84.55
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 84.28
3hhp_A 312 Malate dehydrogenase; MDH, citric acid cycle, TCA 84.22
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 84.2
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 83.74
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 83.36
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 83.24
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 82.97
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 82.96
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 82.54
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 82.41
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 82.35
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 82.33
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 82.31
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 81.91
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 81.72
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 81.42
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 81.35
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 81.3
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 81.28
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 81.28
1s6y_A 450 6-phospho-beta-glucosidase; hydrolase, structural 81.26
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 81.23
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 80.94
1mld_A 314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 80.68
3pdi_A483 Nitrogenase MOFE cofactor biosynthesis protein NI; 80.35
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 80.28
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 80.21
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 80.1
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
Probab=100.00  E-value=2.3e-95  Score=663.78  Aligned_cols=259  Identities=37%  Similarity=0.653  Sum_probs=249.9

Q ss_pred             CEeeccCCChhhHHHHHHHHHhcCCeEEEeCCCCcCCCCCCCHHHHHHHHhhhccEEEEeeCCcchHHHHhhhCCCcEEe
Q 024871            1 MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFATVPVIN   80 (261)
Q Consensus         1 l~~lF~~~StRTR~SFe~A~~~LGg~~~~l~~~~s~~~kgEs~~Dt~~~ls~~~D~iv~R~~~~~~~~~~a~~~~vPVIN   80 (261)
                      ++++|||||||||+|||.||++|||+++++++++||++||||++||+|+||+|+|+||+||+.++.++++|+++++||||
T Consensus        39 la~lF~e~STRTR~SFe~A~~~LGg~~i~l~~~~ss~~kgEsl~DTarvls~~~D~iviR~~~~~~~~~lA~~~~vPVIN  118 (307)
T 3tpf_A           39 LAMIFEKNSTRTRMAFELAITELGGKALFLSSNDLQLSRGEPVKDTARVIGAMVDFVMMRVNKHETLLEFARYSKAPVIN  118 (307)
T ss_dssp             EEEEESSCCHHHHHHHHHHHHHTTCEEEEECTTTCCTTTSSCHHHHHHHHHHHSSEEEEECSCHHHHHHHHHHCSSCEEE
T ss_pred             EEEEecCCCcchHHhHHHHHHHcCCeEEEcCcccccCCCCCCHHHHHHHHHHhCCEEEEecCChHHHHHHHHhCCCCEEe
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCChhHHHHHHHHHHHHhCCCC-CcEEEEEcCCCchHHHHHHHHhcCCcEEEEeCCCCCCCCHHHHHHHH----Hh
Q 024871           81 GLTDYNHPCQIMADALTIIEHVGRLE-GTKVVYVGDGNNIVHSWLLMASVIPFHFVCACPKGFEPDKETVEKAR----KA  155 (261)
Q Consensus        81 a~~~~~HPtQ~L~Dl~Ti~e~~g~l~-~~~i~~vGd~~~v~~S~~~~~~~~g~~~~~~~P~~~~~~~~~~~~~~----~~  155 (261)
                      |+++++||||+|+|+|||+|++|+++ |+||+||||.+||+|||+.+++++|++|++++|++|.|+++++++++    +.
T Consensus       119 ag~~~~HPtQaLaDl~Ti~e~~g~l~~gl~va~vGD~~~va~Sl~~~~~~~G~~v~~~~P~~~~~~~~~~~~~~~~a~~~  198 (307)
T 3tpf_A          119 ALSELYHPTQVLGDLFTIKEWNKMQNGIAKVAFIGDSNNMCNSWLITAAILGFEISIAMPKNYKISPEIWEFAMKQALIS  198 (307)
T ss_dssp             EECSSCCHHHHHHHHHHHHHTTCCGGGCCEEEEESCSSHHHHHHHHHHHHHTCEEEEECCTTCCCCHHHHHHHHHHHHHH
T ss_pred             CCCCCcCcHHHHHHHHHHHHHhCCCCCCCEEEEEcCCCccHHHHHHHHHHcCCEEEEECCCccCCCHHHHHHHHHHHHHc
Confidence            98889999999999999999999999 99999999999999999999999999999999999999998877666    56


Q ss_pred             CCCeEEEEcCHHHHhCCCCEEEEecccCcchhHHHHHHHhhhcCCcccHHHHHhcCCCcEEeeCCCCCCCcccccccccC
Q 024871          156 GISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVIEA  235 (261)
Q Consensus       156 g~~~i~~~~d~~~a~~~aDviy~~~w~~~~~~~~~~~~~~~~~~y~v~~~~~~~a~~~~~~mH~lP~~rg~Ev~~~v~~~  235 (261)
                      | .++++++|+++|+++|||||||+|.||+++++.+++.+++.+||||.++|+.+++|++||||||+|||+||+++|+++
T Consensus       199 g-~~~~~~~d~~eav~~aDvvyt~~w~smg~e~~~~~~~~~~~~y~v~~e~l~~a~~~ai~mH~lPa~Rg~EI~~eV~d~  277 (307)
T 3tpf_A          199 G-AKISLGYDKFEALKDKDVVITDTWVSMGEENEKERKIKEFEGFMIDEKAMSVANKDAILLHCLPAYRGYEVSEEIFEK  277 (307)
T ss_dssp             T-CEEEEESCHHHHHTTCSEEEECCSSCTTGGGGHHHHHHHTGGGCBCHHHHHHSCTTCEEEECSCCCBTTTBCHHHHHH
T ss_pred             C-CeEEEEcCHHHHhcCCCEEEecCcccCCchhhHHHHHHHhcccccCHHHHHhcCCCcEEECCCCCCCCceeCHHHhCC
Confidence            7 589999999999999999999999999987766777889999999999999999999999999999999999999999


Q ss_pred             CCcchHhHHhccHHHHHHHHHHHhc
Q 024871          236 PYSIVFPQAENRMHAQNAIMLHALG  260 (261)
Q Consensus       236 ~~s~~~~Qa~N~l~~r~All~~~l~  260 (261)
                      |+|+||+||+||+|+|||||+++||
T Consensus       278 p~s~if~QaeNrl~~r~AlL~~ll~  302 (307)
T 3tpf_A          278 HADVIFEEARNRLYVVKALLCFLDN  302 (307)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcchHHHHHHcCHHHHHHHHHHHhh
Confidence            9999999999999999999999987



>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>1js1_X Transcarbamylase; alpha/beta topology, two domains, transferase; 2.00A {Bacteroides fragilis} SCOP: c.78.1.1 c.78.1.1 PDB: 2fg6_X* 2fg7_X* 2g7m_X* Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A Back     alignment and structure
>3aek_B Light-independent protochlorophyllide reductase S; iron/sulfur cluster, oxidoreductase, bacteriochlorophyll biosynthesis; HET: PMR; 2.30A {Rhodobacter capsulatus} PDB: 3aeq_B* 3aer_B 3aes_B* 3aeu_B 3aet_B Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A* 3r8x_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>3q0i_A Methionyl-tRNA formyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; 1.89A {Vibrio cholerae} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3dcm_X AdoMet, uncharacterized protein TM_1570; trefoil knot, spout mtase, adoMet binding, transferase; HET: SAM; 2.00A {Thermotoga maritima} Back     alignment and structure
>2xdq_B Light-independent protochlorophyllide reductase S; oxidoreductase, DPOR, (bacterio)chlorophyll biosynthesis, photosynthesis; 2.40A {Thermosynechococcus elongatus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1mio_A Nitrogenase molybdenum iron protein (alpha chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} SCOP: c.92.2.3 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1qgu_B Protein (nitrogenase molybdenum iron protein); biological nitrogen fixation, nitrogen metabolism, molybdoenzymes, electron transfer; HET: HCA CFM CLF; 1.60A {Klebsiella pneumoniae} SCOP: c.92.2.3 PDB: 1h1l_B* 1qh1_B* 1qh8_B* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3u7q_B Nitrogenase molybdenum-iron protein beta chain; multiple rossmann fold domains, reductase, nitrogen fixing, oxidoreductase; HET: HCA ICS 1CL CLF; 1.00A {Azotobacter vinelandii} SCOP: c.92.2.3 PDB: 1fp4_B* 1g21_B* 1g20_B* 1m1n_B* 1l5h_B* 1m1y_B* 1m34_B* 1n2c_B* 2afh_B* 2afi_B* 2afk_B* 2min_B* 3k1a_B* 3min_B* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1mio_B Nitrogenase molybdenum iron protein (beta chain); HET: HCA CFM CLP; 3.00A {Clostridium pasteurianum} SCOP: c.92.2.3 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3pdi_A Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 261
d1tuga1310 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltr 2e-51
d1pvva2163 c.78.1.1 (A:151-313) Ornithine transcarbamoylase { 2e-47
d1otha2170 c.78.1.1 (A:185-354) Ornithine transcarbamoylase { 2e-39
d1dxha2185 c.78.1.1 (A:151-335) Ornithine transcarbamoylase { 4e-36
d1pg5a2153 c.78.1.1 (A:147-299) Aspartate carbamoyltransferas 4e-33
d1pvva1150 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Ar 1e-32
d1vlva2161 c.78.1.1 (A:153-313) Ornithine transcarbamoylase { 2e-32
d1ml4a2157 c.78.1.1 (A:152-308) Aspartate carbamoyltransferas 3e-32
d1duvg2183 c.78.1.1 (G:151-333) Ornithine transcarbamoylase { 1e-31
d1ekxa2160 c.78.1.1 (A:151-310) Aspartate carbamoyltransferas 6e-29
d1js1x1163 c.78.1.1 (X:1-163) Transcarbamylase-like protein { 8e-29
d1js1x2161 c.78.1.1 (X:164-324) Transcarbamylase-like protein 2e-28
d1otha1151 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {H 1e-27
d1dxha1150 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Ps 7e-25
d1duvg1150 c.78.1.1 (G:1-150) Ornithine transcarbamoylase {Es 1e-23
d1vlva1152 c.78.1.1 (A:1-152) Ornithine transcarbamoylase {Th 3e-22
d1pg5a1146 c.78.1.1 (A:1-146) Aspartate carbamoyltransferase 8e-22
d1ekxa1150 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase 1e-17
d1ml4a1150 c.78.1.1 (A:2-151) Aspartate carbamoyltransferase 3e-17
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 310 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/ornithine carbamoyltransferase
family: Aspartate/ornithine carbamoyltransferase
domain: Aspartate carbamoyltransferase catalytic subunit
species: Escherichia coli [TaxId: 562]
 Score =  168 bits (426), Expect = 2e-51
 Identities = 64/267 (23%), Positives = 97/267 (36%), Gaps = 12/267 (4%)

Query: 1   MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGPDDIQM--GKREETRDAARVLCRYNDIIM 58
           ++  F   S RTR+SFET    LG   +            K E   D   V+  Y D I+
Sbjct: 44  IASCFFAASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIV 103

Query: 59  ARVFGHQDILDLAKFAT-VPVINGLTDYN-HPCQIMADALTIIEHVGRLEGTKVVYVGDG 116
            R           +F+  VPV+N     N HP Q + D  TI E  GRL+   V  VGD 
Sbjct: 104 MRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDL 163

Query: 117 NNIVHSW---LLMASVIPFHFVCACPKGFEPDKETVEKARKAGISKIEITNDPKEVVQGA 173
                       +A      F    P      +  ++   + GI    + +  +EV+   
Sbjct: 164 KYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEKGI-AWSLHSSIEEVMAEV 222

Query: 174 DVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVI 233
           D++Y                      F +    +  A      +H LP  R  E+   V 
Sbjct: 223 DILYMTRVQKERLDPS--EYANVKAQFVLRASDLHNAKANMKVLHPLP--RVDEIATDVD 278

Query: 234 EAPYSIVFPQAENRMHAQNAIMLHALG 260
           + P++  F QA N + A+ A++   L 
Sbjct: 279 KTPHAWYFQQAGNGIFARQALLALVLN 305


>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 163 Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 185 Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 153 Back     information, alignment and structure
>d1pvva1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 150 Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Length = 161 Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 157 Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Length = 183 Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 160 Back     information, alignment and structure
>d1js1x1 c.78.1.1 (X:1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Length = 163 Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Length = 161 Back     information, alignment and structure
>d1otha1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d1dxha1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Length = 150 Back     information, alignment and structure
>d1duvg1 c.78.1.1 (G:1-150) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure
>d1vlva1 c.78.1.1 (A:1-152) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Length = 152 Back     information, alignment and structure
>d1pg5a1 c.78.1.1 (A:1-146) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 146 Back     information, alignment and structure
>d1ekxa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure
>d1ml4a1 c.78.1.1 (A:2-151) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d1tuga1310 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 100.0
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 100.0
d1ml4a2157 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 100.0
d1duvg2183 Ornithine transcarbamoylase {Escherichia coli [Tax 100.0
d1otha2170 Ornithine transcarbamoylase {Human (Homo sapiens) 100.0
d2at2a2151 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1pg5a2153 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1ekxa2160 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1duvg1150 Ornithine transcarbamoylase {Escherichia coli [Tax 100.0
d1pvva1150 Ornithine transcarbamoylase {Archaeon Pyrococcus f 100.0
d1vlva1152 Ornithine transcarbamoylase {Thermotoga maritima [ 100.0
d1otha1151 Ornithine transcarbamoylase {Human (Homo sapiens) 100.0
d1dxha1150 Ornithine transcarbamoylase {Pseudomonas aeruginos 100.0
d1ml4a1150 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1ekxa1150 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1js1x1163 Transcarbamylase-like protein {Bacteroides fragili 100.0
d1js1x2161 Transcarbamylase-like protein {Bacteroides fragili 100.0
d1pg5a1146 Aspartate carbamoyltransferase catalytic subunit { 100.0
d2at2a1144 Aspartate carbamoyltransferase catalytic subunit { 100.0
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.34
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 97.25
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.96
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.72
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.68
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.53
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.44
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.39
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.38
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.16
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.15
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 96.05
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 95.51
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.47
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.29
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.07
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 93.88
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 93.85
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.83
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 93.48
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 93.3
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.19
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 92.91
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.9
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 92.13
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.01
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.76
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.64
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 91.49
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 91.49
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 91.4
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 91.4
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.99
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 90.9
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 90.76
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 90.27
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 90.05
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 90.04
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.88
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 89.65
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.38
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.84
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 88.8
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.76
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 88.62
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 88.49
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 87.89
d2pjua1186 Propionate catabolism operon regulatory protein Pr 87.81
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 87.51
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.73
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 86.65
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 86.53
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.48
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 86.43
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 86.25
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 85.51
d1uc8a188 Lysine biosynthesis enzyme LysX, N-terminal domain 84.34
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 84.19
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 83.57
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 82.31
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 81.7
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 81.26
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 80.42
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ATC-like
superfamily: Aspartate/ornithine carbamoyltransferase
family: Aspartate/ornithine carbamoyltransferase
domain: Aspartate carbamoyltransferase catalytic subunit
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=7.9e-82  Score=574.99  Aligned_cols=255  Identities=25%  Similarity=0.305  Sum_probs=233.8

Q ss_pred             CEeeccCCChhhHHHHHHHHHhcCCeEEEeCC--CCcCCCCCCCHHHHHHHHhhhccEEEEeeCCcchHHHHhhhC-CCc
Q 024871            1 MSMIFAKPSMRTRVSFETGFSLLGGHAIYLGP--DDIQMGKREETRDAARVLCRYNDIIMARVFGHQDILDLAKFA-TVP   77 (261)
Q Consensus         1 l~~lF~~~StRTR~SFe~A~~~LGg~~~~l~~--~~s~~~kgEs~~Dt~~~ls~~~D~iv~R~~~~~~~~~~a~~~-~vP   77 (261)
                      ++++|+|||||||+|||.||++|||++++++.  ..++..||||++||++|||+|+|+|++||+.++.++++++++ +||
T Consensus        44 iallF~kpSTRTR~SFe~A~~~LGg~~i~~~~~~~~~~~~kgEsi~Dt~~vls~~~d~iv~R~~~~~~~~~~~~~~~~vP  123 (310)
T d1tuga1          44 IASCFFAASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVP  123 (310)
T ss_dssp             EEEEESSCCHHHHHHHHHHHHHTTCEEEEEECCSSCHHHHTSCCHHHHHHHHTTTCSEEEEEESSBTHHHHHTTTCTTSC
T ss_pred             EEEEecCCCcchhhhHHHHHHHhccccccccccccccccCCCccHHHhhhHhhhcchheeeechhhhhhHHHHHhccCcc
Confidence            58999999999999999999999999998753  344557999999999999999999999999999999998865 899


Q ss_pred             EEeC-CCCCCChhHHHHHHHHHHHHhCCCCCcEEEEEcCC--CchHHHHHHHHhcCC-cEEEEeCCCCCCCCHHHHHHHH
Q 024871           78 VING-LTDYNHPCQIMADALTIIEHVGRLEGTKVVYVGDG--NNIVHSWLLMASVIP-FHFVCACPKGFEPDKETVEKAR  153 (261)
Q Consensus        78 VINa-~~~~~HPtQ~L~Dl~Ti~e~~g~l~~~~i~~vGd~--~~v~~S~~~~~~~~g-~~~~~~~P~~~~~~~~~~~~~~  153 (261)
                      |||| +|+.+||||+|+|++||+|++|+++|+||+|+||.  +||+||++.+++++| +++++++|++|+|++++++.++
T Consensus       124 VINAg~~~~~HP~Q~LaD~~Ti~e~~g~l~~~~i~~vGD~~~~~v~~S~~~~~~~~~~~~~~i~~P~~~~~~~~~~~~~~  203 (310)
T d1tuga1         124 VLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLD  203 (310)
T ss_dssp             EEEEEETTSCCHHHHHHHHHHHHHHHSCSSSCEEEEESCTTTCHHHHHHHHHHTTSSSCEEEEECCGGGCCCHHHHHHHH
T ss_pred             EEECCCCcccchHHHHHHHHHHHHHcCCcccceEEEEeccccCcchHHHHHHHHhccCceEEEeCCcccccchhcccccc
Confidence            9996 68899999999999999999999999999999995  789999999999985 7999999999999999999999


Q ss_pred             HhCCCeEEEEcCHHHHhCCCCEEEEecccCcchhHHHHHHHhhhcCCcccHHHHHhcCCCcEEeeCCCCCCCcccccccc
Q 024871          154 KAGISKIEITNDPKEVVQGADVVYSDVWASMGQKEEAAYRKQAFQGFQVDEFLMKLAGPKAYFMHCLPAERGVEVTEGVI  233 (261)
Q Consensus       154 ~~g~~~i~~~~d~~~a~~~aDviy~~~w~~~~~~~~~~~~~~~~~~y~v~~~~~~~a~~~~~~mH~lP~~rg~Ev~~~v~  233 (261)
                      +.| ..+.+++|+++++++|||||+++|.++..++.  .+.+.+.+||+|.++|+.++++++||||||  ||+||+++|+
T Consensus       204 ~~~-~~~~~~~d~~~a~~~aDvvy~~~~~~e~~~~~--~~~~~~~~~~v~~~~l~~a~~~~i~MHcLP--Rg~EIt~eV~  278 (310)
T d1tuga1         204 EKG-IAWSLHSSIEEVMAEVDILYMTRVQKERLDPS--EYANVKAQFVLRASDLHNAKANMKVLHPLP--RVDEIATDVD  278 (310)
T ss_dssp             TTT-CCEEEESCGGGTTTTCSEEEECCCCGGGSCHH--HHHTTTTSSCBCGGGGTTSCSSCEEECCSC--CSSSBCGGGG
T ss_pred             ccc-ceeeeeechhhhccCCceeeecccchhhhccc--chhhhhhhhhhhHHHHhcCCCCcEEeeCCC--CCCEecHhhh
Confidence            888 57899999999999999999999976543322  335567889999999999999999999999  8999999999


Q ss_pred             cCCCcchHhHHhccHHHHHHHHHHHhc
Q 024871          234 EAPYSIVFPQAENRMHAQNAIMLHALG  260 (261)
Q Consensus       234 ~~~~s~~~~Qa~N~l~~r~All~~~l~  260 (261)
                      ++|+|++|+||+||+|+|||||.++||
T Consensus       279 d~p~s~v~~QAeNrl~~qkAlL~~lL~  305 (310)
T d1tuga1         279 KTPHAWYFQQAGNGIFARQALLALVLN  305 (310)
T ss_dssp             GSTTBCHHHHHHHHHHHHHHHHHHHHS
T ss_pred             cCCcchHHHHHHhhHHHHHHHHHHHhC
Confidence            999999999999999999999999997



>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1duvg1 c.78.1.1 (G:1-150) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vlva1 c.78.1.1 (A:1-152) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1otha1 c.78.1.1 (A:34-184) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxha1 c.78.1.1 (A:1-150) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ml4a1 c.78.1.1 (A:2-151) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ekxa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js1x1 c.78.1.1 (X:1-163) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1js1x2 c.78.1.1 (X:164-324) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1pg5a1 c.78.1.1 (A:1-146) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2at2a1 c.78.1.1 (A:1-144) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure