Citrus Sinensis ID: 026836
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| 224104290 | 243 | predicted protein [Populus trichocarpa] | 0.612 | 0.584 | 0.642 | 3e-36 | |
| 297819328 | 316 | hypothetical protein ARALYDRAFT_905943 [ | 0.650 | 0.477 | 0.520 | 1e-30 | |
| 297745915 | 375 | unnamed protein product [Vitis vinifera] | 0.806 | 0.498 | 0.497 | 6e-28 | |
| 15232729 | 352 | RNA-binding motif protein, X-linked 2 [A | 0.370 | 0.244 | 0.712 | 7e-28 | |
| 356551855 | 354 | PREDICTED: zinc finger CCCH domain-conta | 0.801 | 0.525 | 0.450 | 2e-27 | |
| 225434618 | 429 | PREDICTED: uncharacterized protein LOC10 | 0.784 | 0.424 | 0.492 | 2e-27 | |
| 449460375 | 395 | PREDICTED: zinc finger CCCH domain-conta | 0.767 | 0.450 | 0.453 | 7e-27 | |
| 357490653 | 393 | RNA binding domain protein [Medicago tru | 0.715 | 0.422 | 0.521 | 7e-26 | |
| 147840589 | 737 | hypothetical protein VITISV_032469 [Viti | 0.784 | 0.246 | 0.465 | 4e-25 | |
| 297793411 | 173 | hypothetical protein ARALYDRAFT_358097 [ | 0.353 | 0.473 | 0.646 | 7e-24 |
| >gi|224104290|ref|XP_002313385.1| predicted protein [Populus trichocarpa] gi|222849793|gb|EEE87340.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 157 bits (397), Expect = 3e-36, Method: Compositional matrix adjust.
Identities = 97/151 (64%), Positives = 110/151 (72%), Gaps = 9/151 (5%)
Query: 30 NNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSH 89
+NLNGAQ+LGR IRVDHV KYKKKEEEDEET Q+ RE RGVC AFQRGEC RG GC+FSH
Sbjct: 95 DNLNGAQVLGRIIRVDHVTKYKKKEEEDEETAQQKREARGVCHAFQRGECNRGAGCRFSH 154
Query: 90 NEQRAANTGGGPQDRSSRWGHEKFEGFSWGKNDSSSRATGSGRVALEGNPNQSDRREEKR 149
+EQRAANTG G QD+SSRWGHE F+G S S + E +P Q+DRREEKR
Sbjct: 155 DEQRAANTGWGAQDKSSRWGHEMFDG------PKKSEERSSYNMPSESHPKQNDRREEKR 208
Query: 150 SIRHDHRE---KPREDHGRREDKRSRRHSDN 177
S HD E KPRED+ RREDK+ RR D+
Sbjct: 209 SRWHDDNEIVQKPREDYNRREDKKLRRLEDD 239
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297819328|ref|XP_002877547.1| hypothetical protein ARALYDRAFT_905943 [Arabidopsis lyrata subsp. lyrata] gi|297323385|gb|EFH53806.1| hypothetical protein ARALYDRAFT_905943 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297745915|emb|CBI15971.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15232729|ref|NP_190296.1| RNA-binding motif protein, X-linked 2 [Arabidopsis thaliana] gi|75337070|sp|Q9SD61.1|C3H42_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 42; Short=AtC3H42 gi|6522593|emb|CAB61958.1| putative RNA binding protein [Arabidopsis thaliana] gi|27311733|gb|AAO00832.1| putative RNA-binding protein [Arabidopsis thaliana] gi|34098859|gb|AAQ56812.1| At3g47120 [Arabidopsis thaliana] gi|332644724|gb|AEE78245.1| RNA-binding motif protein, X-linked 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356551855|ref|XP_003544288.1| PREDICTED: zinc finger CCCH domain-containing protein 42-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225434618|ref|XP_002279321.1| PREDICTED: uncharacterized protein LOC100246760 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449460375|ref|XP_004147921.1| PREDICTED: zinc finger CCCH domain-containing protein 25-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357490653|ref|XP_003615614.1| RNA binding domain protein [Medicago truncatula] gi|355516949|gb|AES98572.1| RNA binding domain protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147840589|emb|CAN72715.1| hypothetical protein VITISV_032469 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297793411|ref|XP_002864590.1| hypothetical protein ARALYDRAFT_358097 [Arabidopsis lyrata subsp. lyrata] gi|297310425|gb|EFH40849.1| hypothetical protein ARALYDRAFT_358097 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 232 | ||||||
| TAIR|locus:2075676 | 352 | AT3G47120 [Arabidopsis thalian | 0.840 | 0.553 | 0.381 | 3.3e-24 | |
| MGI|MGI:1919414 | 326 | Rbmx2 "RNA binding motif prote | 0.517 | 0.368 | 0.298 | 4.9e-10 | |
| UNIPROTKB|G5E5I0 | 338 | RBMX2 "Uncharacterized protein | 0.418 | 0.286 | 0.297 | 3.8e-08 | |
| DICTYBASE|DDB_G0288797 | 560 | fip1l1 "cleavage and polyadeny | 0.5 | 0.207 | 0.330 | 5.1e-08 | |
| WB|WBGene00018926 | 419 | F56A11.6 [Caenorhabditis elega | 0.612 | 0.338 | 0.304 | 8.5e-08 | |
| UNIPROTKB|F1LMQ9 | 327 | Rbmx2 "RNA-binding motif prote | 0.586 | 0.415 | 0.262 | 1.5e-07 | |
| RGD|1562693 | 328 | Rbmx2 "RNA binding motif prote | 0.586 | 0.414 | 0.262 | 1.5e-07 | |
| UNIPROTKB|G4NKC1 | 330 | MGG_03086 "U2 snRNP component | 0.366 | 0.257 | 0.344 | 7.6e-07 | |
| ZFIN|ZDB-GENE-030131-1495 | 635 | zrsr2 "zinc finger (CCCH type) | 0.646 | 0.236 | 0.294 | 1e-06 | |
| UNIPROTKB|E1C591 | 747 | PPIG "Uncharacterized protein" | 0.633 | 0.196 | 0.306 | 1.3e-06 |
| TAIR|locus:2075676 AT3G47120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 277 (102.6 bits), Expect = 3.3e-24, P = 3.3e-24
Identities = 84/220 (38%), Positives = 106/220 (48%)
Query: 30 NNLNGAQILGRTIRVDHVAXXXXXXXXXXXXXXXXXXXXGVCRAFQRGECTRGDGCKFSH 89
+NLNGA +LGRTI+VDH GVCRAFQRGECTRGD CKFSH
Sbjct: 95 DNLNGALVLGRTIKVDHCGAYKKHEEEDEETRRQNREARGVCRAFQRGECTRGDSCKFSH 154
Query: 90 NEQRAANTGGG-PQDRSSRWGHEKF-EG------FSWG---KNDSSSRATGSGRVALEGN 138
+E+RAANTG G +DRSS+W H+K EG F G + DS + R A G
Sbjct: 155 DEKRAANTGWGHEEDRSSKWDHDKNREGRGVCRAFQRGECTRGDSCKFSHDEKRAATTGW 214
Query: 139 PNQSDRREEKRSIRHDHREKPREDHGRREDKRSRRHSDNNEFEARSREDHYRRDEKRPKR 198
++ DR + + + +K G R D + D E R R D RPK
Sbjct: 215 GHEEDRSSKWDQDKLNGAKKGGTSFGNRGDFKP----DVEEKSYRGRGDG-DASYGRPK- 268
Query: 199 HESESYLREDQDRRGGD------KSSTGRGDSS-SHRHRE 231
E E RED R D + +GR D++ S RH +
Sbjct: 269 -ERERVDREDMGPRSRDAYDMKEQKRSGRYDNAYSRRHND 307
|
|
| MGI|MGI:1919414 Rbmx2 "RNA binding motif protein, X-linked 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E5I0 RBMX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288797 fip1l1 "cleavage and polyadenylation specificity factor FIP1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00018926 F56A11.6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LMQ9 Rbmx2 "RNA-binding motif protein, X-linked 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1562693 Rbmx2 "RNA binding motif protein, X-linked 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NKC1 MGG_03086 "U2 snRNP component IST3" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1495 zrsr2 "zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C591 PPIG "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| cd12411 | 89 | cd12411, RRM_ist3_like, RNA recognition motif in i | 2e-06 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 2e-04 | |
| smart00356 | 27 | smart00356, ZnF_C3H1, zinc finger | 3e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 0.001 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 0.001 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 0.002 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 0.003 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 0.004 |
| >gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family | Back alignment and domain information |
|---|
Score = 44.2 bits (105), Expect = 2e-06
Identities = 15/20 (75%), Positives = 17/20 (85%)
Query: 31 NLNGAQILGRTIRVDHVAKY 50
NLNG ++LGRTIRVDHV Y
Sbjct: 70 NLNGIKLLGRTIRVDHVRNY 89
|
This subfamily corresponds to the RRM of the ist3 family that includes fungal U2 small nuclear ribonucleoprotein (snRNP) component increased sodium tolerance protein 3 (ist3), X-linked 2 RNA-binding motif proteins (RBMX2) found in Metazoa and plants, and similar proteins. Gene IST3 encoding ist3, also termed U2 snRNP protein SNU17 (Snu17p), is a novel yeast Saccharomyces cerevisiae protein required for the first catalytic step of splicing and for progression of spliceosome assembly. It binds specifically to the U2 snRNP and is an intrinsic component of prespliceosomes and spliceosomes. Yeast ist3 contains an atypical RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). In the yeast pre-mRNA retention and splicing complex, the atypical RRM of ist3 functions as a scaffold that organizes the other two constituents, Bud13p (bud site selection 13) and Pml1p (pre-mRNA leakage 1). Fission yeast Schizosaccharomyces pombe gene cwf29 encoding ist3, also termed cell cycle control protein cwf29, is an RNA-binding protein complexed with cdc5 protein 29. It also contains one RRM. The biological function of RBMX2 remains unclear. It shows high sequence similarity to yeast ist3 protein and harbors one RRM as well. . Length = 89 |
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| KOG0126 | 219 | consensus Predicted RNA-binding protein (RRM super | 99.82 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 95.15 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 94.81 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 94.66 | |
| KOG0111 | 298 | consensus Cyclophilin-type peptidyl-prolyl cis-tra | 93.72 | |
| KOG1763 | 343 | consensus Uncharacterized conserved protein, conta | 88.52 | |
| PF13893 | 56 | RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or | 86.38 | |
| KOG0130 | 170 | consensus RNA-binding protein RBM8/Tsunagi (RRM su | 84.22 | |
| KOG0108 | 435 | consensus mRNA cleavage and polyadenylation factor | 82.57 |
| >KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.82 E-value=4.8e-21 Score=167.20 Aligned_cols=87 Identities=32% Similarity=0.453 Sum_probs=73.9
Q ss_pred ecceeeeeeeecCCCceecCceeEecccccccccccccHHHHHHHHHhhhhhHhhhcCCCCCCCCCcccccccccCCCCC
Q 026836 20 LKAIFSRFLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSHNEQRAANTGG 99 (232)
Q Consensus 20 ~~~~StiLAVDNlNG~~v~GR~irVDHv~~Yk~~~~edee~~~~~~e~~~v~~alq~~~C~~~~~ck~sh~~q~~~~t~~ 99 (232)
-.|+||||||||||||+|+|||||||||.+|++|.+..+ ++.|+..||+++|.+..+-.+.++++.++++.|
T Consensus 85 EDQRSTILAVDN~NGiki~gRtirVDHv~~Yk~pk~~E~--------~d~~t~~L~~~g~~~~~~~~~~~~~~~~~~~k~ 156 (219)
T KOG0126|consen 85 EDQRSTILAVDNLNGIKILGRTIRVDHVSNYKKPKESEE--------MDAVTKELQEEGCSPKNQSIIAQPEKPSPRYKT 156 (219)
T ss_pred cCccceEEEEeccCCceecceeEEeeecccccCCchhhh--------hhHHHHHHhhccCCCCchhhhccccCCCccccc
Confidence 369999999999999999999999999999999966555 788999999999999999889999999999999
Q ss_pred CC--CCCCccccccccc
Q 026836 100 GP--QDRSSRWGHEKFE 114 (232)
Q Consensus 100 ~s--ed~~~~~~~~k~~ 114 (232)
+- +++.+.+.+.+..
T Consensus 157 ~~e~~~~~~~K~~~~~~ 173 (219)
T KOG0126|consen 157 VKEKEDRGSKKHSKKNK 173 (219)
T ss_pred eeecccccchhhhhhhH
Confidence 95 4555444444333
|
|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF13893 RRM_5: RNA recognition motif | Back alignment and domain information |
|---|
| >KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 232 | |||
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 5e-05 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 2e-04 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 3e-04 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 6e-04 |
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
Score = 39.4 bits (92), Expect = 5e-05
Identities = 11/34 (32%), Positives = 16/34 (47%)
Query: 57 DEETRQRMREERGVCRAFQRGECTRGDGCKFSHN 90
E+ VC+ + RG C +GD C+F H
Sbjct: 5 HHHHSHMSGEKTVVCKHWLRGLCKKGDQCEFLHE 38
|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 95.63 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 95.56 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 95.46 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 93.54 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 93.38 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 92.83 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 88.74 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 88.65 | |
| 2wbr_A | 89 | GW182, gawky, LD47780P; DNA-binding protein, RRM, | 88.28 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 88.23 | |
| 2dnr_A | 91 | Synaptojanin-1; RRM domain, RBD, structural genomi | 86.62 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 85.42 | |
| 2dgx_A | 96 | KIAA0430 protein; RRM domain, structural genomics, | 85.38 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 85.02 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 84.47 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 84.23 | |
| 3s8s_A | 110 | Histone-lysine N-methyltransferase SETD1A; chromat | 84.01 | |
| 2diu_A | 96 | KIAA0430 protein; structural genomics, RRM domain, | 83.01 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 82.08 | |
| 2nlw_A | 105 | Eukaryotic translation initiation factor 3 subunit | 81.85 | |
| 1ufw_A | 95 | Synaptojanin 2; RNP domain, structural genomics, r | 81.73 | |
| 2cpi_A | 111 | CCR4-NOT transcription complex subunit 4; RNA reco | 81.63 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 81.26 | |
| 3p5t_L | 90 | Cleavage and polyadenylation specificity factor S; | 81.19 | |
| 2e44_A | 96 | Insulin-like growth factor 2 mRNA binding protein | 80.86 | |
| 1wg1_A | 88 | KIAA1579 protein, homolog EXC-7; RBD, structural g | 80.66 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 80.47 | |
| 1x5p_A | 97 | Negative elongation factor E; structure genomics, | 80.04 |
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=95.63 E-value=0.0035 Score=47.50 Aligned_cols=27 Identities=52% Similarity=1.084 Sum_probs=23.9
Q ss_pred hhhhhHhhhcCCCCCCC-CCcccccccc
Q 026836 67 ERGVCRAFQRGECTRGD-GCKFSHNEQR 93 (232)
Q Consensus 67 ~~~v~~alq~~~C~~~~-~ck~sh~~q~ 93 (232)
.-.||+.||+|.|.+++ .|+|+|+...
T Consensus 16 ~~~VCrdFlrG~C~r~d~~CrfsH~~~~ 43 (89)
T 2rpp_A 16 TLEVCRQFQRGTCSRSDEECKFAHPPKS 43 (89)
T ss_dssp EECBCHHHHHTCCCCCTTTSSSBCCCSS
T ss_pred hhhhchHHhcCCCCCCCCCCCCcCCCcc
Confidence 35699999999999998 9999998765
|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A | Back alignment and structure |
|---|
| >2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C | Back alignment and structure |
|---|
| >2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 232 | |||
| d1u2fa_ | 90 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 91.83 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 89.67 | |
| d2cpea1 | 101 | RNA-binding protein EWS {Human (Homo sapiens) [Tax | 89.16 | |
| d1wf2a_ | 98 | Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu | 88.74 | |
| d2f9da1 | 114 | Pre-mRNA branch site protein p14 {Human (Homo sapi | 88.6 | |
| d1cvja1 | 80 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 86.84 | |
| d1rk8a_ | 88 | RNA-binding protein 8 {Fruit fly (Drosophila melan | 86.21 | |
| d2cpia1 | 89 | E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc | 86.06 | |
| d1x5ta1 | 83 | Splicing factor 3B subunit 4 {Human (Homo sapiens) | 85.39 | |
| d1whxa_ | 111 | Probable RNA-binding protein 19, Rbm19 {Mouse (Mus | 84.9 | |
| d2u2fa_ | 85 | Splicing factor U2AF 65 KDa subunit {Human (Homo s | 84.89 | |
| d1x4da1 | 89 | Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | 84.74 | |
| d1fxla1 | 82 | Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 | 83.98 | |
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 83.93 | |
| d1cvja2 | 89 | Poly(A)-binding protein {Human (Homo sapiens) [Tax | 83.67 | |
| d2cq0a1 | 90 | Eukaryotic translation initiation factor 3 subunit | 83.54 | |
| d1fjca_ | 96 | Nucleolin {Golden hamster (Mesocricetus auratus) [ | 83.48 | |
| d1b7fa1 | 82 | Sex-lethal protein {Drosophila melanogaster [TaxId | 82.88 | |
| d2bz2a1 | 79 | Negative elongation factor E, NELF-E {Human (Homo | 82.74 | |
| d1h2vz_ | 93 | CBP20, 20KDa nuclear cap-binding protein {Human (H | 82.57 | |
| d1weya_ | 104 | Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 | 82.54 | |
| d2cqia1 | 90 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 82.03 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 81.85 | |
| d1x4aa1 | 95 | Splicing factor, arginine/serine-rich 1, SFRS1 {Hu | 81.8 | |
| d1no8a_ | 78 | Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 | 81.47 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 81.07 | |
| d1wg1a_ | 88 | Probable RNA-binding protein KIAA1579 {Human (Homo | 80.77 | |
| d2cqha1 | 80 | IGF-II mRNA-binding protein 2 isoform A {Human (Ho | 80.44 | |
| d2dita1 | 99 | HIV Tat-specific factor 1 {Human (Homo sapiens) [T | 80.19 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 80.11 | |
| d2cpza1 | 102 | CUG triplet repeat RNA-binding protein 1 {Human (H | 80.05 |
| >d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: Splicing factor U2AF 65 KDa subunit species: Human (Homo sapiens) [TaxId: 9606]
Probab=91.83 E-value=0.02 Score=38.99 Aligned_cols=28 Identities=11% Similarity=0.279 Sum_probs=23.6
Q ss_pred eeeeecCCCceecCceeEecccccccccc
Q 026836 26 RFLPNNLNGAQILGRTIRVDHVAKYKKKE 54 (232)
Q Consensus 26 iLAVDNlNG~~v~GR~irVDHv~~Yk~~~ 54 (232)
..|+ +|||..|.|+.|+|.+...|.++.
T Consensus 62 ~~a~-~l~g~~~~Gr~l~V~r~k~~~p~p 89 (90)
T d1u2fa_ 62 TQAM-AFDGIIFQGQSLKIRRPHDYQPLP 89 (90)
T ss_dssp TTGG-GGSSCCSSSSCCCCBCTTCCSCCC
T ss_pred HHHH-hhCCcEECCEEEEECCCCCCCCcc
Confidence 3456 699999999999999998888763
|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} | Back information, alignment and structure |
|---|
| >d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|