Citrus Sinensis ID: 026836


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MPSTKIRLTFTSAASLSISLKAIFSRFLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSHNEQRAANTGGGPQDRSSRWGHEKFEGFSWGKNDSSSRATGSGRVALEGNPNQSDRREEKRSIRHDHREKPREDHGRREDKRSRRHSDNNEFEARSREDHYRRDEKRPKRHESESYLREDQDRRGGDKSSTGRGDSSSHRHRER
cccccEEEEEEcccccHHHHHHHHHHHccccccccEEEcEEEEEEcccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHcccccccccccccccccccccccc
ccccEEEEEEccHHHHHHHHHHHHHHHHHHcccccEEEcEEEEEccHHHHccHHHHcHHHHHHHHHHccHHHHHcccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccc
MPSTKIRLTFTSAASLSISLKAIFSrflpnnlngaqilgrtIRVDHVAKYKKKEEEDEETRQRMREERgvcrafqrgectrgdgckfshneqraantgggpqdrssrwghekfegfswgkndsssratgsgrvalegnpnqsdrreekrsirhdhrekpredhgrredkrsrrhsdnnefearsredhyrrdekrpkrhesesylredqdrrggdksstgrgdssshrhrer
MPSTKIRLTFTSAASLSISLKAIFSRFLPNnlngaqilgrtirvdhvakykkkeeedeetrqrmreergvcrafqrgectrgdgckfshneqraantgggpqdrssrWGHEKFEgfswgkndsssratgsgrvalegnpnqsdrreekrsirhdhrekpredhgrredkrsrrhsdnnefearsredhyrrdekrpkrhesesylredqdrrggdksstgrgdssshrhrer
MPSTKIRLTFTsaaslsislkaifsRFLPNNLNGAQILGRTIRVDHVAkykkkeeedeetrqrmreerGVCRAFQRGECTRGDGCKFSHNEQRAANTGGGPQDRSSRWGHEKFEGFSWGKNDSSSRATGSGRVALEGNPNQSDRREEKRSIRHDHREKPREDHGRREDKRSRRHSDNNEFEARSREDHYRRDEKRPKRHESESYLREDQDRRGGDKSSTGRGDSSSHRHRER
******RLTFTSAASLSISLKAIFSRFLPNNLNGAQILGRTIRVDHVAK***************************************************************************************************************************************************************************************
****KIR*TFTSAASLSISLKAIFSRFLPNNLNGAQILGRTIRVDHV*****************************************************************************************************************************************************************************************
MPSTKIRLTFTSAASLSISLKAIFSRFLPNNLNGAQILGRTIRVDHVAK*****************ERGVCRAFQRGECTRGDGCKFSHNE****************WGHEKFEGFSWG**********SGRVALE************************************************************************************************
**STKIRLTFTSAASLSISLKAIFSRFLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQR**CTRGDGCK**************************************************************************************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSTKIRLTFTSAASLSISLKAIFSRFLPNNLNGAQILGRTIRVDHxxxxxxxxxxxxxxxxxxxxxRGVCRAFQRGECTRGDGCKFSHNEQRAANTGGGPQDRSSRWGHEKFEGFSWGKNDSSSRATGSGRVALEGNPNQSDRREEKRSIRHDHREKPREDHGRREDKRSRRHSDNNEFEARSREDHYRRDEKRPKRHESESYLREDQDRRGGDKSSTGRGDSSSHRHRER
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q9SD61352 Zinc finger CCCH domain-c yes no 0.370 0.244 0.712 1e-29
Q10B98312 Zinc finger CCCH domain-c yes no 0.840 0.625 0.403 4e-16
>sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 Back     alignment and function desciption
 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (82%), Gaps = 1/87 (1%)

Query: 27  FLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCK 86
              +NLNGA +LGRTI+VDH   YKK EEEDEETR++ RE RGVCRAFQRGECTRGD CK
Sbjct: 92  LAVDNLNGALVLGRTIKVDHCGAYKKHEEEDEETRRQNREARGVCRAFQRGECTRGDSCK 151

Query: 87  FSHNEQRAANTGGG-PQDRSSRWGHEK 112
           FSH+E+RAANTG G  +DRSS+W H+K
Sbjct: 152 FSHDEKRAANTGWGHEEDRSSKWDHDK 178





Arabidopsis thaliana (taxid: 3702)
>sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
224104290243 predicted protein [Populus trichocarpa] 0.612 0.584 0.642 3e-36
297819328316 hypothetical protein ARALYDRAFT_905943 [ 0.650 0.477 0.520 1e-30
297745915 375 unnamed protein product [Vitis vinifera] 0.806 0.498 0.497 6e-28
15232729 352 RNA-binding motif protein, X-linked 2 [A 0.370 0.244 0.712 7e-28
356551855 354 PREDICTED: zinc finger CCCH domain-conta 0.801 0.525 0.450 2e-27
225434618 429 PREDICTED: uncharacterized protein LOC10 0.784 0.424 0.492 2e-27
449460375 395 PREDICTED: zinc finger CCCH domain-conta 0.767 0.450 0.453 7e-27
357490653 393 RNA binding domain protein [Medicago tru 0.715 0.422 0.521 7e-26
147840589 737 hypothetical protein VITISV_032469 [Viti 0.784 0.246 0.465 4e-25
297793411173 hypothetical protein ARALYDRAFT_358097 [ 0.353 0.473 0.646 7e-24
>gi|224104290|ref|XP_002313385.1| predicted protein [Populus trichocarpa] gi|222849793|gb|EEE87340.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 110/151 (72%), Gaps = 9/151 (5%)

Query: 30  NNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSH 89
           +NLNGAQ+LGR IRVDHV KYKKKEEEDEET Q+ RE RGVC AFQRGEC RG GC+FSH
Sbjct: 95  DNLNGAQVLGRIIRVDHVTKYKKKEEEDEETAQQKREARGVCHAFQRGECNRGAGCRFSH 154

Query: 90  NEQRAANTGGGPQDRSSRWGHEKFEGFSWGKNDSSSRATGSGRVALEGNPNQSDRREEKR 149
           +EQRAANTG G QD+SSRWGHE F+G         S    S  +  E +P Q+DRREEKR
Sbjct: 155 DEQRAANTGWGAQDKSSRWGHEMFDG------PKKSEERSSYNMPSESHPKQNDRREEKR 208

Query: 150 SIRHDHRE---KPREDHGRREDKRSRRHSDN 177
           S  HD  E   KPRED+ RREDK+ RR  D+
Sbjct: 209 SRWHDDNEIVQKPREDYNRREDKKLRRLEDD 239




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297819328|ref|XP_002877547.1| hypothetical protein ARALYDRAFT_905943 [Arabidopsis lyrata subsp. lyrata] gi|297323385|gb|EFH53806.1| hypothetical protein ARALYDRAFT_905943 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297745915|emb|CBI15971.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15232729|ref|NP_190296.1| RNA-binding motif protein, X-linked 2 [Arabidopsis thaliana] gi|75337070|sp|Q9SD61.1|C3H42_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 42; Short=AtC3H42 gi|6522593|emb|CAB61958.1| putative RNA binding protein [Arabidopsis thaliana] gi|27311733|gb|AAO00832.1| putative RNA-binding protein [Arabidopsis thaliana] gi|34098859|gb|AAQ56812.1| At3g47120 [Arabidopsis thaliana] gi|332644724|gb|AEE78245.1| RNA-binding motif protein, X-linked 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356551855|ref|XP_003544288.1| PREDICTED: zinc finger CCCH domain-containing protein 42-like [Glycine max] Back     alignment and taxonomy information
>gi|225434618|ref|XP_002279321.1| PREDICTED: uncharacterized protein LOC100246760 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449460375|ref|XP_004147921.1| PREDICTED: zinc finger CCCH domain-containing protein 25-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357490653|ref|XP_003615614.1| RNA binding domain protein [Medicago truncatula] gi|355516949|gb|AES98572.1| RNA binding domain protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147840589|emb|CAN72715.1| hypothetical protein VITISV_032469 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297793411|ref|XP_002864590.1| hypothetical protein ARALYDRAFT_358097 [Arabidopsis lyrata subsp. lyrata] gi|297310425|gb|EFH40849.1| hypothetical protein ARALYDRAFT_358097 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2075676352 AT3G47120 [Arabidopsis thalian 0.840 0.553 0.381 3.3e-24
MGI|MGI:1919414326 Rbmx2 "RNA binding motif prote 0.517 0.368 0.298 4.9e-10
UNIPROTKB|G5E5I0338 RBMX2 "Uncharacterized protein 0.418 0.286 0.297 3.8e-08
DICTYBASE|DDB_G0288797560 fip1l1 "cleavage and polyadeny 0.5 0.207 0.330 5.1e-08
WB|WBGene00018926419 F56A11.6 [Caenorhabditis elega 0.612 0.338 0.304 8.5e-08
UNIPROTKB|F1LMQ9327 Rbmx2 "RNA-binding motif prote 0.586 0.415 0.262 1.5e-07
RGD|1562693328 Rbmx2 "RNA binding motif prote 0.586 0.414 0.262 1.5e-07
UNIPROTKB|G4NKC1330 MGG_03086 "U2 snRNP component 0.366 0.257 0.344 7.6e-07
ZFIN|ZDB-GENE-030131-1495 635 zrsr2 "zinc finger (CCCH type) 0.646 0.236 0.294 1e-06
UNIPROTKB|E1C591747 PPIG "Uncharacterized protein" 0.633 0.196 0.306 1.3e-06
TAIR|locus:2075676 AT3G47120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 3.3e-24, P = 3.3e-24
 Identities = 84/220 (38%), Positives = 106/220 (48%)

Query:    30 NNLNGAQILGRTIRVDHVAXXXXXXXXXXXXXXXXXXXXGVCRAFQRGECTRGDGCKFSH 89
             +NLNGA +LGRTI+VDH                      GVCRAFQRGECTRGD CKFSH
Sbjct:    95 DNLNGALVLGRTIKVDHCGAYKKHEEEDEETRRQNREARGVCRAFQRGECTRGDSCKFSH 154

Query:    90 NEQRAANTGGG-PQDRSSRWGHEKF-EG------FSWG---KNDSSSRATGSGRVALEGN 138
             +E+RAANTG G  +DRSS+W H+K  EG      F  G   + DS   +    R A  G 
Sbjct:   155 DEKRAANTGWGHEEDRSSKWDHDKNREGRGVCRAFQRGECTRGDSCKFSHDEKRAATTGW 214

Query:   139 PNQSDRREEKRSIRHDHREKPREDHGRREDKRSRRHSDNNEFEARSREDHYRRDEKRPKR 198
              ++ DR  +    + +  +K     G R D +     D  E   R R D       RPK 
Sbjct:   215 GHEEDRSSKWDQDKLNGAKKGGTSFGNRGDFKP----DVEEKSYRGRGDG-DASYGRPK- 268

Query:   199 HESESYLREDQDRRGGD------KSSTGRGDSS-SHRHRE 231
              E E   RED   R  D      +  +GR D++ S RH +
Sbjct:   269 -ERERVDREDMGPRSRDAYDMKEQKRSGRYDNAYSRRHND 307


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
MGI|MGI:1919414 Rbmx2 "RNA binding motif protein, X-linked 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5I0 RBMX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288797 fip1l1 "cleavage and polyadenylation specificity factor FIP1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00018926 F56A11.6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMQ9 Rbmx2 "RNA-binding motif protein, X-linked 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1562693 Rbmx2 "RNA binding motif protein, X-linked 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G4NKC1 MGG_03086 "U2 snRNP component IST3" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1495 zrsr2 "zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C591 PPIG "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 2e-06
PRK12678 672 PRK12678, PRK12678, transcription termination fact 2e-04
smart0035627 smart00356, ZnF_C3H1, zinc finger 3e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 0.001
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.001
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.002
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 0.003
PRK12678 672 PRK12678, PRK12678, transcription termination fact 0.004
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
 Score = 44.2 bits (105), Expect = 2e-06
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 31 NLNGAQILGRTIRVDHVAKY 50
          NLNG ++LGRTIRVDHV  Y
Sbjct: 70 NLNGIKLLGRTIRVDHVRNY 89


This subfamily corresponds to the RRM of the ist3 family that includes fungal U2 small nuclear ribonucleoprotein (snRNP) component increased sodium tolerance protein 3 (ist3), X-linked 2 RNA-binding motif proteins (RBMX2) found in Metazoa and plants, and similar proteins. Gene IST3 encoding ist3, also termed U2 snRNP protein SNU17 (Snu17p), is a novel yeast Saccharomyces cerevisiae protein required for the first catalytic step of splicing and for progression of spliceosome assembly. It binds specifically to the U2 snRNP and is an intrinsic component of prespliceosomes and spliceosomes. Yeast ist3 contains an atypical RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). In the yeast pre-mRNA retention and splicing complex, the atypical RRM of ist3 functions as a scaffold that organizes the other two constituents, Bud13p (bud site selection 13) and Pml1p (pre-mRNA leakage 1). Fission yeast Schizosaccharomyces pombe gene cwf29 encoding ist3, also termed cell cycle control protein cwf29, is an RNA-binding protein complexed with cdc5 protein 29. It also contains one RRM. The biological function of RBMX2 remains unclear. It shows high sequence similarity to yeast ist3 protein and harbors one RRM as well. . Length = 89

>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.82
KOG2494 331 consensus C3H1-type Zn-finger protein [Transcripti 95.15
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 94.81
smart0035627 ZnF_C3H1 zinc finger. 94.66
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 93.72
KOG1763343 consensus Uncharacterized conserved protein, conta 88.52
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 86.38
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 84.22
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 82.57
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
Probab=99.82  E-value=4.8e-21  Score=167.20  Aligned_cols=87  Identities=32%  Similarity=0.453  Sum_probs=73.9

Q ss_pred             ecceeeeeeeecCCCceecCceeEecccccccccccccHHHHHHHHHhhhhhHhhhcCCCCCCCCCcccccccccCCCCC
Q 026836           20 LKAIFSRFLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSHNEQRAANTGG   99 (232)
Q Consensus        20 ~~~~StiLAVDNlNG~~v~GR~irVDHv~~Yk~~~~edee~~~~~~e~~~v~~alq~~~C~~~~~ck~sh~~q~~~~t~~   99 (232)
                      -.|+||||||||||||+|+|||||||||.+|++|.+..+        ++.|+..||+++|.+..+-.+.++++.++++.|
T Consensus        85 EDQRSTILAVDN~NGiki~gRtirVDHv~~Yk~pk~~E~--------~d~~t~~L~~~g~~~~~~~~~~~~~~~~~~~k~  156 (219)
T KOG0126|consen   85 EDQRSTILAVDNLNGIKILGRTIRVDHVSNYKKPKESEE--------MDAVTKELQEEGCSPKNQSIIAQPEKPSPRYKT  156 (219)
T ss_pred             cCccceEEEEeccCCceecceeEEeeecccccCCchhhh--------hhHHHHHHhhccCCCCchhhhccccCCCccccc
Confidence            369999999999999999999999999999999966555        788999999999999999889999999999999


Q ss_pred             CC--CCCCccccccccc
Q 026836          100 GP--QDRSSRWGHEKFE  114 (232)
Q Consensus       100 ~s--ed~~~~~~~~k~~  114 (232)
                      +-  +++.+.+.+.+..
T Consensus       157 ~~e~~~~~~~K~~~~~~  173 (219)
T KOG0126|consen  157 VKEKEDRGSKKHSKKNK  173 (219)
T ss_pred             eeecccccchhhhhhhH
Confidence            95  4555444444333



>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2rhk_C72 Cleavage and polyadenylation specificity factor su 5e-05
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 2e-04
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 3e-04
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 6e-04
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
 Score = 39.4 bits (92), Expect = 5e-05
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 57 DEETRQRMREERGVCRAFQRGECTRGDGCKFSHN 90
                   E+  VC+ + RG C +GD C+F H 
Sbjct: 5  HHHHSHMSGEKTVVCKHWLRGLCKKGDQCEFLHE 38


>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 95.63
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 95.56
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 95.46
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 93.54
2rhk_C72 Cleavage and polyadenylation specificity factor su 93.38
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 92.83
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 88.74
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 88.65
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 88.28
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 88.23
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 86.62
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 85.42
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 85.38
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 85.02
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 84.47
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 84.23
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 84.01
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 83.01
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 82.08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 81.85
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 81.73
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 81.63
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 81.26
3p5t_L90 Cleavage and polyadenylation specificity factor S; 81.19
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 80.86
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 80.66
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 80.47
1x5p_A97 Negative elongation factor E; structure genomics, 80.04
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
Probab=95.63  E-value=0.0035  Score=47.50  Aligned_cols=27  Identities=52%  Similarity=1.084  Sum_probs=23.9

Q ss_pred             hhhhhHhhhcCCCCCCC-CCcccccccc
Q 026836           67 ERGVCRAFQRGECTRGD-GCKFSHNEQR   93 (232)
Q Consensus        67 ~~~v~~alq~~~C~~~~-~ck~sh~~q~   93 (232)
                      .-.||+.||+|.|.+++ .|+|+|+...
T Consensus        16 ~~~VCrdFlrG~C~r~d~~CrfsH~~~~   43 (89)
T 2rpp_A           16 TLEVCRQFQRGTCSRSDEECKFAHPPKS   43 (89)
T ss_dssp             EECBCHHHHHTCCCCCTTTSSSBCCCSS
T ss_pred             hhhhchHHhcCCCCCCCCCCCCcCCCcc
Confidence            35699999999999998 9999998765



>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 91.83
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 89.67
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 89.16
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 88.74
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 88.6
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 86.84
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 86.21
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 86.06
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 85.39
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 84.9
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 84.89
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 84.74
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 83.98
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 83.93
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 83.67
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 83.54
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 83.48
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 82.88
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 82.74
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 82.57
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 82.54
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 82.03
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 81.85
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 81.8
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 81.47
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 81.07
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 80.77
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 80.44
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 80.19
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 80.11
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 80.05
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Splicing factor U2AF 65 KDa subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=91.83  E-value=0.02  Score=38.99  Aligned_cols=28  Identities=11%  Similarity=0.279  Sum_probs=23.6

Q ss_pred             eeeeecCCCceecCceeEecccccccccc
Q 026836           26 RFLPNNLNGAQILGRTIRVDHVAKYKKKE   54 (232)
Q Consensus        26 iLAVDNlNG~~v~GR~irVDHv~~Yk~~~   54 (232)
                      ..|+ +|||..|.|+.|+|.+...|.++.
T Consensus        62 ~~a~-~l~g~~~~Gr~l~V~r~k~~~p~p   89 (90)
T d1u2fa_          62 TQAM-AFDGIIFQGQSLKIRRPHDYQPLP   89 (90)
T ss_dssp             TTGG-GGSSCCSSSSCCCCBCTTCCSCCC
T ss_pred             HHHH-hhCCcEECCEEEEECCCCCCCCcc
Confidence            3456 699999999999999998888763



>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure