Citrus Sinensis ID: 026956

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
cccHHHHHHHHHHHcccccHHHHHHHHHHcHHHHccccccccccccEEEEEEEEEcccccccccEEEEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccccEEEccccccccccEEEEcccccccEEEEccHHHHHHHHHHcccEEccccccccccccccccHHHHHHHccccHHHcccccccccccccccccccccHHHHHHHHcHHccccc
cHHHHHHHHHHHHHHcccHHHHcHHHHccccccccccccccccccccEEEEEEEEcccccccccccEEEEEcccccHHHHHHHHHHHHHcccccccccccccccccccEEEEccEEEEHHHcccccccccEEEccccccHHHHHccHcHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccHHHEEEEcccccccccccccccccHHHHHHHHHHHHHHccc
MATGLIRRAISSSAAVAQPARLLTARFHASEaeaqkvepkasantdtkkfqiyrwnpdspskpelKEFEINLKECGPMVLDALIKIkseidpsltfrrscregicgscamnidgcnglacltkispsgsastitplphMFVIKDLVVDMTNFYNqyksiepwlkrknpppmpgkeipqskkdrakldgmyecilcaccstscpsywwtseaylgpAALLHANSIGLSNLL
MATGLIRraisssaavaqPARLLTARFHASEaeaqkvepkasantdtkkfqiyrwnpdspskPELKEFEINLKECGPMVLDALIKIKseidpsltfrrSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYksiepwlkrknpppmpgKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
MATGLirraisssaaVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
**************************************************QIYRW***********EFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWL**********************LDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSI******
*************************************************FQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKR**************KKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
MATGLIRRAISSSAAVAQPARLLTARFHAS***************DTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
**********SSSAAVAQ*ARLL********************NTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKN*******EIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSNLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
Q8LB02280 Succinate dehydrogenase [ yes no 0.965 0.792 0.739 2e-96
Q8LBZ7279 Succinate dehydrogenase [ no no 0.965 0.795 0.736 5e-95
P21914297 Succinate dehydrogenase [ yes no 0.813 0.629 0.633 2e-69
Q70KF8283 Succinate dehydrogenase [ N/A no 0.782 0.636 0.684 4e-69
O42772297 Succinate dehydrogenase [ N/A no 0.795 0.616 0.645 8e-69
P21911275 Succinate dehydrogenase [ yes no 0.847 0.709 0.621 3e-68
Q9YHT2290 Succinate dehydrogenase [ yes no 0.882 0.7 0.587 6e-68
Q9FJP9309 Succinate dehydrogenase [ no no 0.795 0.592 0.658 8e-68
Q6FWS8253 Succinate dehydrogenase [ no no 0.752 0.683 0.676 2e-67
A5PL98280 Succinate dehydrogenase [ yes no 0.756 0.621 0.670 4e-67
>sp|Q8LB02|DHSB2_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial OS=Arabidopsis thaliana GN=SDH2-2 PE=1 SV=2 Back     alignment and function desciption
 Score =  352 bits (902), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 165/223 (73%), Positives = 187/223 (83%), Gaps = 1/223 (0%)

Query: 1   MATGLIRRAISS-SAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDS 59
           MA GLI R + + S+ ++  ARL+ AR+ ++ +EAQ            K FQIYRWNPD+
Sbjct: 1   MAFGLIGRVVGTKSSRLSTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN 60

Query: 60  PSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLA 119
           P KPEL++++I+LK+CGPMVLDALIKIK+E+DPSLTFRRSCREGICGSCAMNIDGCNGLA
Sbjct: 61  PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA 120

Query: 120 CLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQS 179
           CLTKI      +TITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKEI QS
Sbjct: 121 CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS 180

Query: 180 KKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHAN 222
           KKDRAKLDGMYECILCACCSTSCPSYWW  E+YLGPAALLHAN
Sbjct: 181 KKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHAN 223
Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 1
>sp|Q8LBZ7|DHSB1_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial OS=Arabidopsis thaliana GN=SDH2-1 PE=1 SV=2 Back     alignment and function description
>sp|P21914|DHSB_DROME Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Drosophila melanogaster GN=SdhB PE=2 SV=2 Back     alignment and function description
>sp|Q70KF8|DHSB_UROFA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Uromyces fabae GN=SDH2 PE=3 SV=1 Back     alignment and function description
>sp|O42772|DHSB_MYCGR Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Mycosphaerella graminicola GN=SDH2 PE=3 SV=1 Back     alignment and function description
>sp|P21911|DHSB_SCHPO Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sdh2 PE=3 SV=3 Back     alignment and function description
>sp|Q9YHT2|DHSB_CHICK Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Gallus gallus GN=SDHB PE=1 SV=1 Back     alignment and function description
>sp|Q9FJP9|DHSB3_ARATH Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial OS=Arabidopsis thaliana GN=SDH2-3 PE=2 SV=1 Back     alignment and function description
>sp|Q6FWS8|DHSB_CANGA Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SDH2 PE=3 SV=1 Back     alignment and function description
>sp|A5PL98|DHSB_DANRE Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Danio rerio GN=sdhb PE=2 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:2168818280 SDH2-2 "succinate dehydrogenas 0.965 0.792 0.726 5.3e-88
TAIR|locus:2086716279 SDH2-1 "succinate dehydrogenas 0.965 0.795 0.727 1.8e-87
FB|FBgn0014028297 SdhB "Succinate dehydrogenase 0.813 0.629 0.633 7.4e-66
POMBASE|SPAC140.01275 sdh2 "succinate dehydrogenase 0.843 0.705 0.625 2e-65
TAIR|locus:504954878309 SDH2-3 "succinate dehydrogenas 0.752 0.559 0.693 5.2e-65
UNIPROTKB|Q3B8J8282 sdhb "Succinate dehydrogenase 0.882 0.719 0.585 1.2e-63
UNIPROTKB|F1NNF7290 SDHB "Succinate dehydrogenase 0.882 0.7 0.587 1.6e-63
UNIPROTKB|Q9YHT2290 SDHB "Succinate dehydrogenase 0.786 0.624 0.644 2.6e-63
ZFIN|ZDB-GENE-030131-8005280 sdhb "succinate dehydrogenase 0.860 0.707 0.610 2.6e-63
UNIPROTKB|B0BM36284 sdhb "Succinate dehydrogenase 0.813 0.658 0.633 8.8e-63
TAIR|locus:2168818 SDH2-2 "succinate dehydrogenase 2-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 879 (314.5 bits), Expect = 5.3e-88, P = 5.3e-88
 Identities = 162/223 (72%), Positives = 181/223 (81%)

Query:     1 MATGLXXXXXXXXXX-VAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDS 59
             MA GL           ++  ARL+ AR+ ++ +EAQ            K FQIYRWNPD+
Sbjct:     1 MAFGLIGRVVGTKSSRLSTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN 60

Query:    60 PSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLA 119
             P KPEL++++I+LK+CGPMVLDALIKIK+E+DPSLTFRRSCREGICGSCAMNIDGCNGLA
Sbjct:    61 PGKPELQDYKIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA 120

Query:   120 CLTKISPSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQS 179
             CLTKI      +TITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNP  +PGKEI QS
Sbjct:   121 CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS 180

Query:   180 KKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHAN 222
             KKDRAKLDGMYECILCACCSTSCPSYWW  E+YLGPAALLHAN
Sbjct:   181 KKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHAN 223
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006099 "tricarboxylic acid cycle" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000104 "succinate dehydrogenase activity" evidence=ISS
GO:0006121 "mitochondrial electron transport, succinate to ubiquinone" evidence=ISS
GO:0045281 "succinate dehydrogenase complex" evidence=ISS
GO:0005749 "mitochondrial respiratory chain complex II" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
TAIR|locus:2086716 SDH2-1 "succinate dehydrogenase 2-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0014028 SdhB "Succinate dehydrogenase B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPAC140.01 sdh2 "succinate dehydrogenase (ubiquinone) iron-sulfur protein subunit (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:504954878 SDH2-3 "succinate dehydrogenase 2-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B8J8 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNF7 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YHT2 SDHB "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8005 sdhb "succinate dehydrogenase complex, subunit B, iron sulfur (Ip)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B0BM36 sdhb "Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P21801DHSB_YEAST1, ., 3, ., 5, ., 10.65900.75210.6503yesno
Q8LB02DHSB2_ARATH1, ., 3, ., 5, ., 10.73990.96520.7928yesno
Q9CQA3DHSB_MOUSE1, ., 3, ., 5, ., 10.64770.75650.6170yesno
Q1RGP3DHSB_RICBR1, ., 3, ., 9, 9, ., 10.62160.79560.7011yesno
Q55CC2DHSB_DICDI1, ., 3, ., 5, ., 10.51520.95650.7665yesno
Q68XS0DHSB_RICTY1, ., 3, ., 9, 9, ., 10.57630.84340.7432yesno
Q3T189DHSB_BOVIN1, ., 3, ., 5, ., 10.58930.86520.7107yesno
A5PL98DHSB_DANRE1, ., 3, ., 5, ., 10.67040.75650.6214yesno
Q007T0DHSB_PIG1, ., 3, ., 5, ., 10.64770.75650.6214yesno
Q59662DHSB_PARDE1, ., 3, ., 9, 9, ., 10.57290.82600.7335yesno
P21911DHSB_SCHPO1, ., 3, ., 5, ., 10.62180.84780.7090yesno
P21913DHSB_RAT1, ., 3, ., 5, ., 10.64200.75650.6170yesno
P21912DHSB_HUMAN1, ., 3, ., 5, ., 10.63630.75650.6214yesno
P21914DHSB_DROME1, ., 3, ., 5, ., 10.63350.81300.6296yesno
Q92JJ8DHSB_RICCN1, ., 3, ., 9, 9, ., 10.64360.75210.6628yesno
Q4UN71DHSB_RICFE1, ., 3, ., 9, 9, ., 10.63790.75210.6628yesno
Q75CI4DHSB_ASHGO1, ., 3, ., 5, ., 10.65920.76520.6743yesno
Q8ZQU2DHSB_SALTY1, ., 3, ., 9, 9, ., 10.53100.74340.7184yesno
B0BM36DHSB_XENTR1, ., 3, ., 5, ., 10.65340.75650.6126yesno
Q9YHT2DHSB_CHICK1, ., 3, ., 5, ., 10.58760.88260.7yesno
Q9ZEA1DHSB_RICPR1, ., 3, ., 9, 9, ., 10.64360.75210.6628yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.5.10.946
3rd Layer1.3.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00020593001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (276 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00024946001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (528 aa)
• ••••• 0.998
GSVIVG00028552001
SubName- Full=Putative uncharacterized protein (Chromosome chr7 scaffold_44, whole genome shotg [...] (423 aa)
•  • •• 0.997
GSVIVG00031891001
SubName- Full=Chromosome undetermined scaffold_60, whole genome shotgun sequence; (329 aa)
•  • •• 0.990
GSVIVG00037069001
SubName- Full=Chromosome chr17 scaffold_85, whole genome shotgun sequence; (336 aa)
•  • •• 0.990
GSVIVG00028048001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (470 aa)
•  • •• 0.983
GSVIVG00018534001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (973 aa)
•  •  • 0.947
GSVIVG00018944001
RecName- Full=Citrate synthase; (466 aa)
•  •  • 0.913
GSVIVG00015101001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (525 aa)
     •• 0.832
GSVIVG00002101001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (493 aa)
     •  0.813
GSVIVG00002099001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (493 aa)
     •  0.812

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 1e-138
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 1e-109
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 4e-78
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumar 8e-74
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-s 3e-67
pfam13085107 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind 2e-48
PRK12577 329 PRK12577, PRK12577, succinate dehydrogenase iron-s 2e-40
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-s 1e-35
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur 2e-32
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumara 1e-29
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur sub 2e-29
PRK12386251 PRK12386, PRK12386, fumarate reductase iron-sulfur 6e-17
PRK08640249 PRK08640, sdhB, succinate dehydrogenase iron-sulfu 8e-14
PRK07570250 PRK07570, PRK07570, succinate dehydrogenase/fumara 1e-04
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information 
 Score =  387 bits (995), Expect = e-138
 Identities = 150/223 (67%), Positives = 169/223 (75%), Gaps = 5/223 (2%)

Query: 1   MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSP 60
           MA GL+RR   + A +  PA    A   A+ +   K   K S  ++ K+FQIYRWNPD+P
Sbjct: 1   MAAGLLRRLAGAKAGLLAPA----AAASAAASAETKASSKGSKPSNLKEFQIYRWNPDNP 56

Query: 61  SKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLAC 120
            KP L+ ++++L +CGPMVLD LIKIK+E DPSLTFRRSCREGICGSCAMNIDG N LAC
Sbjct: 57  GKPHLQSYKVDLNDCGPMVLDVLIKIKNEQDPSLTFRRSCREGICGSCAMNIDGKNTLAC 116

Query: 121 LTKISP-SGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQS 179
           LTKI       +TITPLPHMFVIKDLVVDMTNFY QYKSIEPWLK K PP    KE  QS
Sbjct: 117 LTKIDRDESGPTTITPLPHMFVIKDLVVDMTNFYQQYKSIEPWLKTKKPPEDGQKEHLQS 176

Query: 180 KKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHAN 222
           K+DRAKLDGMYECILCACCSTSCPSYWW  E +LGPAALLHA 
Sbjct: 177 KEDRAKLDGMYECILCACCSTSCPSYWWNPEKFLGPAALLHAY 219

Length = 276
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|237086 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181038 PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 100.0
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 100.0
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 100.0
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
KOG3049288 consensus Succinate dehydrogenase, Fe-S protein su 100.0
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 100.0
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 100.0
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 100.0
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 100.0
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 99.57
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 99.52
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 99.51
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 99.49
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 99.42
PRK09800 956 putative hypoxanthine oxidase; Provisional 99.13
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 99.13
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 99.13
PRK08493 819 NADH dehydrogenase subunit G; Validated 99.12
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 99.09
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 98.89
PLN00192 1344 aldehyde oxidase 98.88
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 98.85
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 98.84
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 98.82
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 98.72
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 98.69
PRK07860 797 NADH dehydrogenase subunit G; Validated 98.65
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 98.64
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 98.6
PRK09129 776 NADH dehydrogenase subunit G; Validated 98.59
PLN02906 1319 xanthine dehydrogenase 98.54
PRK09130 687 NADH dehydrogenase subunit G; Validated 98.5
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 98.47
PRK08166 847 NADH dehydrogenase subunit G; Validated 98.29
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.27
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 98.22
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 98.19
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 98.14
CHL0013499 petF ferredoxin; Validated 98.13
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 98.05
COG4630 493 XdhA Xanthine dehydrogenase, iron-sulfur cluster a 98.02
PLN02593117 adrenodoxin-like ferredoxin protein 97.94
KOG0430 1257 consensus Xanthine dehydrogenase [Nucleotide trans 97.92
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 97.87
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 97.83
PLN03136148 Ferredoxin; Provisional 97.8
PTZ00038191 ferredoxin; Provisional 97.79
PRK05713 312 hypothetical protein; Provisional 97.69
COG0633102 Fdx Ferredoxin [Energy production and conversion] 97.64
PTZ00490143 Ferredoxin superfamily; Provisional 97.57
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 97.56
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 97.5
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 97.28
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 97.14
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 96.65
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.33
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 96.28
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 95.96
KOG2282 708 consensus NADH-ubiquinone oxidoreductase, NDUFS1/7 95.5
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 95.37
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 95.33
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 95.25
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 95.21
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 95.04
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 94.7
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 94.65
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron 94.28
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 94.1
COG1139 459 Uncharacterized conserved protein containing a fer 93.77
PRK05802320 hypothetical protein; Provisional 93.24
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 92.74
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 92.73
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 92.73
COG1150 195 HdrC Heterodisulfide reductase, subunit C [Energy 92.03
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 91.86
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 91.74
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electro 91.18
PF1374669 Fer4_18: 4Fe-4S dicluster domain 90.68
PRK08345289 cytochrome-c3 hydrogenase subunit gamma; Provision 90.55
COG3894 614 Uncharacterized metal-binding protein [General fun 90.45
PF1041840 DHODB_Fe-S_bind: Iron-sulfur cluster binding domai 90.37
PRK0836470 sulfur carrier protein ThiS; Provisional 89.85
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 89.65
COG114599 NapF Ferredoxin [Energy production and conversion] 89.64
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 89.35
PLN0007181 photosystem I subunit VII; Provisional 89.27
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 88.91
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 88.44
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Review 88.43
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 88.36
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 87.94
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 87.76
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 87.35
KOG3256212 consensus NADH:ubiquinone oxidoreductase, NDUFS8/2 86.73
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 86.59
PF1345965 Fer4_15: 4Fe-4S single cluster domain 86.3
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 85.84
COG114668 Ferredoxin [Energy production and conversion] 85.77
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 85.29
CHL0006581 psaC photosystem I subunit VII 84.64
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 84.17
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 83.98
PRK0265181 photosystem I subunit VII; Provisional 83.24
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 82.54
PRK0265181 photosystem I subunit VII; Provisional 81.94
PF1337058 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 81.84
CHL00014167 ndhI NADH dehydrogenase subunit I 81.27
CHL0006581 psaC photosystem I subunit VII 81.14
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 80.9
PRK10194163 ferredoxin-type protein; Provisional 80.87
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information 
Probab=100.00  E-value=8.8e-64  Score=450.19  Aligned_cols=224  Identities=67%  Similarity=1.154  Sum_probs=192.7

Q ss_pred             ChhhhHHhhhhccccccccchhhhhhhhhhhhhhhccCCccCCCCceEEEEEEeeCCCCCCCCceEEEEEeecCCChhHH
Q 026956            1 MATGLIRRAISSSAAVAQPARLLTARFHASEAEAQKVEPKASANTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVL   80 (230)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~lkI~Rfdp~~d~~~~~~~y~v~v~~~~~TvL   80 (230)
                      ||.||+||....-|..-.||.-..|   +..| ..++..+.+++.++++|+|+||||+++.+||||+|+|++.++++|||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~-~~~~~~~~~~~~~~~~~~i~R~~p~~~~~~~~~~y~v~~~~~~~tVL   76 (276)
T PLN00129          1 MAAGLLRRLAGAKAGLLAPAAAASA---AASA-ETKASSKGSKPSNLKEFQIYRWNPDNPGKPHLQSYKVDLNDCGPMVL   76 (276)
T ss_pred             Cchhhhhhhhcccccccccchhhhh---hhcc-cccccCCCCCCCceEEEEEEeeCCCCCCCceeEEEEeCCCCCCchHH
Confidence            8999999987666655555532221   1111 13445566677789999999999999889999999999874379999


Q ss_pred             HHHHHhhhccCCCcccccCcCCCccCcceEEeCCeeeccccccccCCC-CceEEeeCCCCcceeeeeechhhHHHHhhhc
Q 026956           81 DALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKISPSG-SASTITPLPHMFVIKDLVVDMTNFYNQYKSI  159 (230)
Q Consensus        81 daL~~i~~~~d~~l~fr~gCr~GiCGsCaV~ING~~~LAC~t~v~~~~-~~itIEPL~~~pvirDLvVD~~~f~~k~k~v  159 (230)
                      |+|++|++++||+|+||++||+|+||||+|+|||+|+|||.|++.+.+ ++||||||++||||||||||++.||++|+++
T Consensus        77 d~L~~Ik~~~D~sLsfr~sCr~giCGsCam~ING~p~LAC~t~v~~~~~~~i~iePl~~fpVirDLvVD~~~f~~klk~v  156 (276)
T PLN00129         77 DVLIKIKNEQDPSLTFRRSCREGICGSCAMNIDGKNTLACLTKIDRDESGPTTITPLPHMFVIKDLVVDMTNFYQQYKSI  156 (276)
T ss_pred             HHHHHHHHcCCCCeEEeccCCCCCCCCCeeEECCcccccccccHhhcCCCcEEEEECCCCCeeeecccccHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999998754 6899999999999999999999999999999


Q ss_pred             ccccccCCCCCCCCCCCCCCHHHHHHHhcHHHhhhhchhhhcccCcccCCCCCcCHHHHHHHHHhcccc
Q 026956          160 EPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSN  228 (230)
Q Consensus       160 kp~l~~~~~~~~~~~e~~~~pe~~~~~~~~~~CI~CG~C~saCP~~~~~~~~FlGPaal~~a~R~~~~~  228 (230)
                      +||++++..+.....+.+|+|+++++++.+..||+||+|+++||+++.++++|+||++++++|||+.|+
T Consensus       157 ~p~l~~~~~~~~~~~~~~q~pe~~~~~~~~~~CI~CG~C~saCPv~~~~~~~flGP~~l~~a~R~~~D~  225 (276)
T PLN00129        157 EPWLKTKKPPEDGQKEHLQSKEDRAKLDGMYECILCACCSTSCPSYWWNPEKFLGPAALLHAYRWISDS  225 (276)
T ss_pred             cccccCCCCCCCCccccCCCHHHHHHHhhhhhCccccccccccCCCcccCcccccHHHHHHHHHhcCCc
Confidence            999997654432234799999999999999999999999999999977767799999999999998874

>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG3049 consensus Succinate dehydrogenase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>COG4630 XdhA Xanthine dehydrogenase, iron-sulfur cluster and FAD-binding subunit A [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>KOG0430 consensus Xanthine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>KOG2282 consensus NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PF10418 DHODB_Fe-S_bind: Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B; InterPro: IPR019480 Lactococcus lactis is one of the few organisms with two dihydroorotate dehydrogenases (DHODs) A and B [] Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>KOG3256 consensus NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>PF13459 Fer4_15: 4Fe-4S single cluster domain Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
1yq3_B252 Avian Respiratory Complex Ii With Oxaloacetate And 7e-68
3abv_B252 Crystal Structure Of Porcine Heart Mitochondrial Co 7e-65
1zoy_B252 Crystal Structure Of Mitochondrial Respiratory Comp 9e-65
3vr8_B282 Mitochondrial Rhodoquinol-Fumarate Reductase From T 4e-63
1nek_B238 Complex Ii (Succinate Dehydrogenase) From E. Coli W 6e-48
2wp9_B238 Crystal Structure Of The E. Coli Succinate:quinone 6e-48
1kf6_B243 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 2e-20
1qlb_B239 Respiratory Complex Ii-Like Fumarate Reductase From 3e-17
2bs2_B241 Quinol:fumarate Reductase From Wolinella Succinogen 3e-17
>pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 Back     alignment and structure 
Iteration: 1

 Score =  253 bits (646), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 144/183 (78%), Gaps = 2/183 (1%)
Query: 41  ASANTDTKKFQIYRWNPDSP-SKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRS 99
           A+A +  KKF IYRW+PD P  KP ++ +E++L +CGPMVLDALIKIK+E+D +LTFRRS
Sbjct: 5   AAATSRIKKFSIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLDALIKIKNELDSTLTFRRS 64
Query: 100 CREGICGSCAMNIDGCNGLACLTKISPSGSAST-ITPLPHMFVIKDLVVDMTNFYNQYKS 158
           CREGICGSCAMNI G N LAC  KI P  S +T I PLPHM+V+KDLV D++NFY QYKS
Sbjct: 65  CREGICGSCAMNIAGGNTLACTKKIDPDLSKTTKIYPLPHMYVVKDLVPDLSNFYAQYKS 124
Query: 159 IEPWLKRKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAAL 218
           IEP+LK+K+      ++  QS +DR KLDG+YECILCACCSTSCPSYWW  + YLGPA L
Sbjct: 125 IEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVL 184
Query: 219 LHA 221
           + A
Sbjct: 185 MQA 187
>pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 Back     alignment and structure
>pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 Back     alignment and structure
>pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 Back     alignment and structure
>pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 Back     alignment and structure
>pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 Back     alignment and structure
>pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 Back     alignment and structure
>pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 Back     alignment and structure
>pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 1e-108
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 1e-108
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 1e-106
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 1e-101
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 5e-99
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 1e-41
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
 Score =  309 bits (795), Expect = e-108
 Identities = 94/177 (53%), Positives = 122/177 (68%), Gaps = 6/177 (3%)

Query: 49  KFQIYRWNPDSPSKPELKEFEINLKECGPM-VLDALIKIKSEIDPSLTFRRSCREGICGS 107
           +F IYR+NPD    P ++++ +   E   M +LDALI++K E DPSL+FRRSCREG+CGS
Sbjct: 4   EFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLK-EKDPSLSFRRSCREGVCGS 62

Query: 108 CAMNIDGCNGLACLTKIS---PSGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLK 164
             +N++G NGLAC+T IS     G    I PLP + VI+DLVVDM  FY QY+ I+P+L 
Sbjct: 63  DGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLL 122

Query: 165 RKNPPPMPGKEIPQSKKDRAKLDGMYECILCACCSTSCPSYWWTSEAYLGPAALLHA 221
                P P +E  Q  + R KLDG+YECILCACCSTSCPS+WW  + ++GPA LL A
Sbjct: 123 NNGQNP-PAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAA 178
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 100.0
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 100.0
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 100.0
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 100.0
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 100.0
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 100.0
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 99.84
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 99.78
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 99.65
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 99.62
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 99.61
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 99.46
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 99.43
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 99.4
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 99.36
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 99.09
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 98.99
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 98.9
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 98.77
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 98.75
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 98.73
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 98.72
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 98.72
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 98.7
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 98.64
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 98.55
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 98.43
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 98.35
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 98.3
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 98.22
1krh_A 338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 98.18
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 98.1
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 98.09
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 98.07
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 98.01
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 97.98
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 97.97
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 97.97
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 97.96
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 97.94
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 97.79
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 97.33
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 97.12
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 94.78
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 90.67
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 88.77
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 87.49
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 87.34
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 87.27
1dax_A64 Ferredoxin I; electron transport, electron-transfe 87.19
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); het 86.85
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 86.63
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 86.61
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 86.53
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 86.5
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 86.13
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 85.79
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 85.4
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 84.8
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 84.77
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 84.76
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 84.59
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 84.49
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 84.37
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 84.12
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 84.05
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 83.28
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 83.0
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 82.45
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 81.3
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
Probab=100.00  E-value=3e-57  Score=407.57  Aligned_cols=198  Identities=56%  Similarity=1.060  Sum_probs=177.2

Q ss_pred             hhhhhccCCccCCCCceEEEEEEeeCCCC-CCCCceEEEEEeecCCChhHHHHHHHhhhccCCCcccccCcCCCccCcce
Q 026956           31 EAEAQKVEPKASANTDTKKFQIYRWNPDS-PSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCA  109 (230)
Q Consensus        31 ~~~~~~~~~~~~~~~~~v~lkI~Rfdp~~-d~~~~~~~y~v~v~~~~~TvLdaL~~i~~~~d~~l~fr~gCr~GiCGsCa  109 (230)
                      -+++...++.+....++++|+||||||+. +++|||++|+|++++.++||||+|++|+.+++|+|+|++||++|+||+|+
T Consensus        19 ~~~~~~~~~~~~~~~~~~~~~I~R~~p~~~~~~p~~~~~~v~v~~~~~tlLdaL~~i~~~~~ptl~~~~~C~~G~CGsC~   98 (282)
T 3vr8_B           19 ARYASAATAAAPTGKRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCA   98 (282)
T ss_pred             HHhhhhccCcccCCCeeEEEEEEEeCCCCCCCCCCcEEEEEEeCCCCCcHHHHHHhcCcccCCceeecCCCCCCCCCCCE
Confidence            33443455556667789999999999984 77899999999997547999999999998889999999999999999999


Q ss_pred             EEeCCeeeccccccccC-CCCceEEeeCCCCcceeeeeechhhHHHHhhhcccccccCCCCCCCCCCCCCCHHHHHHHhc
Q 026956          110 MNIDGCNGLACLTKISP-SGSASTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPPMPGKEIPQSKKDRAKLDG  188 (230)
Q Consensus       110 V~ING~~~LAC~t~v~~-~~~~itIEPL~~~pvirDLvVD~~~f~~k~k~vkp~l~~~~~~~~~~~e~~~~pe~~~~~~~  188 (230)
                      |+|||++++||.|++.+ .++++|||||++||||||||||++.||++|++++||+.++......+.+.+|+|+++++++.
T Consensus        99 V~InG~~~laC~t~v~~~~~~~~tIepL~~~pVikDLvvD~~~f~~~~~~v~p~l~~~~~~~~~~~~~~qs~~~~~~~~~  178 (282)
T 3vr8_B           99 MNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDG  178 (282)
T ss_pred             EEECCEEecchhhhHhHhcCCcEEeccCCCCceeeccccccHHHHHHHHHHhhhcCCCCCCCCCchhcccCHHHHHHHHh
Confidence            99999999999999984 56889999999999999999999999999999999999876543345678999999999999


Q ss_pred             HHHhhhhchhhhcccCcccCCCCCcCHHHHHHHHHhcccc
Q 026956          189 MYECILCACCSTSCPSYWWTSEAYLGPAALLHANSIGLSN  228 (230)
Q Consensus       189 ~~~CI~CG~C~saCP~~~~~~~~FlGPaal~~a~R~~~~~  228 (230)
                      +..||+||+|+++||++++++++|+||++++++|||++|.
T Consensus       179 ~~~CI~CG~C~~aCP~~~~~~~~~lGP~~li~a~r~~~d~  218 (282)
T 3vr8_B          179 LYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDS  218 (282)
T ss_pred             hhhCcccCcCcccCCceeccCCcCCCHHHHHHHHHHHhCC
Confidence            9999999999999999988767899999999999998764
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1kf6b2105 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur 2e-40
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 2e-37
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 1e-35
d1nekb1132 a.1.2.1 (B:107-238) Succinate dehydogenase {Escher 3e-21
d2bs2b1133 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella 1e-19
d1kf6b1138 a.1.2.1 (B:106-243) Fumarate reductase {Escherichi 7e-19
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin domains from multidomain proteins
domain: Fumarate reductase iron-sulfur protein, N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score =  132 bits (333), Expect = 2e-40
 Identities = 35/106 (33%), Positives = 54/106 (50%), Gaps = 1/106 (0%)

Query: 43  ANTDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCRE 102
           A     K ++ R+NP+  + P    +E+   +    +LDAL  IK  + P L++R SCR 
Sbjct: 1   AEMKNLKIEVVRYNPEVDTAPHSAFYEVPY-DATTSLLDALGYIKDNLAPDLSYRWSCRM 59

Query: 103 GICGSCAMNIDGCNGLACLTKISPSGSASTITPLPHMFVIKDLVVD 148
            ICGSC M ++    LAC T +        +  L +  + +DLVVD
Sbjct: 60  AICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVD 105
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 100.0
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 100.0
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 100.0
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.74
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.73
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 99.65
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 99.62
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 99.61
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 99.6
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 99.6
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 99.59
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 99.5
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 99.42
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 99.37
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 98.41
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 98.36
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 98.3
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 98.29
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 98.27
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 98.25
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 98.24
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 98.2
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 98.19
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 98.19
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 98.17
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 97.98
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 97.89
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 97.79
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 97.69
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 97.62
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 97.59
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 97.58
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 97.49
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 94.44
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 91.85
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 91.84
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 91.81
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 91.15
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 90.45
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 90.41
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 90.2
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 90.04
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 89.95
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 89.36
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 89.05
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 88.95
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 88.92
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 88.8
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 88.61
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 88.4
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 88.12
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 87.89
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 87.83
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 87.67
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 87.62
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 87.28
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 87.24
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 87.06
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 86.81
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 86.65
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 86.46
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 86.16
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 86.09
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 85.66
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 84.18
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 81.58
d2v4jb169 DsrB insert domain {Desulfovibrio vulgaris [TaxId: 80.89
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: 2Fe-2S ferredoxin-like
family: 2Fe-2S ferredoxin domains from multidomain proteins
domain: Fumarate reductase iron-sulfur protein, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=7.7e-42  Score=265.92  Aligned_cols=103  Identities=33%  Similarity=0.599  Sum_probs=99.3

Q ss_pred             CceEEEEEEeeCCCCCCCCceEEEEEeecCCChhHHHHHHHhhhccCCCcccccCcCCCccCcceEEeCCeeeccccccc
Q 026956           45 TDTKKFQIYRWNPDSPSKPELKEFEINLKECGPMVLDALIKIKSEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKI  124 (230)
Q Consensus        45 ~~~v~lkI~Rfdp~~d~~~~~~~y~v~v~~~~~TvLdaL~~i~~~~d~~l~fr~gCr~GiCGsCaV~ING~~~LAC~t~v  124 (230)
                      .++++|+||||||+++.+|||++|+|++++ ++||||+|.+|++++||+|+||+||++|+||+|+|+|||+++|||.|++
T Consensus         3 ~~~i~~~i~R~dp~~~~~~~~~~y~v~~~~-~~tvLd~L~~Ik~~~d~sLsfr~sCr~giCGsCam~ING~~~LAC~t~v   81 (105)
T d1kf6b2           3 MKNLKIEVVRYNPEVDTAPHSAFYEVPYDA-TTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFL   81 (105)
T ss_dssp             CEEEEEEEEECCTTTCSSCEEEEEEEEECT-TCBHHHHHHHHHHHTCTTCCCCCCCSSSSSCCCEEEETTEEEEGGGCBG
T ss_pred             ccEEEEEEEEECCCCCCCCeeEEEEEecCC-CCcHHHHHHHHHHhcCCcceEEeccCCCCCCCCeEEECCcccccceeEe
Confidence            467999999999999999999999999987 9999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCceEEeeCCCCcceeeeeec
Q 026956          125 SPSGSASTITPLPHMFVIKDLVVD  148 (230)
Q Consensus       125 ~~~~~~itIEPL~~~pvirDLvVD  148 (230)
                      .+..+.++||||++|||||||+||
T Consensus        82 ~~~~~~i~iePl~~~pVikDLvVD  105 (105)
T d1kf6b2          82 RDYTDGMKVEALANFPIERDLVVD  105 (105)
T ss_dssp             GGCTTCEEEECCTTSCEEETTEEC
T ss_pred             eccCCCeEEEECCCCCccccCCcC
Confidence            987778999999999999999998
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure