Citrus Sinensis ID: 028809

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MASFFALKTLASSSIPPRALRSTISSSATWACRFFNTTNAFREYDDDGGDDREFDFERSSARSLTPSFFPVFEPFEPFSRSRSLSMNENGEGLYSAGAGAGLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGKGGKEDGDEESVRRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKVE
cccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEEccccccccEEEEEEccEEEEEEEEcccccccccEEEEEEEEEccccccccccEEEEEcccEEEEEcccccccccccEEEEEEc
ccHHHHHHHccccccccccccccccHHHcccccccccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccEEEEEcccccccccEEEEEEccEEEEEcccccccccccccccccEEEEccccHHHHHHHHEHEcccEEEEEEccccccccccEEEEEEc
MASFFALKtlasssippralrstisssaTWACRFfnttnafreydddggddrefdferssarsltpsffpvfepfepfsrsrslsmnengeglysagagaglrprwaaKVTKDALNlsvdmpglakeDVRVSLEQNTLvikgkggkedgdeesvRRYTIRIelpekifkTDQIKAEMKNGVLkltlpmmkedertdvlHIKVE
MASFFALKtlasssippralrstisssatwaCRFFNTTNAFREYDDDGGDDREFDFERSsarsltpsffpvfEPFEPFSRSRSLSMNENGEGLYSAGAGAGLRPRWAAKVTKDALNLSVDmpglakedvrvsleqntlvikgkggkedgdeesvrrytirielpekifktdqikaEMKNgvlkltlpmmkedertdvlhikve
MASFFALKTLASSSIPPRALRSTISSSATWACRFFNTTNAFREYdddggddrefdferSSARSLTpsffpvfepfepfsRSRSLSMNENGEGLYSAGAGAGLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVIkgkggkedgdeeSVRRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKVE
*************************SSATWACRFFNTTNAFREY************************FPVF************************GAGAGLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVI**************RRYTIRIELPEKIFKTDQIKAEMKNGVLKLTL*****************
***F****************************************************************FPVFEPFEPFSRSRSLS************AGAGLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVI*****************TIRIELPEKIFKTDQIKAEMKNGVLKLTLP***********HIKVE
MASFFALKTLASSSIPPRALRSTISSSATWACRFFNTTNAFREYDDDGGDDREFDFERSSARSLTPSFFPVFEPFEPFSRSRSLSMNENGEGLYSAGAGAGLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGK**********VRRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKVE
***************************************************************LTPSFFPVFEPFEPFSRSRSLSMNENG************RPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGKG**********RRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKVE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASFFALKTLASSSIPPRALRSTISSSATWACRFFNTTNAFREYDDDGGDDREFDFERSSARSLTPSFFPVFEPFEPFSRSRSLSMNENGEGLYSAGAGAGLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGKGGKEDGDEESVRRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query203 2.2.26 [Sep-21-2011]
Q39818211 Heat shock 22 kDa protein yes no 0.822 0.791 0.469 5e-36
Q9FGM9210 23.5 kDa heat shock prote yes no 0.955 0.923 0.488 6e-36
P46254202 Heat shock 22 kDa protein N/A no 0.975 0.980 0.468 9e-36
Q96331210 23.6 kDa heat shock prote no no 0.955 0.923 0.488 2e-35
Q67X83248 26.2 kDa heat shock prote yes no 0.832 0.681 0.447 3e-28
Q6Z7V2220 24.1 kDa heat shock prote no no 0.847 0.781 0.45 3e-27
P11890204 Small heat shock protein, N/A no 0.965 0.960 0.436 5e-27
P31170227 25.3 kDa heat shock prote no no 0.660 0.590 0.366 2e-16
Q95661235 Small heat shock protein, N/A no 0.684 0.591 0.374 2e-14
P09887181 Small heat shock protein, no no 0.694 0.779 0.333 7e-14
>sp|Q39818|HS22M_SOYBN Heat shock 22 kDa protein, mitochondrial OS=Glycine max GN=HSP23.9 PE=2 SV=1 Back     alignment and function desciption
 Score =  150 bits (380), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 93/198 (46%), Positives = 121/198 (61%), Gaps = 31/198 (15%)

Query: 27  SATWACRFFNTTNAFREYDDDGGDDREFDFERSSARSL-------------TPSFFPVFE 73
           +A+ + R F+T NA R+YD+   DD   D +R S RS                S F   E
Sbjct: 24  AASASHRSFDT-NAMRQYDN-RADDHSTDIDRHSERSFPSTARRDDIFLRCVGSIFSDSE 81

Query: 74  PFEPFSRSRSLSMNENGEGLYSAGAGAGLRPR--------WAAKVTKDALNLSVDMPGLA 125
            FEP S         +G G   +      R R        W A+ T+DAL+L VDMPGLA
Sbjct: 82  -FEPGS-------EHDGPGHGQSVPLRVARDRSWRWSGRGWDARETEDALHLRVDMPGLA 133

Query: 126 KEDVRVSLEQNTLVIKGKGGKEDGDEESVRRYTIRIELPEKIFKTDQIKAEMKNGVLKLT 185
           KEDV++S+EQNTL+IKG+G KE  +EES RRYT RI+LP+K++K DQI+AEMKNGVLK+ 
Sbjct: 134 KEDVKISVEQNTLIIKGEGAKEGDEEESARRYTSRIDLPDKLYKIDQIRAEMKNGVLKVV 193

Query: 186 LPMMKEDERTDVLHIKVE 203
           +P MKE+ER DV+ +KVE
Sbjct: 194 VPKMKEEERKDVISVKVE 211

Glycine max (taxid: 3847)
>sp|Q9FGM9|HS235_ARATH 23.5 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.5 PE=2 SV=1 Back     alignment and function description
>sp|P46254|HS22M_PEA Heat shock 22 kDa protein, mitochondrial OS=Pisum sativum GN=HSP22 PE=2 SV=1 Back     alignment and function description
>sp|Q96331|HS23M_ARATH 23.6 kDa heat shock protein, mitochondrial OS=Arabidopsis thaliana GN=HSP23.6 PE=2 SV=1 Back     alignment and function description
>sp|Q67X83|HS26M_ORYSJ 26.2 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP26.2 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z7V2|HS24M_ORYSJ 24.1 kDa heat shock protein, mitochondrial OS=Oryza sativa subsp. japonica GN=HSP24.1 PE=2 SV=1 Back     alignment and function description
>sp|P11890|HS23C_CHERU Small heat shock protein, chloroplastic OS=Chenopodium rubrum GN=HSP23 PE=2 SV=1 Back     alignment and function description
>sp|P31170|HS25P_ARATH 25.3 kDa heat shock protein, chloroplastic OS=Arabidopsis thaliana GN=HSP25.3 PE=2 SV=1 Back     alignment and function description
>sp|Q95661|HS21C_SOLLC Small heat shock protein, chloroplastic OS=Solanum lycopersicum GN=HSP21 PE=2 SV=1 Back     alignment and function description
>sp|P09887|HS22C_SOYBN Small heat shock protein, chloroplastic (Fragment) OS=Glycine max GN=HSP22 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
297803604211 hypothetical protein ARALYDRAFT_492313 [ 0.970 0.933 0.511 9e-38
224071519213 predicted protein [Populus trichocarpa] 0.990 0.943 0.553 1e-37
2326354210 LMW heat shock protein [Arabidopsis thal 0.955 0.923 0.493 2e-37
388512007209 unknown [Medicago truncatula] 0.970 0.942 0.474 3e-37
372477638214 mitochondrial heat shock protein [Copaif 0.950 0.901 0.516 2e-36
225466111208 PREDICTED: 23.6 kDa heat shock protein, 0.852 0.831 0.507 4e-36
339792764209 hsp23 [Medicago sativa] 0.970 0.942 0.465 4e-36
189014946174 small heat shock protein [Mangifera indi 0.832 0.971 0.541 1e-34
21554988210 mitochondrial heat shock 22 kd protein-l 0.955 0.923 0.493 2e-34
351727929211 heat shock 22 kDa protein, mitochondrial 0.822 0.791 0.469 2e-34
>gi|297803604|ref|XP_002869686.1| hypothetical protein ARALYDRAFT_492313 [Arabidopsis lyrata subsp. lyrata] gi|297315522|gb|EFH45945.1| hypothetical protein ARALYDRAFT_492313 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 136/215 (63%), Gaps = 18/215 (8%)

Query: 1   MASFFALKTLASSSIPPRALRSTISSSATWACRFFNTTNAFREYDDDGGDDREFDFERSS 60
           MAS  ALK L SSSI PR+ RS +S S +   R FNT NA R YDDDG + +  DF+R S
Sbjct: 1   MASSLALKRLLSSSIVPRS-RSVLSPSVS--SRLFNT-NAVRSYDDDGENGQGVDFDRRS 56

Query: 61  ARSLTPSFFP-VFEPFEPFSRSRSLSMN------ENGEGLYSAGAGA-GLRPRWAAKVTK 112
                  FF  VF+PF P +RS S  +N      EN     + G GA G R  W  K   
Sbjct: 57  VPRRRGDFFSDVFDPFSP-TRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKD 115

Query: 113 DALNLSVDMPGLAKEDVRVSLEQNTLVIKGKGGKEDGDEESV-----RRYTIRIELPEKI 167
           DAL L +DMPGL++EDV+++LEQ+TLVI+G+G  ED D E       RR+T RI LPEKI
Sbjct: 116 DALYLRIDMPGLSREDVKLALEQDTLVIRGEGKYEDDDGEEEDQGGNRRFTSRIGLPEKI 175

Query: 168 FKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKV 202
           +K D+IKAEMKNGVLK+ +P MKE ER DV  I++
Sbjct: 176 YKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEI 210

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224071519|ref|XP_002303499.1| predicted protein [Populus trichocarpa] gi|222840931|gb|EEE78478.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|2326354|emb|CAA67022.1| LMW heat shock protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|388512007|gb|AFK44065.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|372477638|gb|AEX97054.1| mitochondrial heat shock protein [Copaifera officinalis] Back     alignment and taxonomy information
>gi|225466111|ref|XP_002267332.1| PREDICTED: 23.6 kDa heat shock protein, mitochondrial isoform 1 [Vitis vinifera] gi|359490209|ref|XP_003634050.1| PREDICTED: 23.6 kDa heat shock protein, mitochondrial isoform 2 [Vitis vinifera] gi|147765906|emb|CAN66697.1| hypothetical protein VITISV_022536 [Vitis vinifera] gi|296084208|emb|CBI24596.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|339792764|gb|AEK12766.1| hsp23 [Medicago sativa] Back     alignment and taxonomy information
>gi|189014946|gb|ACD69682.1| small heat shock protein [Mangifera indica] Back     alignment and taxonomy information
>gi|21554988|gb|AAM63747.1| mitochondrial heat shock 22 kd protein-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|351727929|ref|NP_001235130.1| heat shock 22 kDa protein, mitochondrial [Glycine max] gi|3122228|sp|Q39818.1|HS22M_SOYBN RecName: Full=Heat shock 22 kDa protein, mitochondrial; Flags: Precursor gi|710432|gb|AAB03096.1| Hsp23.9 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query203
TAIR|locus:2122649210 HSP23.6-MITO "AT4G25200" [Arab 0.522 0.504 0.513 1.6e-28
TAIR|locus:2163670210 AT5G51440 "AT5G51440" [Arabido 0.527 0.509 0.554 4e-26
UNIPROTKB|Q6Z7V2220 HSP24.1 "24.1 kDa heat shock p 0.527 0.486 0.5 1.3e-20
UNIPROTKB|Q67X83248 HSP26.2 "26.2 kDa heat shock p 0.541 0.443 0.491 4.4e-20
TAIR|locus:2137762227 HSP21 "AT4G27670" [Arabidopsis 0.536 0.480 0.358 2.7e-13
UNIPROTKB|P31673154 HSP17.4 "17.4 kDa class I heat 0.507 0.668 0.370 1.6e-08
UNIPROTKB|Q84Q72161 HSP18.1 "18.1 kDa class I heat 0.497 0.627 0.377 2.6e-08
TAIR|locus:2042977153 AT2G29500 "AT2G29500" [Arabido 0.472 0.627 0.330 5.3e-08
UNIPROTKB|Q84J50159 HSP17.7 "17.7 kDa class I heat 0.507 0.647 0.353 8.7e-08
UNIPROTKB|Q943E7149 HSP16.9C "16.9 kDa class I hea 0.497 0.677 0.342 2.3e-07
TAIR|locus:2122649 HSP23.6-MITO "AT4G25200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 1.6e-28, Sum P(2) = 1.6e-28
 Identities = 57/111 (51%), Positives = 72/111 (64%)

Query:    97 GAGA-GLRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQNTLVIXXXXXXXXXXX---- 151
             G GA G R  W  K   DAL L +DMPGL++EDV+++LEQ+TLVI               
Sbjct:    99 GMGASGARRGWDIKEKDDALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGE 158

Query:   152 XSVRRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKV 202
                RR+T RI LP+KI+K D+IKAEMKNGVLK+ +P MKE ER DV  I++
Sbjct:   159 SGNRRFTSRIGLPDKIYKIDEIKAEMKNGVLKVVIPKMKEQERNDVRQIEI 209
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0009408 "response to heat" evidence=ISS;RCA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2163670 AT5G51440 "AT5G51440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6Z7V2 HSP24.1 "24.1 kDa heat shock protein, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q67X83 HSP26.2 "26.2 kDa heat shock protein, mitochondrial" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2137762 HSP21 "AT4G27670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P31673 HSP17.4 "17.4 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q84Q72 HSP18.1 "18.1 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2042977 AT2G29500 "AT2G29500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84J50 HSP17.7 "17.7 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E7 HSP16.9C "16.9 kDa class I heat shock protein 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FGM9HS235_ARATHNo assigned EC number0.48830.95560.9238yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_III0867
hypothetical protein (214 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 4e-22
cd0646488 cd06464, ACD_sHsps-like, Alpha-crystallin domain ( 2e-20
pfam00011101 pfam00011, HSP20, Hsp20/alpha crystallin family 2e-19
cd0647292 cd06472, ACD_ScHsp26_like, Alpha crystallin domain 8e-14
COG0071146 COG0071, IbpA, Molecular chaperone (small heat sho 2e-13
cd0647193 cd06471, ACD_LpsHSP_like, Group of bacterial prote 2e-11
cd0647090 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain 1e-07
cd0646384 cd06463, p23_like, Proteins containing this p23_li 9e-06
cd0652683 cd06526, metazoan_ACD, Alpha-crystallin domain (AC 3e-05
pfam0496978 pfam04969, CS, CS domain 8e-04
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information 
 Score = 84.9 bits (211), Expect = 4e-22
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)

Query: 111 TKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGKGGKEDGDEESVRRYTIRIELPEKIFKT 170
           T D + ++VD+PG+ KED++V +E N L I GK  +E+  E S   +    ELPE +   
Sbjct: 4   TDDEVVVTVDLPGVKKEDIKVEVEDNVLTISGKREEEEERERSYGEFERSFELPEDV-DP 62

Query: 171 DQIKAEMKNGVLKLTLP 187
           ++ KA ++NGVL++TLP
Sbjct: 63  EKSKASLENGVLEITLP 79

sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is this ACD. sHsps are generally active as large oligomers consisting of multiple subunits, and are believed to be ATP-independent chaperones that prevent aggregation and are important in refolding in combination with other Hsps. p23 is a cochaperone of the Hsp90 chaperoning pathway. It binds Hsp90 and participates in the folding of a number of Hsp90 clients including the progesterone receptor. p23 also has a passive chaperoning activity. p23 in addition may act as the cytosolic prostaglandin E2 synthase. Included in this family is the p23-like C-terminal CHORD-SGT1 (CS) domain of suppressor of G2 allele of Skp1 (Sgt1) and the p23-like domains of human butyrate-induced transcript 1 (hB-ind1), NUD (nuclear distribution) C, Melusin, and NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR). Length = 80
>gnl|CDD|107221 cd06464, ACD_sHsps-like, Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|215655 pfam00011, HSP20, Hsp20/alpha crystallin family Back     alignment and domain information
>gnl|CDD|107229 cd06472, ACD_ScHsp26_like, Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>gnl|CDD|223149 COG0071, IbpA, Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|107228 cd06471, ACD_LpsHSP_like, Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>gnl|CDD|107227 cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>gnl|CDD|107247 cd06526, metazoan_ACD, Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>gnl|CDD|218355 pfam04969, CS, CS domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 203
PRK11597142 heat shock chaperone IbpB; Provisional 99.93
PRK10743137 heat shock protein IbpA; Provisional 99.93
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.92
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.88
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.87
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.87
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.87
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.87
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.86
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.86
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.86
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.85
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.84
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.83
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.82
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.81
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.8
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.79
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.76
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.69
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.59
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.58
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.35
cd0646384 p23_like Proteins containing this p23_like domain 99.07
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 99.03
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.86
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.59
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 98.33
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 98.12
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 98.08
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 98.01
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.95
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.9
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.86
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 97.58
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 97.44
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.86
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 96.63
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 96.6
KOG1309 196 consensus Suppressor of G2 allele of skp1 [Signal 96.58
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 96.47
KOG3158180 consensus HSP90 co-chaperone p23 [Posttranslationa 88.69
KOG2265179 consensus Nuclear distribution protein NUDC [Signa 84.02
PF13349166 DUF4097: Domain of unknown function (DUF4097) 81.9
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information 
Probab=99.93  E-value=1.7e-25  Score=177.93  Aligned_cols=119  Identities=16%  Similarity=0.293  Sum_probs=92.7

Q ss_pred             CCCCCccchHHHhhhcCCCCccCCCCCCCCCceeEEE-cCCeEEEEEECCCCCCCceEEEEECCEEEEEEeecCcCCC--
Q 028809           74 PFEPFSRSRSLSMNENGEGLYSAGAGAGLRPRWAAKV-TKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGKGGKEDGD--  150 (203)
Q Consensus        74 ~~dPf~~~~~l~~~~~~~~~~~~~~~~~~~p~~di~E-~~~~y~i~vdLPGv~kedI~V~v~~~~L~I~g~~~~~~~~--  150 (203)
                      ++.+|..++.|.+.|+..      .+....|++||+| ++++|+|.++|||++|+||+|.+++|.|+|+|+++.+.++  
T Consensus         9 ~~~~~~~~d~l~~~~~~~------~~~~~~P~vdI~e~~~~~y~v~adlPGv~kedi~V~v~~~~LtI~ge~~~~~~~~~   82 (142)
T PRK11597          9 LLRQWIGFDKLANALQNA------GESQSFPPYNIEKSDDNHYRITLALAGFRQEDLDIQLEGTRLTVKGTPEQPEKEVK   82 (142)
T ss_pred             hhcccccHHHHHHHhccc------CccCCCCcEEEEEcCCCEEEEEEEeCCCCHHHeEEEEECCEEEEEEEEccccCCCc
Confidence            344555666655555421      1123579999998 5779999999999999999999999999999997654332  


Q ss_pred             ----CceeeEEEEEEECCCCCCCCcceEEEEECCEEEEEEeccC-CCCCCCeEEee
Q 028809          151 ----EESVRRYTIRIELPEKIFKTDQIKAEMKNGVLKLTLPMMK-EDERTDVLHIK  201 (203)
Q Consensus       151 ----e~~~~~F~r~~~LP~~v~d~d~i~A~~~nGvL~I~lPK~~-~~~~~~~i~I~  201 (203)
                          |+.++.|.|+|.||.+| |.+  +|+|+||||+|+|||.. +..++++|+|+
T Consensus        83 ~~~~Er~~g~F~R~f~LP~~v-d~~--~A~~~nGVL~I~lPK~~~~~~~~rkI~I~  135 (142)
T PRK11597         83 WLHQGLVNQPFSLSFTLAENM-EVS--GATFVNGLLHIDLIRNEPEAIAPQRIAIS  135 (142)
T ss_pred             EEEEEEeCcEEEEEEECCCCc-ccC--cCEEcCCEEEEEEeccCccccCCcEEEEC
Confidence                35678999999999999 887  79999999999999964 33456777775

>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>KOG3158 consensus HSP90 co-chaperone p23 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2265 consensus Nuclear distribution protein NUDC [Signal transduction mechanisms] Back     alignment and domain information
>PF13349 DUF4097: Domain of unknown function (DUF4097) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query203
1gme_A151 Heat shock protein 16.9B; small heat shock protein 2e-20
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 6e-20
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 8e-20
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 2e-19
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 1e-13
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 4e-13
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 1e-12
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 5e-12
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 6e-12
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 7e-09
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 3e-11
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
 Score = 82.0 bits (203), Expect = 2e-20
 Identities = 40/145 (27%), Positives = 66/145 (45%), Gaps = 13/145 (8%)

Query: 70  PVFEPFEPFSRS--RSLSMNENGEGLYSAGAGAGLRPRWAAKVTKDALNLSVDMPGLAKE 127
            VF+PF         +            +   A    R   K T +A     D+PG+ KE
Sbjct: 8   NVFDPFADLWADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLPGVKKE 67

Query: 128 DVRVSLEQ-NTLVIKGKGGKEDGDEE--------SVRRYTIRIELPEKIFKTDQIKAEMK 178
           +V+V +E  N LV+ G+  KE  D+         S  ++  R  L E   K +++KA ++
Sbjct: 68  EVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDA-KVEEVKAGLE 126

Query: 179 NGVLKLTLPMMKEDERTDVLHIKVE 203
           NGVL +T+P   E ++ +V  I++ 
Sbjct: 127 NGVLTVTVP-KAEVKKPEVKAIQIS 150
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Length = 100 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Length = 90 Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Length = 85 Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Length = 175 Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Length = 101 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Length = 314 Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Length = 106 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.94
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.93
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.92
4fei_A102 Heat shock protein-related protein; stress respons 99.92
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.9
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.89
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.89
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.88
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.88
2bol_A 314 TSP36, small heat shock protein; A-crystallin, mol 99.87
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.85
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.77
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.08
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.07
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 98.56
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 98.47
3igf_A374 ALL4481 protein; two-domained protein consisting o 98.3
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 98.06
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.95
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.89
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 97.87
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.85
2o30_A131 Nuclear movement protein; MCSG, structural genomic 97.79
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 97.77
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 97.67
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 97.4
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 97.33
4fei_A102 Heat shock protein-related protein; stress respons 82.83
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
Probab=99.94  E-value=9e-27  Score=185.39  Aligned_cols=100  Identities=35%  Similarity=0.560  Sum_probs=86.1

Q ss_pred             CCCceeEEEcCCeEEEEEECCCCCCCceEEEEE-CCEEEEEEeecCcCCC--------CceeeEEEEEEECCCCCCCCcc
Q 028809          102 LRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLE-QNTLVIKGKGGKEDGD--------EESVRRYTIRIELPEKIFKTDQ  172 (203)
Q Consensus       102 ~~p~~di~E~~~~y~i~vdLPGv~kedI~V~v~-~~~L~I~g~~~~~~~~--------e~~~~~F~r~~~LP~~v~d~d~  172 (203)
                      +.|++||+|++++|+|.++|||++++||+|+++ ++.|+|+|+++.+.++        |+.++.|.|+|.||.+| +.+.
T Consensus        42 ~~p~~di~e~~d~~~v~~dlPGv~kedI~V~v~~~~~L~I~g~~~~~~~~~~~~~~~~Er~~g~F~R~~~LP~~v-d~~~  120 (151)
T 1gme_A           42 ANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDA-KVEE  120 (151)
T ss_dssp             GGGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCC-CGGG
T ss_pred             cCCceEEEEcCCEEEEEEECCCCChHHEEEEEecCCEEEEEEEEccccccCCceEEEEeEeccEEEEEEECCCCc-cccc
Confidence            689999999999999999999999999999995 6899999998765432        34568999999999999 9999


Q ss_pred             eEEEEECCEEEEEEeccCCCCCCCeEEeecC
Q 028809          173 IKAEMKNGVLKLTLPMMKEDERTDVLHIKVE  203 (203)
Q Consensus       173 i~A~~~nGvL~I~lPK~~~~~~~~~i~I~Ie  203 (203)
                      |+|+|+||||+|++||.++. +++.+.|+|+
T Consensus       121 i~A~~~nGvL~I~lPK~~~~-~~~~~~I~I~  150 (151)
T 1gme_A          121 VKAGLENGVLTVTVPKAEVK-KPEVKAIQIS  150 (151)
T ss_dssp             CEEEEETTEEEEEEECCCCC-TTCCCCCCCC
T ss_pred             eEEEEECCEEEEEEEccCcC-CCCCeEeeeC
Confidence            99999999999999998654 3445555553
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 203
d1shsa_115 b.15.1.1 (A:) Small heat shock protein {Archaeon M 2e-13
d1gmea_150 b.15.1.1 (A:) Small heat shock protein {Wheat (Tri 2e-12
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 62.0 bits (150), Expect = 2e-13
 Identities = 23/102 (22%), Positives = 41/102 (40%), Gaps = 13/102 (12%)

Query: 111 TKDALNLSVDMPGLAKEDVRVSLEQNTLVIKGKGGKEDGDE---------ESVRRYTIRI 161
               + +   +PG+ KED+ ++   +TL I+ K       E                  I
Sbjct: 18  GDQHIKVIAWLPGVNKEDIILNAVGDTLEIRAKRSPLMITESERIIYSEIPEEEEIYRTI 77

Query: 162 ELPEKIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVLHIKVE 203
           +LP  + K +   A+ +NGVL + LP  +   +     I +E
Sbjct: 78  KLPATV-KEENASAKFENGVLSVILPKAESSIKK---GINIE 115
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query203
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.94
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.9
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.48
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 97.72
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 97.53
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 97.52
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 97.24
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus 87.14
d1vqoe179 Ribosomal protein L6 {Archaeon Haloarcula marismor 85.07
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]

Probab=99.94  E-value=1.4e-26  Score=181.73  Aligned_cols=100  Identities=35%  Similarity=0.567  Sum_probs=87.1

Q ss_pred             CCCceeEEEcCCeEEEEEECCCCCCCceEEEEEC-CEEEEEEeecCcCCC--------CceeeEEEEEEECCCCCCCCcc
Q 028809          102 LRPRWAAKVTKDALNLSVDMPGLAKEDVRVSLEQ-NTLVIKGKGGKEDGD--------EESVRRYTIRIELPEKIFKTDQ  172 (203)
Q Consensus       102 ~~p~~di~E~~~~y~i~vdLPGv~kedI~V~v~~-~~L~I~g~~~~~~~~--------e~~~~~F~r~~~LP~~v~d~d~  172 (203)
                      +.|.+||.|++++|+|+++|||++++||+|++++ +.|+|+|++..+.+.        |+.++.|.|+|.||.+| |.++
T Consensus        41 ~~p~~dv~e~~~~~~i~~~lPG~~~edi~v~v~~~~~l~i~~~~~~~~~~~~~~~~~~e~~~~~f~r~~~LP~~v-d~~~  119 (150)
T d1gmea_          41 ANARMDWKETPEAHVFKADLPGVKKEEVKVEVEDGNVLVVSGERTKEKEDKNDKWHRVERSSGKFVRRFRLLEDA-KVEE  119 (150)
T ss_dssp             GGGCEEEEECSSEEEEEEECTTCCGGGEEEEEETTTEEEEEECCCCCCCCTTCEEEECCCCCCCEEEEEECSSCC-CGGG
T ss_pred             CCCceeEEECCCEEEEEEEeCCCccCCEEEEEEEccceeEEEEEecccccccceeeeeeeccceEEEEEECCCCe-eece
Confidence            5688999999999999999999999999999986 579999998765433        34567899999999999 9999


Q ss_pred             eEEEEECCEEEEEEeccCCCCCCCeEEeecC
Q 028809          173 IKAEMKNGVLKLTLPMMKEDERTDVLHIKVE  203 (203)
Q Consensus       173 i~A~~~nGvL~I~lPK~~~~~~~~~i~I~Ie  203 (203)
                      |+|+|+||||+|++||.++. +++.+.|+|+
T Consensus       120 i~A~~~nGvL~I~lpK~~~~-~~~~~~I~I~  149 (150)
T d1gmea_         120 VKAGLENGVLTVTVPKAEVK-KPEVKAIQIS  149 (150)
T ss_dssp             CEEEEETTEEEEEEECCCCC-TTCCCCCCCC
T ss_pred             eEEEEECCEEEEEEEcCCcC-CCCceEEecc
Confidence            99999999999999998554 4677778875
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure