Citrus Sinensis ID: 028883
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 13173434 | 623 | phosphoribosylaminoimidazole carboxylase | 0.925 | 0.300 | 0.416 | 3e-30 | |
| 37983592 | 621 | phosphoribosylaminoimidazole carboxylase | 0.925 | 0.301 | 0.416 | 3e-30 | |
| 357441429 | 641 | Phosphoribosylaminoimidazole carboxylase | 0.792 | 0.249 | 0.453 | 2e-29 | |
| 14590237 | 177 | phosphoribosylaminoimidazole carboxylase | 0.727 | 0.830 | 0.466 | 3e-29 | |
| 449442114 | 586 | PREDICTED: phosphoribosylaminoimidazole | 0.702 | 0.242 | 0.496 | 1e-28 | |
| 449490248 | 586 | PREDICTED: phosphoribosylaminoimidazole | 0.702 | 0.242 | 0.496 | 1e-28 | |
| 356535191 | 633 | PREDICTED: phosphoribosylaminoimidazole | 0.792 | 0.252 | 0.453 | 2e-28 | |
| 410667200 | 164 | phosphoribosylaminoimidazole carboxylase | 0.717 | 0.884 | 0.493 | 2e-28 | |
| 356576720 | 633 | PREDICTED: phosphoribosylaminoimidazole | 0.787 | 0.251 | 0.45 | 4e-28 | |
| 297823643 | 645 | hypothetical protein ARALYDRAFT_321477 [ | 0.722 | 0.226 | 0.462 | 2e-27 |
| >gi|13173434|gb|AAK14408.1| phosphoribosylaminoimidazole carboxylase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Score = 137 bits (344), Expect = 3e-30, Method: Compositional matrix adjust.
Identities = 82/197 (41%), Positives = 117/197 (59%), Gaps = 10/197 (5%)
Query: 7 RPNSVRTVSRGTIPVLASSNGSATSRRKDDSSVREPSTVFEEENPNGDSTDAPIVGIIME 66
+P R G I ++ S G ++ + + EE+ NG AP VGIIM
Sbjct: 413 KPEMRRQRKMGHITIVGPSMGIVEAQLR---------VILNEESVNGHPAVAPRVGIIMG 463
Query: 67 SDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAH 126
SD DLPVM DAA+ L++F VP E+KI+ H+ + SYALSA+ERGI++II G G AH
Sbjct: 464 SDSDLPVMKDAAKILNEFDVPAEVKIVSAHRTPEMMFSYALSARERGIQVIIAGAGGAAH 523
Query: 127 LSGVAAANSQILVIRVPLLSEDW-SEDDVINSIRMPSHVQVASVPRNNAKNAALYAVKVL 185
L G+ AA + + VI VP+ + D +++ ++MP V VA+V NNA NA L AV++L
Sbjct: 524 LPGMVAAFTPLPVIGVPVRASTLDGLDSLLSIVQMPRGVPVATVAINNATNAGLLAVRLL 583
Query: 186 GIADEDLLERIRKYVEE 202
GI+D L R+ +Y E+
Sbjct: 584 GISDIKLQARMAQYQED 600
|
Source: Nicotiana tabacum Species: Nicotiana tabacum Genus: Nicotiana Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|37983592|gb|AAR06291.1| phosphoribosylaminoimidazole carboxylase, partial [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|357441429|ref|XP_003590992.1| Phosphoribosylaminoimidazole carboxylase [Medicago truncatula] gi|355480040|gb|AES61243.1| Phosphoribosylaminoimidazole carboxylase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|14590237|ref|NP_142303.1| phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] gi|3914493|sp|O58058.1|PURE_PYRHO RecName: Full=N5-carboxyaminoimidazole ribonucleotide mutase; Short=N5-CAIR mutase; AltName: Full=5-(carboxyamino)imidazole ribonucleotide mutase gi|3256711|dbj|BAA29394.1| 177aa long hypothetical phosphoribosylaminoimidazole carboxylase catalytic subunit [Pyrococcus horikoshii OT3] | Back alignment and taxonomy information |
|---|
| >gi|449442114|ref|XP_004138827.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449490248|ref|XP_004158550.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356535191|ref|XP_003536132.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|410667200|ref|YP_006919571.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] gi|409104947|gb|AFV11072.1| phosphoribosylaminoimidazole carboxylase catalytic subunit PurE [Thermacetogenium phaeum DSM 12270] | Back alignment and taxonomy information |
|---|
| >gi|356576720|ref|XP_003556478.1| PREDICTED: phosphoribosylaminoimidazole carboxylase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297823643|ref|XP_002879704.1| hypothetical protein ARALYDRAFT_321477 [Arabidopsis lyrata subsp. lyrata] gi|297325543|gb|EFH55963.1| hypothetical protein ARALYDRAFT_321477 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2040771 | 642 | AT2G37690 [Arabidopsis thalian | 0.722 | 0.227 | 0.462 | 4.2e-27 | |
| SGD|S000005654 | 571 | ADE2 "Phosphoribosylaminoimida | 0.970 | 0.343 | 0.381 | 4.6e-26 | |
| TAIR|locus:2051314 | 162 | AT2G05140 "AT2G05140" [Arabido | 0.683 | 0.851 | 0.453 | 3.6e-25 | |
| CGD|CAL0003241 | 568 | ADE2 [Candida albicans (taxid: | 0.876 | 0.311 | 0.411 | 4.3e-25 | |
| UNIPROTKB|Q92210 | 568 | ADE2 "Phosphoribosylaminoimida | 0.876 | 0.311 | 0.411 | 4.3e-25 | |
| UNIPROTKB|P96880 | 174 | purE "N5-carboxyaminoimidazole | 0.693 | 0.804 | 0.425 | 4.8e-23 | |
| POMBASE|SPCC1322.13 | 552 | ade6 "phosphoribosylaminoimida | 0.732 | 0.268 | 0.395 | 2.7e-22 | |
| TIGR_CMR|GSU_0611 | 169 | GSU_0611 "phosphoribosylaminoi | 0.698 | 0.834 | 0.409 | 5.5e-22 | |
| TIGR_CMR|CHY_1069 | 162 | CHY_1069 "phosphoribosylaminoi | 0.702 | 0.876 | 0.373 | 1.1e-21 | |
| TIGR_CMR|CPS_0026 | 160 | CPS_0026 "phosphoribosylaminoi | 0.688 | 0.868 | 0.373 | 1.2e-19 |
| TAIR|locus:2040771 AT2G37690 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 312 (114.9 bits), Expect = 4.2e-27, P = 4.2e-27
Identities = 68/147 (46%), Positives = 98/147 (66%)
Query: 57 DAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKI 116
+ P V IIM SD DLPVM DAA+ L FGV +E+KI+ H+ + +YA SA RG+++
Sbjct: 473 ETPRVAIIMGSDTDLPVMKDAAKILDLFGVTHEVKIVSAHRTPEMMYTYATSAHSRGVQV 532
Query: 117 IIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSE-DDVINSIRMPSHVQVASVPRNNAK 175
II G G AHL G+ A+ + + VI VP+ + D +++ ++MP V VA+V NNA
Sbjct: 533 IIAGAGGAAHLPGMVASLTPLPVIGVPVRATRLDGVDSLLSIVQMPRGVPVATVAINNAT 592
Query: 176 NAALYAVKVLGIADEDLLERIRKYVEE 202
NAAL AV++LGI+D DL+ R+R+Y E+
Sbjct: 593 NAALLAVRMLGISDTDLVSRMRQYQED 619
|
|
| SGD|S000005654 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2051314 AT2G05140 "AT2G05140" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0003241 ADE2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92210 ADE2 "Phosphoribosylaminoimidazole carboxylase" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P96880 purE "N5-carboxyaminoimidazole ribonucleotide mutase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPCC1322.13 ade6 "phosphoribosylaminoimidazole carboxylase Ade6" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_0611 GSU_0611 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1069 CHY_1069 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0026 CPS_0026 "phosphoribosylaminoimidazole carboxylase, catalytic subunit" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| purE | phosphoribosylaminoimidazole carboxylase catalytic subunit; This subunit can alone transform AIR to CAIR, but in association with purK, which possesses an ATPase activity, an enzyme complex is produced which is capable of converting AIR to CAIR efficiently under physiological condition (By similarity) (177 aa) | ||||||||||
(Pyrococcus horikoshii) | |||||||||||
| purC | • | • | • | • | • | 0.999 | |||||
| purD | • | • | • | • | • | • | • | 0.999 | |||
| purT | • | • | • | • | • | 0.999 | |||||
| purF | • | • | • | • | • | • | 0.998 | ||||
| purM | • | • | • | • | • | • | 0.997 | ||||
| purB | • | • | • | • | • | 0.996 | |||||
| purQ | • | • | • | • | 0.982 | ||||||
| glnA | • | • | 0.976 | ||||||||
| purL | • | • | • | 0.964 | |||||||
| purA | • | • | • | 0.961 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| TIGR01162 | 156 | TIGR01162, purE, phosphoribosylaminoimidazole carb | 6e-43 | |
| pfam00731 | 150 | pfam00731, AIRC, AIR carboxylase | 1e-42 | |
| COG0041 | 162 | COG0041, PurE, Phosphoribosylcarboxyaminoimidazole | 1e-41 | |
| PLN02948 | 577 | PLN02948, PLN02948, phosphoribosylaminoimidazole c | 8e-41 | |
| smart01001 | 152 | smart01001, AIRC, AIR carboxylase | 3e-38 | |
| COG1691 | 254 | COG1691, COG1691, NCAIR mutase (PurE)-related prot | 0.002 |
| >gnl|CDD|130230 TIGR01162, purE, phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
Score = 140 bits (356), Expect = 6e-43
Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 1/143 (0%)
Query: 61 VGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVG 120
VGIIM SD DLP M AA L +FG+PYE++++ H+ + L YA A+ERGIK+II G
Sbjct: 1 VGIIMGSDSDLPTMKKAADILEEFGIPYELRVVSAHRTPELMLEYAKEAEERGIKVIIAG 60
Query: 121 DGVEAHLSGVAAANSQILVIRVPL-LSEDWSEDDVINSIRMPSHVQVASVPRNNAKNAAL 179
G AHL G+ AA + + VI VP+ D +++ ++MPS V VA+V NA NAAL
Sbjct: 61 AGGAAHLPGMVAALTPLPVIGVPVPSKALSGLDSLLSIVQMPSGVPVATVAIGNAGNAAL 120
Query: 180 YAVKVLGIADEDLLERIRKYVEE 202
A ++LGI D +L E++++Y E
Sbjct: 121 LAAQILGIKDPELAEKLKEYREN 143
|
Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE. This model represents PurK, an N5-CAIR mutase [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]. Length = 156 |
| >gnl|CDD|144362 pfam00731, AIRC, AIR carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|223119 COG0041, PurE, Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|214965 smart01001, AIRC, AIR carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|224605 COG1691, COG1691, NCAIR mutase (PurE)-related proteins [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| COG0041 | 162 | PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m | 100.0 | |
| TIGR01162 | 156 | purE phosphoribosylaminoimidazole carboxylase, Pur | 100.0 | |
| PF00731 | 150 | AIRC: AIR carboxylase; InterPro: IPR000031 Phospho | 100.0 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 100.0 | |
| COG1691 | 254 | NCAIR mutase (PurE)-related proteins [General func | 100.0 | |
| KOG2835 | 373 | consensus Phosphoribosylamidoimidazole-succinocarb | 99.95 | |
| cd08170 | 351 | GlyDH Glycerol dehydrogenases (GlyDH) catalyzes ox | 97.49 | |
| cd08550 | 349 | GlyDH-like Glycerol_dehydrogenase-like. Families o | 97.47 | |
| cd08171 | 345 | GlyDH-like2 Glycerol dehydrogenase-like. Glycerol | 97.23 | |
| PRK00843 | 350 | egsA NAD(P)-dependent glycerol-1-phosphate dehydro | 97.23 | |
| cd08175 | 348 | G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) c | 97.22 | |
| PRK09423 | 366 | gldA glycerol dehydrogenase; Provisional | 97.21 | |
| cd08551 | 370 | Fe-ADH iron-containing alcohol dehydrogenases (Fe- | 97.19 | |
| cd08195 | 345 | DHQS Dehydroquinate synthase (DHQS) catalyzes the | 97.12 | |
| TIGR01357 | 344 | aroB 3-dehydroquinate synthase. This model represe | 97.08 | |
| cd08549 | 332 | G1PDH_related Glycerol-1-phosphate_dehydrogenase a | 97.01 | |
| cd08173 | 339 | Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro | 96.98 | |
| cd07766 | 332 | DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) | 96.93 | |
| cd08185 | 380 | Fe-ADH1 Iron-containing alcohol dehydrogenases-lik | 96.91 | |
| cd08183 | 374 | Fe-ADH2 Iron-containing alcohol dehydrogenases-lik | 96.87 | |
| PRK00002 | 358 | aroB 3-dehydroquinate synthase; Reviewed | 96.79 | |
| cd08199 | 354 | EEVS 2-epi-5-epi-valiolone synthase (EEVS). 2-epi- | 96.77 | |
| cd08182 | 367 | HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) c | 96.77 | |
| cd08197 | 355 | DOIS 2-deoxy-scyllo-inosose synthase (DOIS) cataly | 96.74 | |
| cd08174 | 331 | G1PDH-like Glycerol-1-phosphate dehydrogenase-like | 96.65 | |
| cd08193 | 376 | HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyze | 96.64 | |
| cd08194 | 375 | Fe-ADH6 Iron-containing alcohol dehydrogenases-lik | 96.63 | |
| cd08186 | 383 | Fe-ADH8 Iron-containing alcohol dehydrogenase. Typ | 96.53 | |
| cd08176 | 377 | LPO Lactadehyde:propanediol oxidoreductase (LPO) c | 96.53 | |
| cd08187 | 382 | BDH Butanol dehydrogenase catalyzes the conversion | 96.51 | |
| cd08189 | 374 | Fe-ADH5 Iron-containing alcohol dehydrogenases-lik | 96.4 | |
| cd08181 | 357 | PPD-like 1,3-propanediol dehydrogenase-like (PPD). | 96.38 | |
| TIGR02638 | 379 | lactal_redase lactaldehyde reductase. This clade o | 96.34 | |
| cd08192 | 370 | Fe-ADH7 Iron-containing alcohol dehydrogenases-lik | 96.32 | |
| PLN02834 | 433 | 3-dehydroquinate synthase | 96.29 | |
| cd08178 | 398 | AAD_C C-terminal alcohol dehydrogenase domain of t | 96.28 | |
| PF00465 | 366 | Fe-ADH: Iron-containing alcohol dehydrogenase ; In | 96.27 | |
| cd08172 | 347 | GlyDH-like1 Glycerol dehydrogenases-like. Glycerol | 96.18 | |
| cd08177 | 337 | MAR Maleylacetate reductase is involved in many ar | 96.1 | |
| cd08188 | 377 | Fe-ADH4 Iron-containing alcohol dehydrogenases-lik | 96.06 | |
| PRK15454 | 395 | ethanol dehydrogenase EutG; Provisional | 96.05 | |
| cd08179 | 375 | NADPH_BDH NADPH-dependent butanol dehydrogenase in | 95.98 | |
| cd08169 | 344 | DHQ-like Dehydroquinate synthase-like which includ | 95.96 | |
| cd08191 | 386 | HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyz | 95.93 | |
| PRK10586 | 362 | putative oxidoreductase; Provisional | 95.81 | |
| PRK10624 | 382 | L-1,2-propanediol oxidoreductase; Provisional | 95.8 | |
| PRK09860 | 383 | putative alcohol dehydrogenase; Provisional | 95.79 | |
| cd08180 | 332 | PDD 1,3-propanediol dehydrogenase (PPD) catalyzes | 95.73 | |
| cd08190 | 414 | HOT Hydroxyacid-oxoacid transhydrogenase (HOT) inv | 95.56 | |
| PRK06203 | 389 | aroB 3-dehydroquinate synthase; Reviewed | 95.31 | |
| KOG2835 | 373 | consensus Phosphoribosylamidoimidazole-succinocarb | 95.19 | |
| PF13685 | 250 | Fe-ADH_2: Iron-containing alcohol dehydrogenase; P | 95.18 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 95.06 | |
| cd08198 | 369 | DHQS-like2 Dehydroquinate synthase (DHQS)-like. DH | 94.98 | |
| PRK15138 | 387 | aldehyde reductase; Provisional | 94.88 | |
| cd08196 | 346 | DHQS-like1 Dehydroquinate synthase (DHQS)-like. DH | 94.84 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 94.8 | |
| COG0371 | 360 | GldA Glycerol dehydrogenase and related enzymes [E | 94.51 | |
| PRK13805 | 862 | bifunctional acetaldehyde-CoA/alcohol dehydrogenas | 93.83 | |
| cd08184 | 347 | Fe-ADH3 Iron-containing alcohol dehydrogenases-lik | 93.7 | |
| COG1454 | 377 | EutG Alcohol dehydrogenase, class IV [Energy produ | 93.56 | |
| COG2515 | 323 | Acd 1-aminocyclopropane-1-carboxylate deaminase [A | 93.18 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 93.09 | |
| PF04392 | 294 | ABC_sub_bind: ABC transporter substrate binding pr | 93.08 | |
| PF06506 | 176 | PrpR_N: Propionate catabolism activator; InterPro: | 92.95 | |
| PRK13055 | 334 | putative lipid kinase; Reviewed | 92.74 | |
| PRK10653 | 295 | D-ribose transporter subunit RbsB; Provisional | 92.55 | |
| cd06283 | 267 | PBP1_RegR_EndR_KdgR_like Ligand-binding domain of | 92.53 | |
| TIGR03405 | 355 | Phn_Fe-ADH phosphonate metabolism-associated iron- | 92.38 | |
| cd03786 | 363 | GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th | 92.08 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 91.91 | |
| TIGR03702 | 293 | lip_kinase_YegS lipid kinase YegS. Members of this | 91.71 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 91.68 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 91.65 | |
| cd01539 | 303 | PBP1_GGBP Periplasmic glucose/galactose-binding pr | 91.62 | |
| PRK11914 | 306 | diacylglycerol kinase; Reviewed | 91.55 | |
| cd01391 | 269 | Periplasmic_Binding_Protein_Type_1 Type 1 periplas | 91.38 | |
| TIGR02417 | 327 | fruct_sucro_rep D-fructose-responsive transcriptio | 91.33 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 91.23 | |
| cd06311 | 274 | PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi | 91.11 | |
| TIGR00147 | 293 | lipid kinase, YegS/Rv2252/BmrU family. The E. coli | 90.99 | |
| cd06280 | 263 | PBP1_LacI_like_4 Ligand-binding domain of uncharac | 90.49 | |
| COG3199 | 355 | Predicted inorganic polyphosphate/ATP-NAD kinase [ | 90.15 | |
| cd06275 | 269 | PBP1_PurR Ligand-binding domain of purine represso | 90.08 | |
| cd01537 | 264 | PBP1_Repressors_Sugar_Binding_like Ligand-binding | 89.8 | |
| cd06318 | 282 | PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi | 89.53 | |
| cd01575 | 268 | PBP1_GntR Ligand-binding domain of DNA transcripti | 89.43 | |
| PRK13337 | 304 | putative lipid kinase; Reviewed | 89.34 | |
| PRK00861 | 300 | putative lipid kinase; Reviewed | 89.33 | |
| cd06298 | 268 | PBP1_CcpA_like Ligand-binding domain of the catabo | 89.3 | |
| cd06305 | 273 | PBP1_methylthioribose_binding_like Methylthioribos | 89.28 | |
| cd06273 | 268 | PBP1_GntR_like_1 This group includes the ligand-bi | 89.22 | |
| cd06323 | 268 | PBP1_ribose_binding Periplasmic sugar-binding doma | 89.13 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 89.0 | |
| cd06296 | 270 | PBP1_CatR_like Ligand-binding domain of a LacI-lik | 88.89 | |
| cd01988 | 132 | Na_H_Antiporter_C The C-terminal domain of a subfa | 88.78 | |
| cd06321 | 271 | PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b | 88.64 | |
| COG0337 | 360 | AroB 3-dehydroquinate synthetase [Amino acid trans | 88.48 | |
| TIGR03566 | 174 | FMN_reduc_MsuE FMN reductase, MsuE subfamily. Memb | 88.43 | |
| PRK13054 | 300 | lipid kinase; Reviewed | 88.41 | |
| COG2984 | 322 | ABC-type uncharacterized transport system, peripla | 87.82 | |
| cd01542 | 259 | PBP1_TreR_like Ligand-binding domain of DNA transc | 87.47 | |
| cd06320 | 275 | PBP1_allose_binding Periplasmic allose-binding dom | 87.23 | |
| PRK10481 | 224 | hypothetical protein; Provisional | 87.04 | |
| cd06300 | 272 | PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi | 86.9 | |
| cd06310 | 273 | PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi | 86.49 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 86.18 | |
| cd00578 | 452 | L-fuc_L-ara-isomerases L-fucose isomerase (FucIase | 86.09 | |
| cd01538 | 288 | PBP1_ABC_xylose_binding Periplasmic xylose-binding | 85.23 | |
| cd06267 | 264 | PBP1_LacI_sugar_binding_like Ligand binding domain | 84.95 | |
| cd06292 | 273 | PBP1_LacI_like_10 Ligand-binding domain of unchara | 84.51 | |
| PF00532 | 279 | Peripla_BP_1: Periplasmic binding proteins and sug | 84.4 | |
| PRK10423 | 327 | transcriptional repressor RbsR; Provisional | 84.16 | |
| cd01541 | 273 | PBP1_AraR Ligand-binding domain of DNA transcripti | 83.95 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 83.5 | |
| PF10096 | 243 | DUF2334: Uncharacterized protein conserved in bact | 83.47 | |
| cd06293 | 269 | PBP1_LacI_like_11 Ligand-binding domain of unchara | 83.36 | |
| cd06308 | 270 | PBP1_sensor_kinase_like Periplasmic binding domain | 83.15 | |
| TIGR02717 | 447 | AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP | 83.11 | |
| PRK11175 | 305 | universal stress protein UspE; Provisional | 82.96 | |
| cd06301 | 272 | PBP1_rhizopine_binding_like Periplasmic binding pr | 82.81 | |
| PRK09492 | 315 | treR trehalose repressor; Provisional | 82.79 | |
| cd01540 | 289 | PBP1_arabinose_binding Periplasmic L-arabinose-bin | 82.33 | |
| PRK10703 | 341 | DNA-binding transcriptional repressor PurR; Provis | 82.23 | |
| PRK13059 | 295 | putative lipid kinase; Reviewed | 82.03 | |
| cd06302 | 298 | PBP1_LsrB_Quorum_Sensing Periplasmic binding domai | 81.88 | |
| cd06281 | 269 | PBP1_LacI_like_5 Ligand-binding domain of uncharac | 81.86 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 81.6 | |
| cd01536 | 267 | PBP1_ABC_sugar_binding_like Periplasmic sugar-bind | 81.36 | |
| PRK11303 | 328 | DNA-binding transcriptional regulator FruR; Provis | 81.36 | |
| PRK10076 | 213 | pyruvate formate lyase II activase; Provisional | 81.23 | |
| PF06258 | 311 | Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP | 81.2 | |
| PRK14569 | 296 | D-alanyl-alanine synthetase A; Provisional | 80.94 | |
| COG1597 | 301 | LCB5 Sphingosine kinase and enzymes related to euk | 80.82 | |
| TIGR02955 | 295 | TMAO_TorT TMAO reductase system periplasmic protei | 80.75 | |
| PRK10727 | 343 | DNA-binding transcriptional regulator GalR; Provis | 80.24 | |
| PRK13057 | 287 | putative lipid kinase; Reviewed | 80.13 |
| >COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.9e-63 Score=406.42 Aligned_cols=144 Identities=43% Similarity=0.694 Sum_probs=141.8
Q ss_pred CeEEEEecCCCCHHHHHHHHHHHHHhCCCeEEEEEccCCCchHHHHHHHHHhhcCceEEEEecCCcCchhhhhhhccCCc
Q 028883 59 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQIL 138 (202)
Q Consensus 59 ~~V~IimGS~SD~~v~~~a~~~L~~~gi~~ev~V~SaHRtp~~l~~~~~~~~~~g~~ViIa~AG~aa~LpgvvA~~T~~P 138 (202)
++|+|||||+|||++|++|+++|++|||+||++|+||||||+++.+|+++++++|++|||++||++||||||+|++|++|
T Consensus 3 ~~V~IIMGS~SD~~~mk~Aa~~L~~fgi~ye~~VvSAHRTPe~m~~ya~~a~~~g~~viIAgAGgAAHLPGmvAa~T~lP 82 (162)
T COG0041 3 PKVGIIMGSKSDWDTMKKAAEILEEFGVPYEVRVVSAHRTPEKMFEYAEEAEERGVKVIIAGAGGAAHLPGMVAAKTPLP 82 (162)
T ss_pred ceEEEEecCcchHHHHHHHHHHHHHcCCCeEEEEEeccCCHHHHHHHHHHHHHCCCeEEEecCcchhhcchhhhhcCCCC
Confidence 38999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEecCCCCCCChhh-HHHhhcCCCCCeeeEEecCChhhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 028883 139 VIRVPLLSEDWSEDD-VINSIRMPSHVQVASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE 202 (202)
Q Consensus 139 VIgVP~~~~~l~G~D-LlS~vqMP~GvpVatV~I~n~~NAAl~Aa~IL~~~d~~l~~kl~~~~~~ 202 (202)
|||||+++..|+|+| |+|++|||+|+|||||+|++++|||++|+|||++.|++|++||++||++
T Consensus 83 ViGVPv~s~~L~GlDSL~SiVQMP~GvPVaTvaIg~a~NAallAa~ILa~~d~~l~~kl~~~r~~ 147 (162)
T COG0041 83 VIGVPVQSKALSGLDSLLSIVQMPAGVPVATVAIGNAANAALLAAQILAIKDPELAEKLAEFREA 147 (162)
T ss_pred eEeccCccccccchHHHHHHhcCCCCCeeEEEeecchhhHHHHHHHHHcCCCHHHHHHHHHHHHH
Confidence 999999999999999 9999999999999999999999999999999999999999999999973
|
|
| >TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein | Back alignment and domain information |
|---|
| >PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >COG1691 NCAIR mutase (PurE)-related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd08170 GlyDH Glycerol dehydrogenases (GlyDH) catalyzes oxidation of glycerol to dihydroxyacetone in glycerol dissmilation | Back alignment and domain information |
|---|
| >cd08550 GlyDH-like Glycerol_dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08171 GlyDH-like2 Glycerol dehydrogenase-like | Back alignment and domain information |
|---|
| >PRK00843 egsA NAD(P)-dependent glycerol-1-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd08175 G1PDH Glycerol-1-phosphate dehydrogenase (G1PDH) catalyzes the reversible reduction of dihydroxyacetone phosphate (DHAP) to glycerol-1-phosphate (G1P) in an NADH-dependent manner | Back alignment and domain information |
|---|
| >PRK09423 gldA glycerol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like | Back alignment and domain information |
|---|
| >cd08195 DHQS Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis | Back alignment and domain information |
|---|
| >TIGR01357 aroB 3-dehydroquinate synthase | Back alignment and domain information |
|---|
| >cd08549 G1PDH_related Glycerol-1-phosphate_dehydrogenase and related proteins | Back alignment and domain information |
|---|
| >cd08173 Gro1PDH Sn-glycerol-1-phosphate dehydrogenase (Gro1PDH) catalyzes the reversible conversion between dihydroxyacetone phosphate and glycerol-1-phosphate using either NADH or NADPH as a coenzyme | Back alignment and domain information |
|---|
| >cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) | Back alignment and domain information |
|---|
| >cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08183 Fe-ADH2 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >PRK00002 aroB 3-dehydroquinate synthase; Reviewed | Back alignment and domain information |
|---|
| >cd08199 EEVS 2-epi-5-epi-valiolone synthase (EEVS) | Back alignment and domain information |
|---|
| >cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) | Back alignment and domain information |
|---|
| >cd08197 DOIS 2-deoxy-scyllo-inosose synthase (DOIS) catalyzes carbocycle formation from D-glucose-6-phosphate to 2-deoxy-scyllo-inosose through a multistep reaction in the biosynthesis of aminoglycoside antibiotics | Back alignment and domain information |
|---|
| >cd08174 G1PDH-like Glycerol-1-phosphate dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08193 HVD 5-hydroxyvalerate dehydrogenase (HVD) catalyzes the oxidation of 5-hydroxyvalerate to 5-oxovalerate with NAD+ as cofactor | Back alignment and domain information |
|---|
| >cd08194 Fe-ADH6 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08186 Fe-ADH8 Iron-containing alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08176 LPO Lactadehyde:propanediol oxidoreductase (LPO) catalyzes the interconversion between L-lactaldehyde and L-1,2-propanediol in Escherichia coli and other enterobacteria | Back alignment and domain information |
|---|
| >cd08187 BDH Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process | Back alignment and domain information |
|---|
| >cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD) | Back alignment and domain information |
|---|
| >TIGR02638 lactal_redase lactaldehyde reductase | Back alignment and domain information |
|---|
| >cd08192 Fe-ADH7 Iron-containing alcohol dehydrogenases-like, involved in the linear alkylbenzenesulfonate (LAS) degradation pathway | Back alignment and domain information |
|---|
| >PLN02834 3-dehydroquinate synthase | Back alignment and domain information |
|---|
| >cd08178 AAD_C C-terminal alcohol dehydrogenase domain of the acetaldehyde dehydrogenase-alcohol dehydrogenase bifunctional two-domain protein (AAD) | Back alignment and domain information |
|---|
| >PF00465 Fe-ADH: Iron-containing alcohol dehydrogenase ; InterPro: IPR001670 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd08172 GlyDH-like1 Glycerol dehydrogenases-like | Back alignment and domain information |
|---|
| >cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes | Back alignment and domain information |
|---|
| >cd08188 Fe-ADH4 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >PRK15454 ethanol dehydrogenase EutG; Provisional | Back alignment and domain information |
|---|
| >cd08179 NADPH_BDH NADPH-dependent butanol dehydrogenase involved in the butanol and ethanol formation pathway in bacteria | Back alignment and domain information |
|---|
| >cd08169 DHQ-like Dehydroquinate synthase-like which includes dehydroquinate synthase, 2-deoxy-scyllo-inosose synthase, and 2-epi-5-epi-valiolone synthase | Back alignment and domain information |
|---|
| >cd08191 HHD 6-hydroxyhexanoate dehydrogenase (HHD) catalyzes the oxidation of 6-hydroxyhexanoate to 6-oxohexanoate | Back alignment and domain information |
|---|
| >PRK10586 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10624 L-1,2-propanediol oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09860 putative alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08180 PDD 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism | Back alignment and domain information |
|---|
| >cd08190 HOT Hydroxyacid-oxoacid transhydrogenase (HOT) involved in gamma-hydroxybutyrate metabolism | Back alignment and domain information |
|---|
| >PRK06203 aroB 3-dehydroquinate synthase; Reviewed | Back alignment and domain information |
|---|
| >KOG2835 consensus Phosphoribosylamidoimidazole-succinocarboxamide synthase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13685 Fe-ADH_2: Iron-containing alcohol dehydrogenase; PDB: 3CE9_C | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >cd08198 DHQS-like2 Dehydroquinate synthase (DHQS)-like | Back alignment and domain information |
|---|
| >PRK15138 aldehyde reductase; Provisional | Back alignment and domain information |
|---|
| >cd08196 DHQS-like1 Dehydroquinate synthase (DHQS)-like | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >COG0371 GldA Glycerol dehydrogenase and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08184 Fe-ADH3 Iron-containing alcohol dehydrogenases-like | Back alignment and domain information |
|---|
| >COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems | Back alignment and domain information |
|---|
| >PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK13055 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10653 D-ribose transporter subunit RbsB; Provisional | Back alignment and domain information |
|---|
| >cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR | Back alignment and domain information |
|---|
| >TIGR03405 Phn_Fe-ADH phosphonate metabolism-associated iron-containing alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >TIGR03702 lip_kinase_YegS lipid kinase YegS | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species | Back alignment and domain information |
|---|
| >PRK11914 diacylglycerol kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >TIGR00147 lipid kinase, YegS/Rv2252/BmrU family | Back alignment and domain information |
|---|
| >cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >COG3199 Predicted inorganic polyphosphate/ATP-NAD kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli | Back alignment and domain information |
|---|
| >cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK13337 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK00861 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation | Back alignment and domain information |
|---|
| >cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation | Back alignment and domain information |
|---|
| >cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea | Back alignment and domain information |
|---|
| >cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >COG0337 AroB 3-dehydroquinate synthetase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03566 FMN_reduc_MsuE FMN reductase, MsuE subfamily | Back alignment and domain information |
|---|
| >PRK13054 lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] | Back alignment and domain information |
|---|
| >cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis | Back alignment and domain information |
|---|
| >PRK10481 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd00578 L-fuc_L-ara-isomerases L-fucose isomerase (FucIase) and L-arabinose isomerase (AI) family; composed of FucIase, AI and similar proteins | Back alignment and domain information |
|---|
| >cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily | Back alignment and domain information |
|---|
| >cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators | Back alignment and domain information |
|---|
| >PRK10423 transcriptional repressor RbsR; Provisional | Back alignment and domain information |
|---|
| >cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PF10096 DUF2334: Uncharacterized protein conserved in bacteria (DUF2334); InterPro: IPR018763 This group of proteins has no known function | Back alignment and domain information |
|---|
| >cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems | Back alignment and domain information |
|---|
| >TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain | Back alignment and domain information |
|---|
| >PRK11175 universal stress protein UspE; Provisional | Back alignment and domain information |
|---|
| >cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines | Back alignment and domain information |
|---|
| >PRK09492 treR trehalose repressor; Provisional | Back alignment and domain information |
|---|
| >cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >PRK10703 DNA-binding transcriptional repressor PurR; Provisional | Back alignment and domain information |
|---|
| >PRK13059 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs | Back alignment and domain information |
|---|
| >cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >PRK11303 DNA-binding transcriptional regulator FruR; Provisional | Back alignment and domain information |
|---|
| >PRK10076 pyruvate formate lyase II activase; Provisional | Back alignment and domain information |
|---|
| >PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PRK14569 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT | Back alignment and domain information |
|---|
| >PRK10727 DNA-binding transcriptional regulator GalR; Provisional | Back alignment and domain information |
|---|
| >PRK13057 putative lipid kinase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 1o4v_A | 183 | Crystal Structure Of The Catalytic Subunit Of A Pho | 3e-26 | ||
| 3lp6_A | 174 | Crystal Structure Of Rv3275c-E60a From Mycobacteriu | 4e-21 | ||
| 1xmp_A | 170 | Crystal Structure Of Pure (Ba0288) From Bacillus An | 3e-18 | ||
| 4b4k_A | 181 | Crystal Structure Of Bacillus Anthracis Pure Length | 4e-18 | ||
| 3oow_A | 166 | Octameric Structure Of The Phosphoribosylaminoimida | 3e-16 | ||
| 3opq_A | 163 | Phosphoribosylaminoimidazole Carboxylase With Fruct | 4e-16 | ||
| 4grd_A | 173 | Crystal Structure Of Phosphoribosylaminoimidazole C | 1e-14 | ||
| 1u11_A | 182 | Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutas | 1e-13 | ||
| 2fw1_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 1e-13 | ||
| 2fwa_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 1e-12 | ||
| 2fw6_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 1e-12 | ||
| 2fwb_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 2e-12 | ||
| 2fw9_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 2e-12 | ||
| 2fwi_A | 183 | Structure Of Pure (n5-carboxyaminoimidazole Ribonuc | 2e-12 | ||
| 2ywx_A | 157 | Crystal Structure Of Phosphoribosylaminoimidazole C | 5e-12 | ||
| 3ors_A | 163 | Crystal Structure Of N5-Carboxyaminoimidazole Ribon | 2e-10 | ||
| 2fw8_A | 183 | Structure Of Pure (N5-Carboxyaminoimidazole Ribonuc | 5e-10 | ||
| 2nsh_A | 169 | E. Coli Pure H45q Mutant Complexed With Nitro-Air L | 5e-10 | ||
| 2nsl_A | 169 | E. Coli Pure H45n Mutant Complexed With Cair Length | 6e-10 | ||
| 2h31_A | 425 | Crystal Structure Of Human Paics, A Bifunctional Ca | 1e-08 | ||
| 3rgg_A | 159 | Crystal Structure Of Treponema Denticola Pure Bound | 2e-08 | ||
| 3rg8_A | 159 | Crystal Structure Of Treponema Denticola Pure Lengt | 2e-08 | ||
| 2ate_A | 169 | Structure Of The Complex Of Pure With Nitroair Leng | 2e-08 | ||
| 1qcz_A | 169 | Crystal Structure Of E. Coli Pure, An Unusual Mutas | 2e-08 | ||
| 3kuu_A | 174 | Structure Of The Pure Phosphoribosylaminoimidazole | 3e-08 | ||
| 1d7a_A | 161 | Crystal Structure Of E. Coli Pure-Mononucleotide Co | 3e-08 | ||
| 3trh_A | 169 | Structure Of A Phosphoribosylaminoimidazole Carboxy | 5e-06 |
| >pdb|1O4V|A Chain A, Crystal Structure Of The Catalytic Subunit Of A Phosphoribosylaminoimidazole Mutase (Tm0446) From Thermotoga Maritima At 1.77 A Resolution Length = 183 | Back alignment and structure |
|
| >pdb|3LP6|A Chain A, Crystal Structure Of Rv3275c-E60a From Mycobacterium Tubercu 1.7a Resolution Length = 174 | Back alignment and structure |
| >pdb|1XMP|A Chain A, Crystal Structure Of Pure (Ba0288) From Bacillus Anthracis At 1.8 Resolution Length = 170 | Back alignment and structure |
| >pdb|4B4K|A Chain A, Crystal Structure Of Bacillus Anthracis Pure Length = 181 | Back alignment and structure |
| >pdb|3OOW|A Chain A, Octameric Structure Of The Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Francisella Tularensis Subsp. Tularensis Schu S4. Length = 166 | Back alignment and structure |
| >pdb|3OPQ|A Chain A, Phosphoribosylaminoimidazole Carboxylase With Fructose-6-Phosphate Bound To The Central Channel Of The Octameric Protein Structure. Length = 163 | Back alignment and structure |
| >pdb|4GRD|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Burkholderia Cenocepacia J2315 Length = 173 | Back alignment and structure |
| >pdb|1U11|A Chain A, Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophile Acetobacter Aceti Length = 182 | Back alignment and structure |
| >pdb|2FW1|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8.5 Length = 183 | Back alignment and structure |
| >pdb|2FWA|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H89n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 7 Length = 183 | Back alignment and structure |
| >pdb|2FW6|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) Mutant H59n From The Acidophilic Bacterium Acetobacter Aceti, At Ph 5.4 Length = 183 | Back alignment and structure |
| >pdb|2FWB|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2FW9|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59f From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2FWI|A Chain A, Structure Of Pure (n5-carboxyaminoimidazole Ribonucleotide Mutase) H59d, From The Acidophilic Bacterium Acetobacter Aceti, Complexed With 5-aminoimidazole Ribonucleotide (air) Length = 183 | Back alignment and structure |
| >pdb|2YWX|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Methanocaldococcus Jannaschii Length = 157 | Back alignment and structure |
| >pdb|3ORS|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Mutase From Staphylococcus Aureus Length = 163 | Back alignment and structure |
| >pdb|2FW8|A Chain A, Structure Of Pure (N5-Carboxyaminoimidazole Ribonucleotide Mutase) H89g From The Acidophilic Bacterium Acetobacter Aceti, At Ph 8 Length = 183 | Back alignment and structure |
| >pdb|2NSH|A Chain A, E. Coli Pure H45q Mutant Complexed With Nitro-Air Length = 169 | Back alignment and structure |
| >pdb|2NSL|A Chain A, E. Coli Pure H45n Mutant Complexed With Cair Length = 169 | Back alignment and structure |
| >pdb|2H31|A Chain A, Crystal Structure Of Human Paics, A Bifunctional Carboxylase And Synthetase In Purine Biosynthesis Length = 425 | Back alignment and structure |
| >pdb|3RGG|A Chain A, Crystal Structure Of Treponema Denticola Pure Bound To Air Length = 159 | Back alignment and structure |
| >pdb|3RG8|A Chain A, Crystal Structure Of Treponema Denticola Pure Length = 159 | Back alignment and structure |
| >pdb|2ATE|A Chain A, Structure Of The Complex Of Pure With Nitroair Length = 169 | Back alignment and structure |
| >pdb|1QCZ|A Chain A, Crystal Structure Of E. Coli Pure, An Unusual Mutase That Catalyzes The Conversion Of N5-carboxyaminoimidazole Ribonucleotide (n5-cair) To 4-carboxyaminoimidazole Ribonucleotide (cair) In The Purine Biosynthetic Pathway Length = 169 | Back alignment and structure |
| >pdb|3KUU|A Chain A, Structure Of The Pure Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit From Yersinia Pestis Length = 174 | Back alignment and structure |
| >pdb|1D7A|A Chain A, Crystal Structure Of E. Coli Pure-Mononucleotide Complex. Length = 161 | Back alignment and structure |
| >pdb|3TRH|A Chain A, Structure Of A Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit (Pure) From Coxiella Burnetii Length = 169 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 5e-46 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 8e-45 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 1e-42 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 2e-39 | |
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 2e-39 | |
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 9e-39 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 1e-38 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 2e-38 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 7e-38 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 1e-37 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 1e-37 | |
| 2h31_A | 425 | Multifunctional protein ADE2; alpha-beta-alpha, li | 1e-33 |
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Length = 183 | Back alignment and structure |
|---|
Score = 149 bits (378), Expect = 5e-46
Identities = 64/156 (41%), Positives = 92/156 (58%), Gaps = 1/156 (0%)
Query: 48 EENPNGDSTDAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYAL 107
+ + P VGIIM SD DLPVM AA L +FG+ YEI I+ H+ YA
Sbjct: 3 SDKIHHHHHHVPRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAK 62
Query: 108 SAKERGIKIIIVGDGVEAHLSGVAAANSQILVIRVPLLSEDWSEDDVINSI-RMPSHVQV 166
+A+ERGI++II G G AHL G+ A+ + + VI VP+ + + D + SI +MP V V
Sbjct: 63 NAEERGIEVIIAGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPV 122
Query: 167 ASVPRNNAKNAALYAVKVLGIADEDLLERIRKYVEE 202
A+V NNAKNA + A +LGI ++ ++++Y E
Sbjct: 123 ATVAINNAKNAGILAASILGIKYPEIARKVKEYKER 158
|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} Length = 174 | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} PDB: 3rgg_A* Length = 159 | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Length = 169 | Back alignment and structure |
|---|
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Length = 163 | Back alignment and structure |
|---|
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Length = 181 | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Length = 170 | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Length = 157 | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} PDB: 3opq_A* Length = 166 | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Length = 174 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Length = 182 | Back alignment and structure |
|---|
| >2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 3ors_A | 163 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 100.0 | |
| 3lp6_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti; | 100.0 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 100.0 | |
| 1xmp_A | 170 | PURE, phosphoribosylaminoimidazole carboxylase; pu | 100.0 | |
| 3kuu_A | 174 | Phosphoribosylaminoimidazole carboxylase catalyti | 100.0 | |
| 1o4v_A | 183 | Phosphoribosylaminoimidazole mutase PURE; structur | 100.0 | |
| 4grd_A | 173 | N5-CAIR mutase, phosphoribosylaminoimidazole carbo | 100.0 | |
| 3oow_A | 166 | Phosphoribosylaminoimidazole carboxylase,catalyic; | 100.0 | |
| 4b4k_A | 181 | N5-carboxyaminoimidazole ribonucleotide mutase; is | 100.0 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 100.0 | |
| 3rg8_A | 159 | Phosphoribosylaminoimidazole carboxylase, PURE PR; | 100.0 | |
| 2ywx_A | 157 | Phosphoribosylaminoimidazole carboxylase catalyti; | 100.0 | |
| 2h31_A | 425 | Multifunctional protein ADE2; alpha-beta-alpha, li | 100.0 | |
| 3uhj_A | 387 | Probable glycerol dehydrogenase; structural genomi | 97.39 | |
| 1jq5_A | 370 | Glycerol dehydrogenase; oxidoreductase, NAD, glyce | 97.28 | |
| 3ce9_A | 354 | Glycerol dehydrogenase; NP_348253.1, 3-dehydroquin | 97.04 | |
| 3bfj_A | 387 | 1,3-propanediol oxidoreductase; opportunistic path | 97.0 | |
| 1o2d_A | 371 | Alcohol dehydrogenase, iron-containing; TM0920, st | 96.96 | |
| 1ta9_A | 450 | Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosa | 96.82 | |
| 3ox4_A | 383 | Alcohol dehydrogenase 2; iron, NAD, oxidoreductase | 96.8 | |
| 3okf_A | 390 | 3-dehydroquinate synthase; structural genomics, ce | 96.76 | |
| 1sg6_A | 393 | Pentafunctional AROM polypeptide; shikimate pathwa | 96.7 | |
| 3hl0_A | 353 | Maleylacetate reductase; structur genomics, PSI-2, | 96.69 | |
| 1rrm_A | 386 | Lactaldehyde reductase; structural genomics, dehyd | 96.64 | |
| 3jzd_A | 358 | Iron-containing alcohol dehydrogenase; YP_298327.1 | 96.5 | |
| 1vlj_A | 407 | NADH-dependent butanol dehydrogenase; TM0820, stru | 96.47 | |
| 2gru_A | 368 | 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2 | 96.12 | |
| 1oj7_A | 408 | Hypothetical oxidoreductase YQHD; structural genom | 95.99 | |
| 3qbe_A | 368 | 3-dehydroquinate synthase; shikimate pathway, myco | 95.94 | |
| 2pju_A | 225 | Propionate catabolism operon regulatory protein; s | 95.91 | |
| 1xah_A | 354 | Sadhqs, 3-dehydroquinate synthase; shikimate pathw | 95.69 | |
| 3iv7_A | 364 | Alcohol dehydrogenase IV; NP_602249.1, iron-contai | 95.58 | |
| 1ujn_A | 348 | Dehydroquinate synthase; riken structu genomics/pr | 95.4 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 95.32 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 95.26 | |
| 2q5c_A | 196 | NTRC family transcriptional regulator; structural | 95.22 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 95.05 | |
| 3kke_A | 303 | LACI family transcriptional regulator; structural | 94.76 | |
| 1kq3_A | 376 | Glycerol dehydrogenase; structural genomics, joint | 94.62 | |
| 3clh_A | 343 | 3-dehydroquinate synthase; shikimate pathway, arom | 94.05 | |
| 3o1i_D | 304 | Periplasmic protein TORT; ligand free, two compone | 93.76 | |
| 2iks_A | 293 | DNA-binding transcriptional dual regulator; escher | 93.56 | |
| 3gv0_A | 288 | Transcriptional regulator, LACI family; transcript | 93.49 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 93.48 | |
| 3rf7_A | 375 | Iron-containing alcohol dehydrogenase; structural | 93.38 | |
| 3jy6_A | 276 | Transcriptional regulator, LACI family; NYSGXRC, P | 93.3 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 93.12 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 93.08 | |
| 3miz_A | 301 | Putative transcriptional regulator protein, LACI f | 93.03 | |
| 3lft_A | 295 | Uncharacterized protein; ABC, ATPase, cassette, L- | 93.0 | |
| 3s99_A | 356 | Basic membrane lipoprotein; ssgcid, structural gen | 93.0 | |
| 1dbq_A | 289 | Purine repressor; transcription regulation, DNA-bi | 92.87 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 92.75 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 92.73 | |
| 2rgy_A | 290 | Transcriptional regulator, LACI family; 11011J, NY | 92.5 | |
| 1mjh_A | 162 | Protein (ATP-binding domain of protein MJ0577); hy | 92.41 | |
| 2qh8_A | 302 | Uncharacterized protein; conserved domain protein, | 92.21 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 92.06 | |
| 3qk7_A | 294 | Transcriptional regulators; structural genomics, N | 92.04 | |
| 3lkv_A | 302 | Uncharacterized conserved domain protein; ATPase b | 91.92 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 91.9 | |
| 1tjy_A | 316 | Sugar transport protein; protein-ligand complex, s | 91.49 | |
| 2rjo_A | 332 | Twin-arginine translocation pathway signal protei; | 91.47 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 91.46 | |
| 2h3h_A | 313 | Sugar ABC transporter, periplasmic sugar-binding p | 91.15 | |
| 1tq8_A | 163 | Hypothetical protein RV1636; MTCY01B2.28, structur | 91.06 | |
| 1jx6_A | 342 | LUXP protein; protein-ligand complex, signaling pr | 91.02 | |
| 3brs_A | 289 | Periplasmic binding protein/LACI transcriptional; | 91.01 | |
| 3gyb_A | 280 | Transcriptional regulators (LACI-family transcript | 90.93 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 90.75 | |
| 3k9c_A | 289 | Transcriptional regulator, LACI family protein; PS | 90.64 | |
| 3gbv_A | 304 | Putative LACI-family transcriptional regulator; NY | 90.6 | |
| 3bbl_A | 287 | Regulatory protein of LACI family; protein structu | 90.6 | |
| 3jvd_A | 333 | Transcriptional regulators; structural genomics, P | 90.55 | |
| 2qv7_A | 337 | Diacylglycerol kinase DGKB; alpha-beta domain 1, b | 90.53 | |
| 3rot_A | 297 | ABC sugar transporter, periplasmic sugar binding; | 90.46 | |
| 3c3k_A | 285 | Alanine racemase; structural genomics, protein str | 90.41 | |
| 3idf_A | 138 | USP-like protein; universal, stress, PSI, MCSG, st | 90.37 | |
| 2vk2_A | 306 | YTFQ, ABC transporter periplasmic-binding protein | 90.35 | |
| 2fvy_A | 309 | D-galactose-binding periplasmic protein; periplasm | 90.32 | |
| 3dlo_A | 155 | Universal stress protein; unknown function, struct | 90.3 | |
| 3d02_A | 303 | Putative LACI-type transcriptional regulator; peri | 90.09 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 89.97 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 89.93 | |
| 2fn9_A | 290 | Ribose ABC transporter, periplasmic ribose-bindin; | 89.87 | |
| 2dum_A | 170 | Hypothetical protein PH0823; conserved hypothetica | 89.85 | |
| 2qu7_A | 288 | Putative transcriptional regulator; structural gen | 89.76 | |
| 3bil_A | 348 | Probable LACI-family transcriptional regulator; st | 89.73 | |
| 8abp_A | 306 | L-arabinose-binding protein; binding proteins; HET | 89.66 | |
| 3g1w_A | 305 | Sugar ABC transporter; sugar-binding protein, baci | 89.41 | |
| 3h5o_A | 339 | Transcriptional regulator GNTR; transcription regu | 89.17 | |
| 3s3t_A | 146 | Nucleotide-binding protein, universal stress PROT | 89.15 | |
| 2fep_A | 289 | Catabolite control protein A; CCPA, transcriptiona | 89.11 | |
| 2x7x_A | 325 | Sensor protein; transferase, sensor histidine kina | 89.01 | |
| 3uug_A | 330 | Multiple sugar-binding periplasmic receptor CHVE; | 88.72 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 88.56 | |
| 3loq_A | 294 | Universal stress protein; structural genomics, PSI | 88.29 | |
| 3d8u_A | 275 | PURR transcriptional regulator; APC91343.1, vibrio | 88.28 | |
| 2gm3_A | 175 | Unknown protein; AT3G01520, putative ethylene-resp | 88.23 | |
| 3tb6_A | 298 | Arabinose metabolism transcriptional repressor; tr | 88.16 | |
| 3brq_A | 296 | HTH-type transcriptional regulator ASCG; transcrip | 88.07 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 87.9 | |
| 3clk_A | 290 | Transcription regulator; 11017J, PSI-II, NYSGXRC, | 87.63 | |
| 2dri_A | 271 | D-ribose-binding protein; sugar transport; HET: RI | 87.48 | |
| 1qpz_A | 340 | PURA, protein (purine nucleotide synthesis repress | 87.45 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 87.39 | |
| 1gud_A | 288 | ALBP, D-allose-binding periplasmic protein; peripl | 86.83 | |
| 2hsg_A | 332 | Glucose-resistance amylase regulator; CCPA, transc | 86.58 | |
| 2ioy_A | 283 | Periplasmic sugar-binding protein; ribose binding | 86.41 | |
| 3fg9_A | 156 | Protein of universal stress protein USPA family; A | 85.64 | |
| 2dgd_A | 223 | 223AA long hypothetical arylmalonate decarboxylas; | 85.06 | |
| 1byk_A | 255 | Protein (trehalose operon repressor); LACI family, | 84.54 | |
| 2fqx_A | 318 | Membrane lipoprotein TMPC; ABC transport system, l | 84.48 | |
| 3hs3_A | 277 | Ribose operon repressor; PSI-II, NYSGXRC, periplas | 83.86 | |
| 3s81_A | 268 | Putative aspartate racemase; structural genomics, | 83.84 | |
| 3u7r_A | 190 | NADPH-dependent FMN reductase; alpha/beta twisted | 83.77 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 83.69 | |
| 1jye_A | 349 | Lactose operon repressor; gene regulation, protein | 83.63 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 83.47 | |
| 2z08_A | 137 | Universal stress protein family; uncharacterized c | 83.02 | |
| 3s40_A | 304 | Diacylglycerol kinase; structural genomics, the ce | 82.85 | |
| 2o20_A | 332 | Catabolite control protein A; CCPA, transcriptiona | 82.63 | |
| 2bon_A | 332 | Lipid kinase; DAG kinase, transferase; 1.90A {Esch | 82.32 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 82.23 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 81.98 | |
| 3mt0_A | 290 | Uncharacterized protein PA1789; structural genomic | 81.97 | |
| 2xed_A | 273 | Putative maleate isomerase; nicotinic acid catabol | 81.62 | |
| 3olq_A | 319 | Universal stress protein E; structural genomics, P | 81.38 | |
| 2hqb_A | 296 | Transcriptional activator of COMK gene; berkeley s | 81.35 | |
| 3e61_A | 277 | Putative transcriptional repressor of ribose OPER; | 81.19 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 80.93 | |
| 3hgm_A | 147 | Universal stress protein TEAD; rossman fold, signa | 80.62 | |
| 2o6l_A | 170 | UDP-glucuronosyltransferase 2B7; drug metabolism, | 80.05 |
| >3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
Probab=100.00 E-value=7e-62 Score=401.75 Aligned_cols=146 Identities=34% Similarity=0.577 Sum_probs=142.4
Q ss_pred CCCeEEEEecCCCCHHHHHHHHHHHHHhCCCeEEEEEccCCCchHHHHHHHHHhhcCceEEEEecCCcCchhhhhhhccC
Q 028883 57 DAPIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQ 136 (202)
Q Consensus 57 ~~~~V~IimGS~SD~~v~~~a~~~L~~~gi~~ev~V~SaHRtp~~l~~~~~~~~~~g~~ViIa~AG~aa~LpgvvA~~T~ 136 (202)
+.++|+|||||+||+|+|+||+++|++||++||++|+|+||+|+++.+|+++++++|++|||++|||+||||||+|++|+
T Consensus 2 ~~~~V~Iimgs~SD~~v~~~a~~~l~~~gi~~ev~V~SaHR~p~~~~~~~~~a~~~g~~ViIa~AG~aa~LpgvvA~~t~ 81 (163)
T 3ors_A 2 NAMKVAVIMGSSSDWKIMQESCNMLDYFEIPYEKQVVSAHRTPKMMVQFASEARERGINIIIAGAGGAAHLPGMVASLTT 81 (163)
T ss_dssp -CCCEEEEESCGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEEESSCCHHHHHHHHCS
T ss_pred CCCeEEEEECcHHHHHHHHHHHHHHHHcCCCEEEEEECCcCCHHHHHHHHHHHHhCCCcEEEEECCchhhhHHHHHhccC
Confidence 34789999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcEEEecCCCCCCChhh-HHHhhcCCCCCeeeEEecC--ChhhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 028883 137 ILVIRVPLLSEDWSEDD-VINSIRMPSHVQVASVPRN--NAKNAALYAVKVLGIADEDLLERIRKYVEE 202 (202)
Q Consensus 137 ~PVIgVP~~~~~l~G~D-LlS~vqMP~GvpVatV~I~--n~~NAAl~Aa~IL~~~d~~l~~kl~~~~~~ 202 (202)
+||||||+++++|+|+| ||||||||+|+||+||+|| |++|||++|+|||+++|++||+||++||++
T Consensus 82 ~PVIgVP~~~~~l~G~dsLlS~vqmp~GvPVatV~I~~a~~~nAa~lAa~Il~~~d~~l~~kl~~~r~~ 150 (163)
T 3ors_A 82 LPVIGVPIETKSLKGIDSLLSIVQMPGGIPVATTAIGAAGAKNAGILAARMLSIQNPSLVEKLNQYESS 150 (163)
T ss_dssp SCEEEEEECCTTTTTHHHHHHHHTCCTTSCCEECCSTHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHH
T ss_pred CCEEEeeCCCCCCCCHHHHHHHhhCCCCCceEEEEcCCcccHHHHHHHHHHHhCCCHHHHHHHHHHHHH
Confidence 99999999999999999 9999999999999999999 999999999999999999999999999973
|
| >3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* | Back alignment and structure |
|---|
| >1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 | Back alignment and structure |
|---|
| >4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* | Back alignment and structure |
|---|
| >4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A | Back alignment and structure |
|---|
| >3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* | Back alignment and structure |
|---|
| >2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uhj_A Probable glycerol dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1jq5_A Glycerol dehydrogenase; oxidoreductase, NAD, glycerol metabolism; HET: NAD; 1.70A {Geobacillus stearothermophilus} SCOP: e.22.1.2 PDB: 1jpu_A* 1jqa_A* | Back alignment and structure |
|---|
| >3ce9_A Glycerol dehydrogenase; NP_348253.1, 3-dehydroquinate syntha structural genomics, joint center for structural genomics; HET: MSE; 2.37A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3bfj_A 1,3-propanediol oxidoreductase; opportunistic pathogens, decamer, structural genomics,struct proteomics in europe, spine; 2.70A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1o2d_A Alcohol dehydrogenase, iron-containing; TM0920, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE NAP TRS; 1.30A {Thermotoga maritima} SCOP: e.22.1.2 PDB: 1vhd_A* | Back alignment and structure |
|---|
| >1ta9_A Glycerol dehydrogenase; oxidoredu; 1.90A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ox4_A Alcohol dehydrogenase 2; iron, NAD, oxidoreductase; HET: NAD; 2.00A {Zymomonas mobilis} PDB: 3owo_A* | Back alignment and structure |
|---|
| >3okf_A 3-dehydroquinate synthase; structural genomics, center for structural genomics of infec diseases, csgid, NAD, lyase; HET: NAD; 2.50A {Vibrio cholerae o1 biovar eltor} | Back alignment and structure |
|---|
| >1sg6_A Pentafunctional AROM polypeptide; shikimate pathway, aromatic amino acid biosynthesis, DHQS, O form J, domain movement, cyclase, lyase; HET: NAD; 1.70A {Emericella nidulans} SCOP: e.22.1.1 PDB: 1nr5_A* 1nrx_A* 1nua_A 1nva_A* 1nvb_A* 1nvd_A* 1nve_A* 1nvf_A* 1dqs_A* | Back alignment and structure |
|---|
| >3hl0_A Maleylacetate reductase; structur genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE NAD EPE; 1.60A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1rrm_A Lactaldehyde reductase; structural genomics, dehydrogenase, PSI, protein structure initiative; HET: APR; 1.60A {Escherichia coli} SCOP: e.22.1.2 PDB: 2bi4_A* 2bl4_A* | Back alignment and structure |
|---|
| >3jzd_A Iron-containing alcohol dehydrogenase; YP_298327.1, putative alcohol dehedrogenase, structural GENO joint center for structural genomics; HET: MSE NAD PG4 P6G PGE; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1vlj_A NADH-dependent butanol dehydrogenase; TM0820, structural G JCSG, protein structure initiative, PSI, joint center for S genomics; HET: NAP; 1.78A {Thermotoga maritima} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >2gru_A 2-deoxy-scyllo-inosose synthase; aminoglycoside, 2-deoxystreptamine, dehydroquinate synthase, lyase; HET: NAD EXO CAK; 2.15A {Bacillus circulans} PDB: 2d2x_A* | Back alignment and structure |
|---|
| >1oj7_A Hypothetical oxidoreductase YQHD; structural genomics; HET: NZQ; 2.0A {Escherichia coli} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >3qbe_A 3-dehydroquinate synthase; shikimate pathway, mycobacte tuberculosis, nicotinamide adenine dinucleotide (NAD)-depen enzyme; 2.07A {Mycobacterium tuberculosis} PDB: 3qbd_A | Back alignment and structure |
|---|
| >2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 | Back alignment and structure |
|---|
| >1xah_A Sadhqs, 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, open form, form B, domain movement, cyclase; HET: NAD; 2.20A {Staphylococcus aureus} PDB: 1xag_A* 1xai_A* 1xaj_A* 1xal_A* | Back alignment and structure |
|---|
| >3iv7_A Alcohol dehydrogenase IV; NP_602249.1, iron-containing alcohol dehydrogenase, structur genomics, joint center for structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1ujn_A Dehydroquinate synthase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.80A {Thermus thermophilus} SCOP: e.22.1.1 | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >1kq3_A Glycerol dehydrogenase; structural genomics, joint center FO structural genomics, JCSG, protein structure initiative, PS oxidoreductase; 1.50A {Thermotoga maritima} SCOP: e.22.1.2 | Back alignment and structure |
|---|
| >3clh_A 3-dehydroquinate synthase; shikimate pathway, aromatic amino acid biosynthesis, DHQS, amino-acid biosynthesis, cytoplasm, lyase, NAD; HET: NAD; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C | Back alignment and structure |
|---|
| >2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >3rf7_A Iron-containing alcohol dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: NAD EPE; 2.12A {Shewanella denitrificans} | Back alignment and structure |
|---|
| >3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} | Back alignment and structure |
|---|
| >3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} | Back alignment and structure |
|---|
| >3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* | Back alignment and structure |
|---|
| >2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* | Back alignment and structure |
|---|
| >1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* | Back alignment and structure |
|---|
| >3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} | Back alignment and structure |
|---|
| >3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2qv7_A Diacylglycerol kinase DGKB; alpha-beta domain 1, beta sandwich domain 2, protein-ADP COM transferase; HET: ADP; 2.30A {Staphylococcus aureus} SCOP: e.52.1.2 PDB: 2qvl_A | Back alignment and structure |
|---|
| >3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} | Back alignment and structure |
|---|
| >3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* | Back alignment and structure |
|---|
| >3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* | Back alignment and structure |
|---|
| >3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* | Back alignment and structure |
|---|
| >2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A | Back alignment and structure |
|---|
| >3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* | Back alignment and structure |
|---|
| >2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 | Back alignment and structure |
|---|
| >3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* | Back alignment and structure |
|---|
| >1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* | Back alignment and structure |
|---|
| >2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* | Back alignment and structure |
|---|
| >2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* | Back alignment and structure |
|---|
| >3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A | Back alignment and structure |
|---|
| >3u7r_A NADPH-dependent FMN reductase; alpha/beta twisted open-sheet, lavoprotein, quinone reductas oxidoreductase; HET: MSE FNR 2PE; 1.40A {Paracoccus denitrificans} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A | Back alignment and structure |
|---|
| >3s40_A Diacylglycerol kinase; structural genomics, the center for structural genomics of infectious diseases, csgid, transfer; 2.10A {Bacillus anthracis} PDB: 3t5p_A | Back alignment and structure |
|---|
| >2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} | Back alignment and structure |
|---|
| >2bon_A Lipid kinase; DAG kinase, transferase; 1.90A {Escherichia coli} SCOP: e.52.1.2 PDB: 2jgr_A 2p1r_A | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A | Back alignment and structure |
|---|
| >3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} | Back alignment and structure |
|---|
| >2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 | Back alignment and structure |
|---|
| >2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1o4va_ | 169 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 2e-34 | |
| d1qcza_ | 163 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 3e-34 | |
| d1xmpa_ | 155 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 3e-32 | |
| d1u11a_ | 159 | c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoi | 1e-30 |
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) species: Thermotoga maritima [TaxId: 2336]
Score = 118 bits (297), Expect = 2e-34
Identities = 62/145 (42%), Positives = 90/145 (62%), Gaps = 1/145 (0%)
Query: 59 PIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIII 118
P VGIIM SD DLPVM AA L +FG+ YEI I+ H+ YA +A+ERGI++II
Sbjct: 1 PRVGIIMGSDSDLPVMKQAAEILEEFGIDYEITIVSAHRTPDRMFEYAKNAEERGIEVII 60
Query: 119 VGDGVEAHLSGVAAANSQILVIRVPLLSEDWS-EDDVINSIRMPSHVQVASVPRNNAKNA 177
G G AHL G+ A+ + + VI VP+ + + D + + ++MP V VA+V NNAKNA
Sbjct: 61 AGAGGAAHLPGMVASITHLPVIGVPVKTSTLNGLDSLFSIVQMPGGVPVATVAINNAKNA 120
Query: 178 ALYAVKVLGIADEDLLERIRKYVEE 202
+ A +LGI ++ ++++Y E
Sbjct: 121 GILAASILGIKYPEIARKVKEYKER 145
|
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Length = 163 | Back information, alignment and structure |
|---|
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Length = 155 | Back information, alignment and structure |
|---|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Length = 159 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1xmpa_ | 155 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1o4va_ | 169 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1u11a_ | 159 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1qcza_ | 163 | N5-CAIR mutase (phosphoribosylaminoimidazole carbo | 100.0 | |
| d1jq5a_ | 366 | Glycerol dehydrogenase {Bacillus stearothermophilu | 97.44 | |
| d1o2da_ | 359 | Alcohol dehydrogenase TM0920 {Thermotoga maritima | 96.7 | |
| d1vlja_ | 398 | NADH-dependent butanol dehydrogenase A (TM0820) {T | 96.38 | |
| d2dria_ | 271 | D-ribose-binding protein {Escherichia coli, strain | 95.99 | |
| d1rrma_ | 385 | Lactaldehyde reductase FucO {Escherichia coli [Tax | 95.89 | |
| d2bona1 | 295 | Lipid kinase YegS {Escherichia coli [TaxId: 562]} | 95.83 | |
| d2pjua1 | 186 | Propionate catabolism operon regulatory protein Pr | 94.99 | |
| d2nzug1 | 275 | Glucose-resistance amylase regulator CcpA, C-termi | 93.85 | |
| d1kq3a_ | 364 | Glycerol dehydrogenase {Thermotoga maritima [TaxId | 93.71 | |
| d1oj7a_ | 390 | Hypothetical oxidoreductase yqhD {Escherichia coli | 93.65 | |
| d1tjya_ | 316 | AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 | 93.3 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 92.8 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 92.4 | |
| d1guda_ | 288 | D-allose-binding protein {Escherichia coli [TaxId: | 92.37 | |
| d1mjha_ | 160 | "Hypothetical" protein MJ0577 {Archaeon Methanococ | 89.91 | |
| d1zl0a2 | 167 | LD-carboxypeptidase A, N-terminal domain {Pseudomo | 88.94 | |
| d1sg6a_ | 389 | Dehydroquinate synthase, DHQS {Aspergillus nidulan | 88.72 | |
| d3etja1 | 79 | N5-carboxyaminoimidazole ribonucleotide synthetase | 88.43 | |
| d2qv7a1 | 312 | Diacylglycerol kinase DgkB {Staphylococcus aureus | 88.1 | |
| d2fvya1 | 305 | Galactose/glucose-binding protein {Escherichia col | 88.01 | |
| d1ujna_ | 347 | Dehydroquinate synthase, DHQS {Thermus thermophilu | 87.8 | |
| d2gm3a1 | 171 | Putative ethylene-responsive protein AT3g01520/F4P | 87.56 | |
| d1jx6a_ | 338 | Quorum-sensing signal (autoinducer-2) binding prot | 86.55 | |
| d1utaa_ | 77 | Cell division protein FtsN {Escherichia coli [TaxI | 86.38 | |
| d8abpa_ | 305 | L-arabinose-binding protein {Escherichia coli [Tax | 85.63 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 85.0 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 84.96 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 84.45 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 82.75 | |
| d1uz5a3 | 148 | MoeA, central domain {Archaeon Pyrococcus horikosh | 82.65 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 82.49 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 81.2 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 80.85 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 80.64 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 80.4 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 80.32 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 80.03 |
| >d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) family: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) domain: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) species: Bacillus anthracis [TaxId: 1392]
Probab=100.00 E-value=7e-59 Score=379.34 Aligned_cols=145 Identities=35% Similarity=0.573 Sum_probs=141.8
Q ss_pred CCeEEEEecCCCCHHHHHHHHHHHHHhCCCeEEEEEccCCCchHHHHHHHHHhhcCceEEEEecCCcCchhhhhhhccCC
Q 028883 58 APIVGIIMESDLDLPVMNDAARTLSDFGVPYEIKILPPHQNCKEALSYALSAKERGIKIIIVGDGVEAHLSGVAAANSQI 137 (202)
Q Consensus 58 ~~~V~IimGS~SD~~v~~~a~~~L~~~gi~~ev~V~SaHRtp~~l~~~~~~~~~~g~~ViIa~AG~aa~LpgvvA~~T~~ 137 (202)
+|+|+|||||+||+|+|+||.++|++|||+||++|+||||+|+++.+|++++++++++|||++|||+||||||+|++|++
T Consensus 1 K~~V~IimGS~SD~~~~~~a~~~L~~~gi~~~~~v~SAHrtp~rl~~~~~~~~~~~~~viIa~AG~aa~Lpgvva~~t~~ 80 (155)
T d1xmpa_ 1 KSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDYMFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNL 80 (155)
T ss_dssp CCSEEEEESSGGGHHHHHHHHHHHHHTTCCEEEEECCTTTSHHHHHHHHHHTTTTTCCEEEEEEESSCCHHHHHHTTCCS
T ss_pred CCEEEEEECcHhhHHHHHHHHHHHHHcCCcEEEEEechhcChHHHHHHHHHHHhhcceEEEeecccCCCchhHHHHhccc
Confidence 37899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cEEEecCCCCCCChhh-HHHhhcCCCCCeeeEEecC--ChhhHHHHHHHHHccCCHHHHHHHHHHHhC
Q 028883 138 LVIRVPLLSEDWSEDD-VINSIRMPSHVQVASVPRN--NAKNAALYAVKVLGIADEDLLERIRKYVEE 202 (202)
Q Consensus 138 PVIgVP~~~~~l~G~D-LlS~vqMP~GvpVatV~I~--n~~NAAl~Aa~IL~~~d~~l~~kl~~~~~~ 202 (202)
||||||+++++++|+| |||++|||+|+||+||+|| |++|||++|+|||++.|++|++||++||++
T Consensus 81 PVIgVP~~~~~~~G~d~llS~vqMP~Gipv~tv~v~~~~~~nAa~~A~~Il~~~d~~l~~~l~~~r~~ 148 (155)
T d1xmpa_ 81 PVIGVPVQSKALNGLDSLLSIVQMPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREA 148 (155)
T ss_dssp CEEEEEECCTTTTTHHHHHHHHCCCTTCCCEECCSSHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred eEEEEEeecccCcCcccHHHHHhCccCCCceEEEecCcchHHHHHHHHHHHccCCHHHHHHHHHHHHH
Confidence 9999999999999999 9999999999999999999 889999999999999999999999999974
|
| >d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} | Back information, alignment and structure |
|---|
| >d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o2da_ e.22.1.2 (A:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vlja_ e.22.1.2 (A:) NADH-dependent butanol dehydrogenase A (TM0820) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rrma_ e.22.1.2 (A:) Lactaldehyde reductase FucO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oj7a_ e.22.1.2 (A:) Hypothetical oxidoreductase yqhD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zl0a2 c.23.16.7 (A:3-169) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sg6a_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qv7a1 e.52.1.2 (A:1-312) Diacylglycerol kinase DgkB {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ujna_ e.22.1.1 (A:) Dehydroquinate synthase, DHQS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1utaa_ d.58.52.1 (A:) Cell division protein FtsN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Archaeon Pyrococcus horikoshii, PH0582 [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|