Citrus Sinensis ID: 029161

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MNKTMIRGSSSSDSSRALSNGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSIPYNRL
ccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHcccccccccccccccEEEccccccccccccEEcccccccccHHHHHHHHHHHHccEEEEEEEcccccccccccccEEEEcccHHHHHHHHHHHccccccccccccccc
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHccccccccccccEEEEEEcccccccHHHHEEEEcccccccHHHHHHHHHHHHHcccEEEEEEcHHHHHHccccccEEEEcccHHHHHHHHHHHHcccccEEEcccccc
mnktmirgssssdssralsnGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGAlkdvigiptsvasaneaavagipldqyrdtsqidfafddadiieeGTLVAVIGrqqpkgdesiiQEKSVLNAADKLVFMVSEnqykgvldgsvpvlvqpvnwmeTAEEIDDLfigdaevfsipynrl
mnktmirgssssdssralSNGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQykgvldgsvpVLVQPVNWMETAEEIDDLFIGDAEVFSIPYNRL
MNKTMIRGssssdssralsngssVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQidfafddadiiEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSIPYNRL
***********************VLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQ******SIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSIPY***
*******************************TVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSIPYN**
*******************NGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSIPYNRL
**********************SVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKTMIRGSSSSDSSRALSNGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVFSIPYNRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
Q7VA25237 Ribose-5-phosphate isomer yes no 0.681 0.569 0.365 1e-15
Q9ZU38265 Probable ribose-5-phospha no no 0.707 0.528 0.342 9e-15
Q5FQ98231 Ribose-5-phosphate isomer yes no 0.666 0.571 0.354 6e-13
Q0I7L2238 Ribose-5-phosphate isomer yes no 0.666 0.554 0.359 8e-13
Q72J47227 Ribose-5-phosphate isomer yes no 0.681 0.594 0.358 9e-13
B2G5S0227 Ribose-5-phosphate isomer yes no 0.616 0.537 0.341 3e-12
A5VI94227 Ribose-5-phosphate isomer yes no 0.616 0.537 0.341 3e-12
Q5SIR5227 Ribose-5-phosphate isomer yes no 0.681 0.594 0.351 3e-12
Q7NPM5230 Ribose-5-phosphate isomer yes no 0.686 0.591 0.324 3e-12
Q3AHX1239 Ribose-5-phosphate isomer yes no 0.712 0.589 0.355 5e-12
>sp|Q7VA25|RPIA_PROMA Ribose-5-phosphate isomerase A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpiA PE=3 SV=1 Back     alignment and function desciption
 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 42  ITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDT 101
           I  GM++GLGSG  +A+ I+ +G +L+ G+LK++IG+PTS      A+  GIPL  +   
Sbjct: 20  IKDGMILGLGSGSTAALMIKSLGEKLKEGSLKEIIGVPTSFQGEVLASQLGIPLRAFSAV 79

Query: 102 SQIDFAFDDADIIEEGTLVAVIGRQQPKGDESI-IQEKSVLNAADKLVFMVSENQY--KG 158
           S+ID A D AD ++          Q  KG  +  +QEK V + AD+ V +V   +   K 
Sbjct: 80  SKIDLAIDGADEVDPNF-------QLIKGGGACHVQEKLVASIADRFVVVVDSTKIVEKL 132

Query: 159 VLDGSVPVLVQPVNWMETAEEIDDL 183
            L+  +PV V P  W    +E++DL
Sbjct: 133 NLEFKLPVEVLPAAWKLVQKELNDL 157

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) (taxid: 167539)
EC: 5EC: .EC: 3EC: .EC: 1EC: .EC: 6
>sp|Q9ZU38|RPIA_ARATH Probable ribose-5-phosphate isomerase OS=Arabidopsis thaliana GN=At2g01290 PE=2 SV=1 Back     alignment and function description
>sp|Q5FQ98|RPIA_GLUOX Ribose-5-phosphate isomerase A OS=Gluconobacter oxydans (strain 621H) GN=rpiA PE=3 SV=1 Back     alignment and function description
>sp|Q0I7L2|RPIA_SYNS3 Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain CC9311) GN=rpiA PE=3 SV=1 Back     alignment and function description
>sp|Q72J47|RPIA_THET2 Ribose-5-phosphate isomerase A OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpiA PE=1 SV=1 Back     alignment and function description
>sp|B2G5S0|RPIA_LACRJ Ribose-5-phosphate isomerase A OS=Lactobacillus reuteri (strain JCM 1112) GN=rpiA PE=3 SV=1 Back     alignment and function description
>sp|A5VI94|RPIA_LACRD Ribose-5-phosphate isomerase A OS=Lactobacillus reuteri (strain DSM 20016) GN=rpiA PE=3 SV=1 Back     alignment and function description
>sp|Q5SIR5|RPIA_THET8 Ribose-5-phosphate isomerase A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpiA PE=3 SV=1 Back     alignment and function description
>sp|Q7NPM5|RPIA_GLOVI Ribose-5-phosphate isomerase A OS=Gloeobacter violaceus (strain PCC 7421) GN=rpiA PE=3 SV=1 Back     alignment and function description
>sp|Q3AHX1|RPIA_SYNSC Ribose-5-phosphate isomerase A OS=Synechococcus sp. (strain CC9605) GN=rpiA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
225444205294 PREDICTED: ribose-5-phosphate isomerase 0.924 0.622 0.675 7e-67
118489032285 unknown [Populus trichocarpa x Populus d 0.848 0.589 0.722 1e-66
224115580285 predicted protein [Populus trichocarpa] 0.848 0.589 0.716 4e-66
449519058295 PREDICTED: LOW QUALITY PROTEIN: probable 0.853 0.572 0.678 2e-64
449435558295 PREDICTED: probable ribose-5-phosphate i 0.853 0.572 0.678 2e-64
356555958291 PREDICTED: ribose-5-phosphate isomerase 0.883 0.601 0.655 3e-64
357448681258 Ribose-5-phosphate isomerase A [Medicago 0.878 0.674 0.653 7e-62
147857157167 hypothetical protein VITISV_005604 [Viti 0.732 0.868 0.744 3e-58
255578039262 ribose-5-phosphate isomerase, putative [ 0.752 0.568 0.697 2e-57
297791367290 predicted protein [Arabidopsis lyrata su 0.858 0.586 0.579 7e-52
>gi|225444205|ref|XP_002270834.1| PREDICTED: ribose-5-phosphate isomerase A [Vitis vinifera] gi|296089229|emb|CBI39001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  258 bits (660), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 127/188 (67%), Positives = 151/188 (80%), Gaps = 5/188 (2%)

Query: 7   RGSSSSDSSRALSNGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQ 66
           R    S +   L++ SS L +AAKHTV     DTYI SGMV+GLGSG AS MAI+Y+GRQ
Sbjct: 32  RCRFPSVTRSCLADASSALLQAAKHTV-----DTYIKSGMVIGLGSGHASDMAIQYLGRQ 86

Query: 67  LRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQ 126
           LR GALKD+ GIP SVASA+EAA  GIPL  Y+D SQIDFAFDDAD+IEEGTLVA+IGR+
Sbjct: 87  LRTGALKDITGIPMSVASASEAAKVGIPLGHYQDCSQIDFAFDDADVIEEGTLVAIIGRR 146

Query: 127 QPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIG 186
           + +G+ESIIQEKS+L AADKLVF++ E QYK  L+G +PVLVQ +NWMETAEEIDDLF+G
Sbjct: 147 RLQGNESIIQEKSILKAADKLVFIIQEKQYKCDLEGLIPVLVQSLNWMETAEEIDDLFLG 206

Query: 187 DAEVFSIP 194
           DAEV+  P
Sbjct: 207 DAEVWRRP 214

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118489032|gb|ABK96323.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|224115580|ref|XP_002317071.1| predicted protein [Populus trichocarpa] gi|222860136|gb|EEE97683.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449519058|ref|XP_004166552.1| PREDICTED: LOW QUALITY PROTEIN: probable ribose-5-phosphate isomerase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435558|ref|XP_004135562.1| PREDICTED: probable ribose-5-phosphate isomerase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356555958|ref|XP_003546296.1| PREDICTED: ribose-5-phosphate isomerase A-like [Glycine max] Back     alignment and taxonomy information
>gi|357448681|ref|XP_003594616.1| Ribose-5-phosphate isomerase A [Medicago truncatula] gi|355483664|gb|AES64867.1| Ribose-5-phosphate isomerase A [Medicago truncatula] Back     alignment and taxonomy information
>gi|147857157|emb|CAN79225.1| hypothetical protein VITISV_005604 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255578039|ref|XP_002529890.1| ribose-5-phosphate isomerase, putative [Ricinus communis] gi|223530617|gb|EEF32493.1| ribose-5-phosphate isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297791367|ref|XP_002863568.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297309403|gb|EFH39827.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2163436296 AT5G44520 [Arabidopsis thalian 0.818 0.547 0.523 1.4e-41
TAIR|locus:2038801265 RPI2 "ribose-5-phosphate isome 0.757 0.566 0.312 2.1e-13
TAIR|locus:2026296267 RSW10 "RADIAL SWELLING 10" [Ar 0.696 0.516 0.340 2.7e-13
TAIR|locus:2084898276 EMB3119 "EMBRYO DEFECTIVE 3119 0.691 0.496 0.328 1.9e-11
TIGR_CMR|BA_2791220 BA_2791 "ribose 5-phosphate is 0.681 0.613 0.246 1.3e-06
TIGR_CMR|SPO_1327262 SPO_1327 "ribose 5-phosphate i 0.691 0.522 0.275 1.5e-06
WB|WBGene00015101251 rpia-1 [Caenorhabditis elegans 0.691 0.545 0.253 2e-06
TAIR|locus:2163436 AT5G44520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 441 (160.3 bits), Expect = 1.4e-41, P = 1.4e-41
 Identities = 88/168 (52%), Positives = 120/168 (71%)

Query:    25 LFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVAS 84
             L RAA HTV     D Y+ SGM++GLGSG+AS  AI Y+G+QL +G+L +V+G+P S  S
Sbjct:    40 LLRAAHHTV-----DNYVKSGMIIGLGSGEASDFAIRYLGQQLGSGSLHNVVGVPMSARS 94

Query:    85 ANEAAVAGIPLDQYRDTSQXXXXXXXXXXXEEGTLVAVIGRQQP-KGDESIIQEKSVLNA 143
             A+EAA  GIPL+ YRD  Q           EE TL+AVIGR++  + D+ I+++KS++  
Sbjct:    95 ASEAAKYGIPLEYYRDGVQIDFAFHDADAVEENTLIAVIGRRRSSQEDDYILKQKSIVKV 154

Query:   144 ADKLVFMVSENQYKGVLDGSVPVLVQPVNWMETAEEIDDLFIGDAEVF 191
             AD+ VFM+ E QYK  L+GS+PVLVQ +NW+  AEEIDDL++GDAEV+
Sbjct:   155 ADEAVFMIKEEQYKAGLEGSIPVLVQSLNWLAIAEEIDDLYLGDAEVW 202
GO:0004751 "ribose-5-phosphate isomerase activity" evidence=IEA
GO:0009052 "pentose-phosphate shunt, non-oxidative branch" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
TAIR|locus:2038801 RPI2 "ribose-5-phosphate isomerase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026296 RSW10 "RADIAL SWELLING 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084898 EMB3119 "EMBRYO DEFECTIVE 3119" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2791 BA_2791 "ribose 5-phosphate isomerase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1327 SPO_1327 "ribose 5-phosphate isomerase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
WB|WBGene00015101 rpia-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.1.6LOW CONFIDENCE prediction!
3rd Layer5.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
cd01398213 cd01398, RPI_A, RPI_A: Ribose 5-phosphate isomeras 4e-34
PLN02384264 PLN02384, PLN02384, ribose-5-phosphate isomerase 6e-20
TIGR00021218 TIGR00021, rpiA, ribose 5-phosphate isomerase 6e-19
COG0120227 COG0120, RpiA, Ribose 5-phosphate isomerase [Carbo 8e-19
PRK00702220 PRK00702, PRK00702, ribose-5-phosphate isomerase A 7e-15
pfam06026172 pfam06026, Rib_5-P_isom_A, Ribose 5-phosphate isom 3e-09
PRK13978228 PRK13978, PRK13978, ribose-5-phosphate isomerase A 2e-05
cd00458169 cd00458, SugarP_isomerase, SugarP_isomerase: Sugar 1e-04
>gnl|CDD|238692 cd01398, RPI_A, RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway Back     alignment and domain information 
 Score =  119 bits (302), Expect = 4e-34
 Identities = 49/158 (31%), Positives = 79/158 (50%), Gaps = 14/158 (8%)

Query: 27  RAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASAN 86
            AA+  V       Y+  GMV+GLG+G   A  IE +G ++R     +++G+PTS  +  
Sbjct: 4   AAARAAVD------YVEDGMVIGLGTGSTVAYFIEALGERVREE-GLNIVGVPTSFQTEE 56

Query: 87  EAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADK 146
            A   GIPL    +  ++D A D AD ++   L  + G     G  ++++EK V +AA K
Sbjct: 57  LARELGIPLTDLDEVPRLDLAIDGADEVDP-DLNLIKG-----GGGALLREKIVASAAKK 110

Query: 147 LVFMVSENQYKGVLD-GSVPVLVQPVNWMETAEEIDDL 183
            + +  E++    L    +PV V P  W   A E++ L
Sbjct: 111 FIVIADESKLVERLGEFPLPVEVVPFAWSYVARELEKL 148

This reaction leads to the conversion of phosphosugars into glycolysis intermediates, which are precursors for the synthesis of amino acids, vitamins, nucleotides, and cell wall components. In plants, RPI is part of the Calvin cycle as ribulose 5-phosphate is the carbon dioxide receptor in the first dark reaction of photosynthesis. There are two unrelated types of RPIs (A and B), which catalyze the same reaction, at least one type of RPI is present in an organism. RPI_A is more widely distributed than RPI_B in bacteria, eukaryotes, and archaea. Length = 213
>gnl|CDD|215215 PLN02384, PLN02384, ribose-5-phosphate isomerase Back     alignment and domain information
>gnl|CDD|232786 TIGR00021, rpiA, ribose 5-phosphate isomerase Back     alignment and domain information
>gnl|CDD|223198 COG0120, RpiA, Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234816 PRK00702, PRK00702, ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>gnl|CDD|218860 pfam06026, Rib_5-P_isom_A, Ribose 5-phosphate isomerase A (phosphoriboisomerase A) Back     alignment and domain information
>gnl|CDD|184433 PRK13978, PRK13978, ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>gnl|CDD|238258 cd00458, SugarP_isomerase, SugarP_isomerase: Sugar Phosphate Isomerase family; includes type A ribose 5-phosphate isomerase (RPI_A), glucosamine-6-phosphate (GlcN6P) deaminase, and 6-phosphogluconolactonase (6PGL) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
PLN02384264 ribose-5-phosphate isomerase 100.0
PRK13978228 ribose-5-phosphate isomerase A; Provisional 100.0
COG0120227 RpiA Ribose 5-phosphate isomerase [Carbohydrate tr 100.0
PRK00702220 ribose-5-phosphate isomerase A; Provisional 100.0
TIGR00021218 rpiA ribose 5-phosphate isomerase. This model desc 100.0
cd01398213 RPI_A RPI_A: Ribose 5-phosphate isomerase type A ( 100.0
KOG3075261 consensus Ribose 5-phosphate isomerase [Carbohydra 100.0
PF06026173 Rib_5-P_isom_A: Ribose 5-phosphate isomerase A (ph 99.97
PF00455161 DeoRC: DeoR C terminal sensor domain; InterPro: IP 99.95
PRK10681252 DNA-binding transcriptional repressor DeoR; Provis 99.93
PRK10906252 DNA-binding transcriptional repressor GlpR; Provis 99.93
PRK09802269 DNA-binding transcriptional regulator AgaR; Provis 99.93
PRK10411240 DNA-binding transcriptional activator FucR; Provis 99.92
COG1349253 GlpR Transcriptional regulators of sugar metabolis 99.92
PRK13509251 transcriptional repressor UlaR; Provisional 99.92
PRK10434256 srlR DNA-bindng transcriptional repressor SrlR; Pr 99.92
TIGR00524303 eIF-2B_rel eIF-2B alpha/beta/delta-related unchara 98.22
PRK08335275 translation initiation factor IF-2B subunit alpha; 98.19
COG1184301 GCD2 Translation initiation factor 2B subunit, eIF 98.15
TIGR00511301 ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e 98.14
PRK08535310 translation initiation factor IF-2B subunit delta; 98.13
TIGR00512331 salvage_mtnA S-methyl-5-thioribose-1-phosphate iso 98.1
PRK05720344 mtnA methylthioribose-1-phosphate isomerase; Revie 97.93
PF01008282 IF-2B: Initiation factor 2 subunit family; InterPr 97.77
KOG1466313 consensus Translation initiation factor 2B, alpha 97.69
PRK06371329 translation initiation factor IF-2B subunit alpha; 97.66
PRK05772363 translation initiation factor IF-2B subunit alpha; 97.66
PRK06036339 translation initiation factor IF-2B subunit alpha; 97.5
COG2057225 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, 97.23
PRK08334356 translation initiation factor IF-2B subunit beta; 97.13
PRK06372253 translation initiation factor IF-2B subunit delta; 96.97
TIGR02428207 pcaJ_scoB_fam 3-oxoacid CoA-transferase, B subunit 96.56
PF04198255 Sugar-bind: Putative sugar-binding domain; InterPr 96.51
PRK09920219 acetyl-CoA:acetoacetyl-CoA transferase subunit alp 96.32
COG1788220 AtoD Acyl CoA:acetate/3-ketoacid CoA transferase, 96.16
TIGR02429222 pcaI_scoA_fam 3-oxoacid CoA-transferase, A subunit 96.08
COG2390321 DeoR Transcriptional regulator, contains sigma fac 95.88
KOG1465353 consensus Translation initiation factor 2B, beta s 95.43
PRK15418318 transcriptional regulator LsrR; Provisional 95.22
TIGR03458 485 YgfH_subfam succinate CoA transferases. A closely 95.18
TIGR01584 492 citF citrate lyase, alpha subunit. This is a model 94.89
cd00458169 SugarP_isomerase SugarP_isomerase: Sugar Phosphate 94.08
PF02550198 AcetylCoA_hydro: Acetyl-CoA hydrolase/transferase 93.25
PF04223 466 CitF: Citrate lyase, alpha subunit (CitF); InterPr 93.18
KOG1467556 consensus Translation initiation factor 2B, delta 92.25
COG0427 501 ACH1 Acetyl-CoA hydrolase [Energy production and c 90.17
COG3051 513 CitF Citrate lyase, alpha subunit [Energy producti 88.25
COG0182346 Predicted translation initiation factor 2B subunit 86.79
PF04223466 CitF: Citrate lyase, alpha subunit (CitF); InterPr 86.59
PF01144217 CoA_trans: Coenzyme A transferase; InterPro: IPR00 85.35
>PLN02384 ribose-5-phosphate isomerase Back     alignment and domain information 
Probab=100.00  E-value=2.4e-43  Score=304.86  Aligned_cols=174  Identities=35%  Similarity=0.548  Sum_probs=158.3

Q ss_pred             ccccCCCCCchHHhhccCHHHHHHHHHHHhccccccccCCCCCEEEECcchhHHHHHHHHHHHhhcCCCCCeEEEcCcHH
Q 029161            4 TMIRGSSSSDSSRALSNGSSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVA   83 (198)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~K~~IA~~Aa~~~~~~~~I~~g~~IgLgsGST~~~la~~L~~~~~~~~l~~itvVTnS~~   83 (198)
                      .|+.||||-    .|+ ..+.|+++|++|+      ++|++||+||||||||+.+++++|+++.+.+.++++++||+|.+
T Consensus        20 ~~~~~~~~~----~m~-~~~~K~~aA~~A~------~~V~~gmvVGLGTGSTv~~~I~~La~r~~~~~l~~I~~VpTS~~   88 (264)
T PLN02384         20 SMLSPSSPV----ILT-QDELKKIAAYKAV------EFVESGMVLGLGTGSTAKHAVDRIGELLRQGKLKNIIGIPTSKK   88 (264)
T ss_pred             CcCCCCCCC----CCC-HHHHHHHHHHHHH------HhccCCCEEEecchHHHHHHHHHHHHhhhhccccceEEEcCcHH
Confidence            477777773    332 2447999999999      99999999999999999999999999987777778999999999


Q ss_pred             HHHHHHHcCCCEEEcCCCCcccEEEeecCccCCCCcceeecCCCCCcchhHHHHHHHHHhcCcEEEEEcCCccccCCC--
Q 029161           84 SANEAAVAGIPLDQYRDTSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLD--  161 (198)
Q Consensus        84 ~a~~l~~~gi~v~~l~~~~~iD~af~Gad~Vd~~~~~~ikG~g~~~~~ea~~~ek~i~~~s~~~ivlaD~sK~~~~lg--  161 (198)
                      ++.+|+++|+++..+.+..++|++|||||+||+ ++++|||||+     |+++||+++++|+++|+|+|++|++++||  
T Consensus        89 T~~~a~~~GIpl~~l~~v~~iDiaiDGADEId~-~lnlIKGGGg-----allrEKivA~~A~~~IiI~DesK~V~~Lg~~  162 (264)
T PLN02384         89 THEQAVSLGIPLSDLDSHPVVDLAIDGADEVDP-NLNLVKGRGG-----SLLREKMIEGACKKFVVIVDESKLVKHIGGS  162 (264)
T ss_pred             HHHHHHHcCCcEeccccCCcccEEEECCceeCC-CCCEEEeCcH-----HHHHHHHHHHhcCeEEEEEeCcceecccCCC
Confidence            999999999999999998899999999999999 8999999999     99999999999999999999999999997  


Q ss_pred             -CcccEEEecCCHHHHHHHHHhhcC--CCceeEeCC
Q 029161          162 -GSVPVLVQPVNWMETAEEIDDLFI--GDAEVFSIP  194 (198)
Q Consensus       162 -~~ipvEV~p~~~~~v~~~l~~lf~--g~~~~~R~~  194 (198)
                       .|+||||+|++|.+|.++|+++|.  |..+.+|++
T Consensus       163 ~~plPVEV~p~a~~~v~~~L~~l~~~~g~~~~lR~~  198 (264)
T PLN02384        163 GLAMPVEVVPFCWKFTAEKLQSLFEYAGCVAKLRTK  198 (264)
T ss_pred             CCCEEEEECccHHHHHHHHHHHHhhccCCceEEecc
Confidence             389999999999999999999874  567888975

>PRK13978 ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>COG0120 RpiA Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK00702 ribose-5-phosphate isomerase A; Provisional Back     alignment and domain information
>TIGR00021 rpiA ribose 5-phosphate isomerase Back     alignment and domain information
>cd01398 RPI_A RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway Back     alignment and domain information
>KOG3075 consensus Ribose 5-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06026 Rib_5-P_isom_A: Ribose 5-phosphate isomerase A (phosphoriboisomerase A); InterPro: IPR004788 Ribose 5-phosphate isomerase, also known as phosphoriboisomerase, catalyses the reversible conversion of D-ribose 5-phosphate to D-ribulose 5-phosphate, the first step in the non-oxidative branch of the pentose phosphate pathway [] Back     alignment and domain information
>PF00455 DeoRC: DeoR C terminal sensor domain; InterPro: IPR014036 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK10681 DNA-binding transcriptional repressor DeoR; Provisional Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>TIGR00524 eIF-2B_rel eIF-2B alpha/beta/delta-related uncharacterized proteins Back     alignment and domain information
>PRK08335 translation initiation factor IF-2B subunit alpha; Validated Back     alignment and domain information
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00511 ribulose_e2b2 ribose-1,5-bisphosphate isomerase, e2b2 family Back     alignment and domain information
>PRK08535 translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>TIGR00512 salvage_mtnA S-methyl-5-thioribose-1-phosphate isomerase Back     alignment and domain information
>PRK05720 mtnA methylthioribose-1-phosphate isomerase; Reviewed Back     alignment and domain information
>PF01008 IF-2B: Initiation factor 2 subunit family; InterPro: IPR000649 Initiation factor 2 binds to Met-tRNA, GTP and the small ribosomal subunit Back     alignment and domain information
>KOG1466 consensus Translation initiation factor 2B, alpha subunit (eIF-2Balpha/GCN3) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06371 translation initiation factor IF-2B subunit alpha; Provisional Back     alignment and domain information
>PRK05772 translation initiation factor IF-2B subunit alpha; Provisional Back     alignment and domain information
>PRK06036 translation initiation factor IF-2B subunit alpha; Provisional Back     alignment and domain information
>COG2057 AtoA Acyl CoA:acetate/3-ketoacid CoA transferase, beta subunit [Lipid metabolism] Back     alignment and domain information
>PRK08334 translation initiation factor IF-2B subunit beta; Validated Back     alignment and domain information
>PRK06372 translation initiation factor IF-2B subunit delta; Provisional Back     alignment and domain information
>TIGR02428 pcaJ_scoB_fam 3-oxoacid CoA-transferase, B subunit Back     alignment and domain information
>PF04198 Sugar-bind: Putative sugar-binding domain; InterPro: IPR007324 This probable domain is found in bacterial transcriptional regulators such as DeoR and SorC Back     alignment and domain information
>PRK09920 acetyl-CoA:acetoacetyl-CoA transferase subunit alpha; Provisional Back     alignment and domain information
>COG1788 AtoD Acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR02429 pcaI_scoA_fam 3-oxoacid CoA-transferase, A subunit Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>KOG1465 consensus Translation initiation factor 2B, beta subunit (eIF-2Bbeta/GCD7) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15418 transcriptional regulator LsrR; Provisional Back     alignment and domain information
>TIGR03458 YgfH_subfam succinate CoA transferases Back     alignment and domain information
>TIGR01584 citF citrate lyase, alpha subunit Back     alignment and domain information
>cd00458 SugarP_isomerase SugarP_isomerase: Sugar Phosphate Isomerase family; includes type A ribose 5-phosphate isomerase (RPI_A), glucosamine-6-phosphate (GlcN6P) deaminase, and 6-phosphogluconolactonase (6PGL) Back     alignment and domain information
>PF02550 AcetylCoA_hydro: Acetyl-CoA hydrolase/transferase N-terminal domain; InterPro: IPR003702 This family contains several enzymes which take part in pathways involving acetyl-CoA Back     alignment and domain information
>PF04223 CitF: Citrate lyase, alpha subunit (CitF); InterPro: IPR006472 These sequences, from both Gram-positive and Gram-negative bacteria, represent the alpha subunit of the holoenzyme citrate lyase composed of alpha (2 Back     alignment and domain information
>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0427 ACH1 Acetyl-CoA hydrolase [Energy production and conversion] Back     alignment and domain information
>COG3051 CitF Citrate lyase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG0182 Predicted translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04223 CitF: Citrate lyase, alpha subunit (CitF); InterPro: IPR006472 These sequences, from both Gram-positive and Gram-negative bacteria, represent the alpha subunit of the holoenzyme citrate lyase composed of alpha (2 Back     alignment and domain information
>PF01144 CoA_trans: Coenzyme A transferase; InterPro: IPR004165 Coenzyme A (CoA) transferases belong to an evolutionary conserved [, ] family of enzymes catalyzing the reversible transfer of CoA from one carboxylic acid to another Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1uj5_A227 Crystal Structure Of Thermus Thermophilus Ribose-5- 2e-09
1uj4_A227 Crystal Structure Of Thermus Thermophilus Ribose-5- 1e-08
2f8m_A244 Ribose 5-Phosphate Isomerase From Plasmodium Falcip 2e-08
1lk5_A229 Structure Of The D-Ribose-5-Phosphate Isomerase Fro 1e-05
3ixq_A226 Structure Of Ribose 5-Phosphate Isomerase A From Me 6e-05
3l7o_A225 Crystal Structure Of Ribose-5-Phosphate Isomerase A 7e-05
4gmk_A228 Crystal Structure Of Ribose 5-Phosphate Isomerase F 8e-04
>pdb|1UJ5|A Chain A, Crystal Structure Of Thermus Thermophilus Ribose-5-Phosphate Isomerase Complexed With Ribose-5-Phosphate Length = 227 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 70/146 (47%), Gaps = 10/146 (6%)
Query: 40  TYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYR 99
            Y+  GMVVGLG+G  +  A+  + R+LR G LK V+G+PTS A+   A   GIPL    
Sbjct: 18  AYVQDGMVVGLGTGSTARYAVLELARRLREGELKGVVGVPTSRATEELAKREGIPL---V 74
Query: 100 DTSQXXXXXXXXXXXEEGTLVAVIGRQQPKG-DESIIQEKSVLNAADKLVFMVSENQYKG 158
           D              E    +A+I     KG   ++++EK V   A + + +    +   
Sbjct: 75  DLPPEGVDLAIDGADEIAPGLALI-----KGMGGALLREKIVERVAKEFIVIADHTKKVP 129
Query: 159 VLD-GSVPVLVQPVNWMETAEEIDDL 183
           VL  G VPV + P  +  T + I DL
Sbjct: 130 VLGRGPVPVEIVPFGYRATLKAIADL 155
>pdb|1UJ4|A Chain A, Crystal Structure Of Thermus Thermophilus Ribose-5-phosphate Isomerase Length = 227 Back     alignment and structure
>pdb|2F8M|A Chain A, Ribose 5-Phosphate Isomerase From Plasmodium Falciparum Length = 244 Back     alignment and structure
>pdb|1LK5|A Chain A, Structure Of The D-Ribose-5-Phosphate Isomerase From Pyrococcus Horikoshii Length = 229 Back     alignment and structure
>pdb|3IXQ|A Chain A, Structure Of Ribose 5-Phosphate Isomerase A From Methanocaldococcus Jannaschii Length = 226 Back     alignment and structure
>pdb|3L7O|A Chain A, Crystal Structure Of Ribose-5-Phosphate Isomerase A From Streptococcus Mutans Ua159 Length = 225 Back     alignment and structure
>pdb|4GMK|A Chain A, Crystal Structure Of Ribose 5-Phosphate Isomerase From The Probiotic Bacterium Lactobacillus Salivarius Ucc118 Length = 228 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
2f8m_A244 Ribose 5-phosphate isomerase; structural genomics, 3e-20
1lk5_A229 D-ribose-5-phosphate isomerase; alpha/beta structu 5e-20
1uj6_A227 Ribose 5-phosphate isomerase; enzyme-inhibitor com 4e-18
3l7o_A225 Ribose-5-phosphate isomerase A; RPIA; 1.70A {Strep 3e-17
2pjm_A226 Ribose-5-phosphate isomerase A; 3D-structure, stru 6e-17
3kwm_A224 Ribose-5-phosphate isomerase A; structural genomic 1e-16
1o8b_A219 Ribose 5-phosphate isomerase; RPIA, PSI, protein S 1e-16
1m0s_A219 Ribose-5-phosphate isomerase A; D-ribose 5-phospha 1e-16
3uw1_A239 Ribose-5-phosphate isomerase A; ssgcid, seattle st 2e-16
3hhe_A255 Ribose-5-phosphate isomerase A; niaid, ssgcid, dec 2e-16
1xtz_A264 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccha 7e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>2f8m_A Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative, STRU genomics of pathogenic protozoa consortium; 2.09A {Plasmodium falciparum} Length = 244 Back     alignment and structure
 Score = 84.1 bits (209), Expect = 3e-20
 Identities = 44/154 (28%), Positives = 75/154 (48%), Gaps = 17/154 (11%)

Query: 38  VDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQ 97
           VD Y+ S M +GLG+G      +E +   L++G LKDV+ IPTS+ +  +A   GIPL  
Sbjct: 21  VDEYVQSNMTIGLGTGSTVFYVLERIDNLLKSGKLKDVVCIPTSIDTELKARKLGIPLTT 80

Query: 98  YRDTSQIDFAFDDAD-IIEEGTLVAVIGRQQPKGD-ESIIQEKSVLNAADKLVFMVSENQ 155
               S ID   D  D I     L+        KG   ++++EK V +++  L+ +  E+ 
Sbjct: 81  LEKHSNIDITIDGTDEIDLNLNLI--------KGRGGALVREKLVASSSSLLIIIGDES- 131

Query: 156 YKGVLDG-----SVPVLVQPVNWMETAEEIDDLF 184
            K   +G     +VP+ +    + +  E +  ++
Sbjct: 132 -KLCTNGLGMTGAVPIEILTFGYEKIIENLLKIY 164
>1lk5_A D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii} SCOP: c.124.1.4 d.58.40.1 PDB: 1lk7_A* Length = 229 Back     alignment and structure
>1uj6_A Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomi initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} SCOP: c.124.1.4 d.58.40.1 PDB: 1uj5_A* 1uj4_A* Length = 227 Back     alignment and structure
>3l7o_A Ribose-5-phosphate isomerase A; RPIA; 1.70A {Streptococcus mutans} Length = 225 Back     alignment and structure
>3kwm_A Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structu genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp} Length = 224 Back     alignment and structure
>1o8b_A Ribose 5-phosphate isomerase; RPIA, PSI, protein ST initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} SCOP: c.124.1.4 d.58.40.1 PDB: 1lkz_A 1ks2_A* 3enq_A 3env_A* 3enw_A* Length = 219 Back     alignment and structure
>1m0s_A Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} SCOP: c.124.1.4 d.58.40.1 Length = 219 Back     alignment and structure
>3uw1_A Ribose-5-phosphate isomerase A; ssgcid, seattle structural genomics center for infectious DI isomerase, ribose isomerase; HET: R5P; 1.71A {Burkholderia thailandensis} PDB: 3u7j_A* Length = 239 Back     alignment and structure
>3hhe_A Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, STRU genomics, seattle structural genomics center for infectious; HET: 5RP; 2.30A {Bartonella henselae} Length = 255 Back     alignment and structure
>1xtz_A Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Length = 264 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
3l7o_A225 Ribose-5-phosphate isomerase A; RPIA; 1.70A {Strep 100.0
2pjm_A226 Ribose-5-phosphate isomerase A; 3D-structure, stru 100.0
3kwm_A224 Ribose-5-phosphate isomerase A; structural genomic 100.0
3hhe_A255 Ribose-5-phosphate isomerase A; niaid, ssgcid, dec 100.0
4gmk_A228 Ribose-5-phosphate isomerase A; D-ribose-5-phospha 100.0
3uw1_A239 Ribose-5-phosphate isomerase A; ssgcid, seattle st 100.0
1lk5_A229 D-ribose-5-phosphate isomerase; alpha/beta structu 100.0
2f8m_A244 Ribose 5-phosphate isomerase; structural genomics, 100.0
3ixq_A226 Ribose-5-phosphate isomerase A; structural genomic 100.0
1m0s_A219 Ribose-5-phosphate isomerase A; D-ribose 5-phospha 100.0
1uj6_A227 Ribose 5-phosphate isomerase; enzyme-inhibitor com 100.0
1xtz_A264 Ribose-5-phosphate isomerase; yeast; 2.10A {Saccha 100.0
1o8b_A219 Ribose 5-phosphate isomerase; RPIA, PSI, protein S 100.0
1vb5_A276 Translation initiation factor EIF-2B; 2.20A {Pyroc 99.36
3ecs_A315 Translation initiation factor EIF-2B subunit alpha 98.17
2w48_A315 Sorbitol operon regulator; SORC, activator, repres 98.06
3a11_A338 Translation initiation factor EIF-2B, delta subun; 97.99
2o0m_A345 Transcriptional regulator, SORC family; structural 97.97
1poi_B260 Glutaconate coenzyme A-transferase; COA, glutamate 97.85
2yvk_A374 Methylthioribose-1-phosphate isomerase; methionine 97.84
1t5o_A351 EIF2BD, translation initiation factor EIF2B, subun 97.71
1t9k_A347 Probable methylthioribose-1-phosphate isomerase; s 97.68
2a0u_A383 Initiation factor 2B; SGPP, structural genomics, P 97.65
3d3u_A439 4-hydroxybutyrate COA-transferase; alpha-beta prot 97.61
3rrl_A235 Succinyl-COA:3-ketoacid-coenzyme A transferase SU; 97.34
3rrl_B207 Succinyl-COA:3-ketoacid-coenzyme A transferase SU; 97.27
1k6d_A220 Acetate COA-transferase alpha subunit; structural 97.25
3cdk_A241 Succinyl-COA:3-ketoacid-coenzyme A transferase sub 97.13
3d3u_A 439 4-hydroxybutyrate COA-transferase; alpha-beta prot 96.76
3nze_A267 Putative transcriptional regulator, sugar-binding; 96.67
3qli_A 455 Coenzyme A transferase; COEN transferase; 1.90A {Y 96.58
3kv1_A267 Transcriptional repressor; alpha-beta structure, s 96.5
3gk7_A 448 4-hydroxybutyrate COA-transferase; alpha/beta prot 96.39
1xr4_A 509 Putative citrate lyase alpha chain/citrate-ACP TR; 96.26
3eh7_A 434 4-hydroxybutyrate COA-transferase; citrate lyase, 96.16
3efb_A266 Probable SOR-operon regulator; alpha-beta-alpha sa 96.09
2oas_A 436 ATOA, 4-hydroxybutyrate coenzyme A transferase; al 96.06
2g39_A 497 Acetyl-COA hydrolase; coenzyme A transferase, stru 96.05
2gnp_A266 Transcriptional regulator; structural genomics, MC 95.91
2nvv_A 506 Acetyl-COA hydrolase/transferase family protein; a 95.91
2ahu_A 531 Putative enzyme YDIF; COA transferase, glutamyl th 95.83
4eu9_A 514 Succinyl-COA:acetate coenzyme A transferase; HET: 95.71
2hj0_A 519 Putative citrate lyase, ALFA subunit; alpha beta p 95.68
2okg_A255 Central glycolytic gene regulator; alpha/beta/alph 95.34
1w2w_B191 5-methylthioribose-1-phosphate isomerase; EIF2B, m 95.15
2r5f_A264 Transcriptional regulator, putative; transcription 95.06
1xr4_A509 Putative citrate lyase alpha chain/citrate-ACP TR; 95.03
1stz_A338 Heat-inducible transcription repressor HRCA homol; 93.88
3k6m_A481 Succinyl-COA:3-ketoacid-coenzyme A transferase 1, 93.54
2ahu_A531 Putative enzyme YDIF; COA transferase, glutamyl th 93.39
2hj0_A519 Putative citrate lyase, ALFA subunit; alpha beta p 93.33
3k6m_A 481 Succinyl-COA:3-ketoacid-coenzyme A transferase 1, 89.15
1poi_A 317 Glutaconate coenzyme A-transferase; COA, glutamate 88.79
3qli_A455 Coenzyme A transferase; COEN transferase; 1.90A {Y 84.38
2bkx_A242 Glucosamine-6-phosphate deaminase; hydrolase, subs 82.59
1fs5_A266 Glucosamine-6-phosphate deaminase; allosteric enzy 82.48
3gk7_A448 4-hydroxybutyrate COA-transferase; alpha/beta prot 82.05
2oas_A436 ATOA, 4-hydroxybutyrate coenzyme A transferase; al 81.84
2ri0_A234 Glucosamine-6-phosphate deaminase; carbohydrate me 81.59
3eh7_A434 4-hydroxybutyrate COA-transferase; citrate lyase, 81.24
>3l7o_A Ribose-5-phosphate isomerase A; RPIA; 1.70A {Streptococcus mutans} Back     alignment and structure
Probab=100.00  E-value=4.3e-45  Score=309.37  Aligned_cols=158  Identities=25%  Similarity=0.402  Sum_probs=149.8

Q ss_pred             HHHHHHHHHHHhccccccccCCCCCEEEECcchhHHHHHHHHHHHhhcCCCCCeEEEcCcHHHHHHHHHcCCCEEEcCCC
Q 029161           22 SSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDT  101 (198)
Q Consensus        22 ~~~K~~IA~~Aa~~~~~~~~I~~g~~IgLgsGST~~~la~~L~~~~~~~~l~~itvVTnS~~~a~~l~~~gi~v~~l~~~  101 (198)
                      .++|++||++|+      ++|++||+||||||||+.+++++|.++.+.+.+ ++|+||||++++.++.++|++++.+++.
T Consensus         2 ~~~K~~iA~~A~------~~V~dg~vIgLGsGST~~~~i~~L~~~~~~~~~-~i~~VttS~~t~~~l~~~Gi~l~~l~~~   74 (225)
T 3l7o_A            2 EELKKIAGVRAA------QYVEDGMIVGLGTGSTAYYFVEEVGRRVQEEGL-QVIGVTTSSRTTAQAQALGIPLKSIDEV   74 (225)
T ss_dssp             CHHHHHHHHHHH------TTCCTTCEEEECCSTTHHHHHHHHHHHHHHHCC-CCEEEESSHHHHHHHHHHTCCBCCGGGS
T ss_pred             hHHHHHHHHHHH------HhCCCCCEEEECCcHHHHHHHHHHHHhhhhcCC-CEEEEcCCHHHHHHHhccCceEEecCcc
Confidence            368999999999      999999999999999999999999987665555 7999999999999999999999999988


Q ss_pred             CcccEEEeecCccCCCCcceeecCCCCCcchhHHHHHHHHHhcCcEEEEEcCCccccCCC-CcccEEEecCCHHHHHHHH
Q 029161          102 SQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLD-GSVPVLVQPVNWMETAEEI  180 (198)
Q Consensus       102 ~~iD~af~Gad~Vd~~~~~~ikG~g~~~~~ea~~~ek~i~~~s~~~ivlaD~sK~~~~lg-~~ipvEV~p~~~~~v~~~l  180 (198)
                      +++|++|||||+||+ +++++||+|+     |++|||+++.+|+++|+|+|+|||+++|| +|+||||+|++|.+|.++|
T Consensus        75 ~~iD~a~dGADevd~-~~~liKGgG~-----al~rEKiva~~A~~~iviaD~sK~~~~Lg~~plPvEV~p~a~~~v~~~l  148 (225)
T 3l7o_A           75 DSVDVTVDGADEVDP-NFNGIKGGGG-----ALLMEKIVGTLTKDYIWVVDESKMVDTLGAFRLPVEVVQYGAERLFREF  148 (225)
T ss_dssp             SCEEEEEECCSEECT-TSCEECCTTS-----CHHHHHHHHHTEEEEEEEEEGGGBCSSSCSSCEEEEECSTTHHHHHHHH
T ss_pred             cccCEEEEcCCccCc-ccCeecCchh-----hhHHHHHHHHhCCeEEEEEecccchhhcCCCCEEEEEehhHHHHHHHHH
Confidence            899999999999999 8999999999     99999999999999999999999999998 6999999999999999999


Q ss_pred             HhhcCCCceeEeCC
Q 029161          181 DDLFIGDAEVFSIP  194 (198)
Q Consensus       181 ~~lf~g~~~~~R~~  194 (198)
                      +++  |+.+.||++
T Consensus       149 ~~l--G~~~~lR~~  160 (225)
T 3l7o_A          149 EKK--GYKPSFREY  160 (225)
T ss_dssp             HHT--TCCEEECEE
T ss_pred             HHc--CCceEEEEc
Confidence            998  899999984
>3kwm_A Ribose-5-phosphate isomerase A; structural genomics, IDP02119, center for structu genomics of infectious diseases, csgid; 2.32A {Francisella tularensis subsp} Back     alignment and structure
>3hhe_A Ribose-5-phosphate isomerase A; niaid, ssgcid, decode, SBRI, UW, STRU genomics, seattle structural genomics center for infectious; HET: 5RP; 2.30A {Bartonella henselae} Back     alignment and structure
>4gmk_A Ribose-5-phosphate isomerase A; D-ribose-5-phosphate isomerase family, ribose 5-phosphate isomerisation; 1.72A {Lactobacillus salivarius} Back     alignment and structure
>3uw1_A Ribose-5-phosphate isomerase A; ssgcid, seattle structural genomics center for infectious DI isomerase, ribose isomerase; HET: R5P; 1.71A {Burkholderia thailandensis} PDB: 3u7j_A* Back     alignment and structure
>1lk5_A D-ribose-5-phosphate isomerase; alpha/beta structure; 1.75A {Pyrococcus horikoshii} SCOP: c.124.1.4 d.58.40.1 PDB: 1lk7_A* Back     alignment and structure
>2f8m_A Ribose 5-phosphate isomerase; structural genomics, PSI, protein structure initiative, STRU genomics of pathogenic protozoa consortium; 2.09A {Plasmodium falciparum} Back     alignment and structure
>3ixq_A Ribose-5-phosphate isomerase A; structural genomics, pentose phosphate pathway, carbon fixation, NPPSFA; HET: PGO; 1.78A {Methanocaldococcus jannaschii} Back     alignment and structure
>1m0s_A Ribose-5-phosphate isomerase A; D-ribose 5-phosphate isomerase, northeast structural genomics consortium, IR21, structural genomics, PSI; HET: CIT; 1.90A {Haemophilus influenzae} SCOP: c.124.1.4 d.58.40.1 Back     alignment and structure
>1uj6_A Ribose 5-phosphate isomerase; enzyme-inhibitor complex, riken structural genomics/proteomi initiative, RSGI, structural genomics; HET: A5P; 1.74A {Thermus thermophilus} SCOP: c.124.1.4 d.58.40.1 PDB: 1uj5_A* 1uj4_A* Back     alignment and structure
>1xtz_A Ribose-5-phosphate isomerase; yeast; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1o8b_A Ribose 5-phosphate isomerase; RPIA, PSI, protein ST initiative, MCSG, midwest center for structural genomics; HET: ABF; 1.25A {Escherichia coli} SCOP: c.124.1.4 d.58.40.1 PDB: 1lkz_A 1ks2_A* 3enq_A 3env_A* 3enw_A* Back     alignment and structure
>1vb5_A Translation initiation factor EIF-2B; 2.20A {Pyrococcus horikoshii} SCOP: c.124.1.5 Back     alignment and structure
>3ecs_A Translation initiation factor EIF-2B subunit alpha; eukaryotic translation initiation factor 2balpha (EIF2balpha); 2.65A {Homo sapiens} Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>3a11_A Translation initiation factor EIF-2B, delta subun; isomerase, hexamer, rossmann fold; 2.50A {Thermococcus kodakaraensis} PDB: 3a9c_A* 3vm6_A* Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>1poi_B Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} SCOP: c.124.1.3 Back     alignment and structure
>2yvk_A Methylthioribose-1-phosphate isomerase; methionine salvage pathway,; HET: MRU; 2.40A {Bacillus subtilis} PDB: 2yrf_A* Back     alignment and structure
>1t5o_A EIF2BD, translation initiation factor EIF2B, subunit DELT; subunit delta, structural GEN PSI, protein structure initiative; 1.90A {Archaeoglobus fulgidus} SCOP: c.124.1.5 Back     alignment and structure
>1t9k_A Probable methylthioribose-1-phosphate isomerase; structural genomics, translation initiation factor, AIF-2B subunit, PSI; 2.60A {Thermotoga maritima} SCOP: c.124.1.5 Back     alignment and structure
>2a0u_A Initiation factor 2B; SGPP, structural genomics, PSI, protein structure initiative eukaryotic initiation factor; 2.10A {Leishmania major} SCOP: c.124.1.5 Back     alignment and structure
>3d3u_A 4-hydroxybutyrate COA-transferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.80A {Porphyromonas gingivalis} Back     alignment and structure
>3rrl_A Succinyl-COA:3-ketoacid-coenzyme A transferase SU; MCSG,PSI-biology, structural genomics, midwest center for ST genomics; 2.29A {Helicobacter pylori} Back     alignment and structure
>3rrl_B Succinyl-COA:3-ketoacid-coenzyme A transferase SU; MCSG,PSI-biology, structural genomics, midwest center for ST genomics; 2.29A {Helicobacter pylori} PDB: 3cdk_B Back     alignment and structure
>1k6d_A Acetate COA-transferase alpha subunit; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Escherichia coli} SCOP: c.124.1.2 Back     alignment and structure
>3cdk_A Succinyl-COA:3-ketoacid-coenzyme A transferase subunit A; CO-expressed complex, hetero-tetramer, structural genomics, PSI-2; 2.59A {Bacillus subtilis} Back     alignment and structure
>3d3u_A 4-hydroxybutyrate COA-transferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.80A {Porphyromonas gingivalis} Back     alignment and structure
>3nze_A Putative transcriptional regulator, sugar-binding; structural genomics, PSI-2, protein structure initiative; 1.70A {Arthrobacter aurescens} SCOP: c.124.1.0 Back     alignment and structure
>3qli_A Coenzyme A transferase; COEN transferase; 1.90A {Yersinia pestis} PDB: 3qlk_A 3s8d_A Back     alignment and structure
>3kv1_A Transcriptional repressor; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.70A {Vibrio fischeri} SCOP: c.124.1.0 Back     alignment and structure
>3gk7_A 4-hydroxybutyrate COA-transferase; alpha/beta protein; HET: SPD; 1.85A {Clostridium aminobutyricum} PDB: 3qdq_A* Back     alignment and structure
>1xr4_A Putative citrate lyase alpha chain/citrate-ACP TR; the midwest center for structural genomics, MCSG, structural genomics; 2.37A {Salmonella typhimurium} SCOP: c.124.1.2 c.124.1.2 Back     alignment and structure
>3eh7_A 4-hydroxybutyrate COA-transferase; citrate lyase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Porphyromonas gingivalis} Back     alignment and structure
>3efb_A Probable SOR-operon regulator; alpha-beta-alpha sandwich, center for structural genomics of infectious diseases, csgid, transcription; HET: MSE; 2.00A {Shigella flexneri 2A} SCOP: c.124.1.8 Back     alignment and structure
>2oas_A ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha beta protein, structural genomics, PSI-2, protein STRU initiative; HET: COA; 2.40A {Shewanella oneidensis} Back     alignment and structure
>2g39_A Acetyl-COA hydrolase; coenzyme A transferase, structural G PSI, protein structure initiative, midwest center for struc genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: c.124.1.2 c.124.1.2 Back     alignment and structure
>2gnp_A Transcriptional regulator; structural genomics, MCSG, APC84799, streptococcus pneumonia PSI, protein structure initiative; 1.65A {Streptococcus pneumoniae} SCOP: c.124.1.8 Back     alignment and structure
>2nvv_A Acetyl-COA hydrolase/transferase family protein; alpha beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Porphyromonas gingivalis} Back     alignment and structure
>2ahu_A Putative enzyme YDIF; COA transferase, glutamyl thioester, structural genomi montreal-kingston bacterial structural genomics initiative; 1.90A {Escherichia coli} SCOP: c.124.1.3 c.124.1.2 PDB: 2ahv_A* 2ahw_A* Back     alignment and structure
>4eu9_A Succinyl-COA:acetate coenzyme A transferase; HET: COA; 1.48A {Acetobacter aceti} PDB: 4eua_A* 4eu3_A* 4eu4_A* 4eu5_A* 4eu6_A* 4eu7_A* 4eu8_A* 4eub_A* 4euc_A* 4eud_A* Back     alignment and structure
>2hj0_A Putative citrate lyase, ALFA subunit; alpha beta protein., structural genomics, PSI-2, protein STR initiative; HET: CIT; 2.70A {Streptococcus mutans} Back     alignment and structure
>2okg_A Central glycolytic gene regulator; alpha/beta/alpha sandwich, rossmann-like fold, structural genomics, PSI-2, protein structure initiative; HET: MSE G3H; 1.65A {Bacillus subtilis} SCOP: c.124.1.8 PDB: 3bxe_A* 3bxf_A* 3bxg_A* 3bxh_A* Back     alignment and structure
>1w2w_B 5-methylthioribose-1-phosphate isomerase; EIF2B, methionine salvage pathway, translation initiation, oxidoreductase; 1.75A {Saccharomyces cerevisiae} SCOP: c.124.1.5 Back     alignment and structure
>2r5f_A Transcriptional regulator, putative; transcription regulator, sugar-binding domain, structural GE PFAM04198, PSI-2; 2.10A {Pseudomonas syringae PV} SCOP: c.124.1.8 Back     alignment and structure
>1xr4_A Putative citrate lyase alpha chain/citrate-ACP TR; the midwest center for structural genomics, MCSG, structural genomics; 2.37A {Salmonella typhimurium} SCOP: c.124.1.2 c.124.1.2 Back     alignment and structure
>1stz_A Heat-inducible transcription repressor HRCA homol; circe element, structural genomics, BSGC structure FUN NIH, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.51 d.110.2.3 Back     alignment and structure
>3k6m_A Succinyl-COA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT, COA transferase, dynamic domain, glycerol, mitochondri transferase; 1.50A {Sus scrofa} PDB: 1m3e_A* 1o9l_A 1ooy_A 2nrc_A 2nrb_A 3oxo_A* 1ooz_A 1ope_A 3dlx_A Back     alignment and structure
>2ahu_A Putative enzyme YDIF; COA transferase, glutamyl thioester, structural genomi montreal-kingston bacterial structural genomics initiative; 1.90A {Escherichia coli} SCOP: c.124.1.3 c.124.1.2 PDB: 2ahv_A* 2ahw_A* Back     alignment and structure
>2hj0_A Putative citrate lyase, ALFA subunit; alpha beta protein., structural genomics, PSI-2, protein STR initiative; HET: CIT; 2.70A {Streptococcus mutans} Back     alignment and structure
>3k6m_A Succinyl-COA:3-ketoacid-coenzyme A transferase 1, mitochondrial; SCOT, COA transferase, dynamic domain, glycerol, mitochondri transferase; 1.50A {Sus scrofa} PDB: 1m3e_A* 1o9l_A 1ooy_A 2nrc_A 2nrb_A 3oxo_A* 1ooz_A 1ope_A 3dlx_A Back     alignment and structure
>1poi_A Glutaconate coenzyme A-transferase; COA, glutamate, protein fermentation; 2.50A {Acidaminococcus fermentans} SCOP: c.124.1.2 Back     alignment and structure
>3qli_A Coenzyme A transferase; COEN transferase; 1.90A {Yersinia pestis} PDB: 3qlk_A 3s8d_A Back     alignment and structure
>2bkx_A Glucosamine-6-phosphate deaminase; hydrolase, substrate inhibition, fructose-6-phosphate; HET: F6R; 1.4A {Bacillus subtilis} PDB: 2bkv_A* Back     alignment and structure
>1fs5_A Glucosamine-6-phosphate deaminase; allosteric enzyme, entropic effects, aldose-ketose isomerase multiple conformers, isomerase; HET: 16G TLA; 1.73A {Escherichia coli} SCOP: c.124.1.1 PDB: 1cd5_A 1fqo_A* 1frz_A* 1dea_A* 1fs6_A 1fsf_A 1hor_A* 1hot_A* 2wu1_A* 1jt9_A Back     alignment and structure
>3gk7_A 4-hydroxybutyrate COA-transferase; alpha/beta protein; HET: SPD; 1.85A {Clostridium aminobutyricum} PDB: 3qdq_A* Back     alignment and structure
>2oas_A ATOA, 4-hydroxybutyrate coenzyme A transferase; alpha beta protein, structural genomics, PSI-2, protein STRU initiative; HET: COA; 2.40A {Shewanella oneidensis} Back     alignment and structure
>2ri0_A Glucosamine-6-phosphate deaminase; carbohydrate metabolism,; HET: BTB; 1.60A {Streptococcus mutans} PDB: 2ri1_A* Back     alignment and structure
>3eh7_A 4-hydroxybutyrate COA-transferase; citrate lyase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Porphyromonas gingivalis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d1lk5a1149 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate 2e-14
d1m0sa1147 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate 7e-13
d1o8ba1124 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphat 5e-12
d1uj4a1151 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate 6e-11
>d1lk5a1 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
domain: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 65.5 bits (159), Expect = 2e-14
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 9/141 (6%)

Query: 41  YITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRD 100
           +I   MV+GLG+G  +A  I+ +G +L+ G + D++G+PTS  +   A    IP+     
Sbjct: 17  FIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQ 76

Query: 101 TSQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVL 160
              ID A D AD ++    +            ++  EK +   A   + +V E +    L
Sbjct: 77  VDAIDVAVDGADEVDPNLNL------IKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYL 130

Query: 161 DGSVPVLVQPVNWMETAEEID 181
                ++   V   E  ++++
Sbjct: 131 -DIADIV--IVGTREGVKKLE 148
>d1m0sa1 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Haemophilus influenzae [TaxId: 727]} Length = 147 Back     information, alignment and structure
>d1o8ba1 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 124 Back     information, alignment and structure
>d1uj4a1 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Thermus thermophilus [TaxId: 274]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d1uj4a1151 D-ribose-5-phosphate isomerase (RpiA), catalytic d 99.98
d1o8ba1124 D-ribose-5-phosphate isomerase (RpiA), catalytic d 99.97
d1lk5a1149 D-ribose-5-phosphate isomerase (RpiA), catalytic d 99.97
d1m0sa1147 D-ribose-5-phosphate isomerase (RpiA), catalytic d 99.96
d1vb5a_274 Putative eIF-2B subunit 2-like protein PH0440 {Pyr 98.21
d1uj4a274 D-ribose-5-phosphate isomerase (RpiA), lid domain 98.16
d1lk5a280 D-ribose-5-phosphate isomerase (RpiA), lid domain 97.94
d1m0sa272 D-ribose-5-phosphate isomerase (RpiA), lid domain 97.89
d1o8ba272 D-ribose-5-phosphate isomerase (RpiA), lid domain 97.79
d1t5oa_340 Putative eIF-2B delta-subunit {Archaeon Archaeoglo 97.52
d1k6da_219 Acetate:CoA transferase alpha {Escherichia coli [T 97.52
d1t9ka_340 Probable methylthioribose-1-phosphate isomerase TM 97.5
d2g39a1221 Acetyl-CoA hydrolase (PA5445) {Pseudomonas aerugin 96.75
d1poib_260 Glutaconate:CoA transferase beta {Acidaminococcus 96.71
d2gnpa1262 Transcriptional regulator SP0247 {Streptococcus pn 96.32
g1w2w.1402 Putative methylthioribose-1-phosphate isomerase Yp 96.11
d3efba1255 Sor-operon regulator SorC {Shigella flexneri [TaxI 95.9
d2okga1250 Central glycolytic gene regulator CggR {Bacillus s 95.82
d2ahua1247 Putative enzyme YdiF C-terminal domain {Escherichi 95.69
d2a0ua1374 Initiation factor 2b {Leishmania major [TaxId: 566 95.64
d1xr4a1236 Putative citrate lyase alpha chain, citF2 {Salmone 95.32
d2r5fa1258 Transcriptional regulator PSPTO2395 {Pseudomonas s 94.28
d2ahua2273 Putative enzyme YdiF N-terminal domain {Escherichi 94.28
d1ooya2242 Succinate:CoA transferase, N-terminal domain {Pig 93.6
d1ooya1221 Succinate:CoA transferase, C-terminal domain {Pig 91.69
d1poia_ 317 Glutaconate:CoA transferase alpha {Acidaminococcus 91.36
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.31
d2o0ma1247 Transcriptional regulator EF1965 {Enterococcus fae 90.1
d1xr4a2269 Putative citrate lyase alpha chain, citF2 {Salmone 83.45
>d1uj4a1 c.124.1.4 (A:3-131,A:206-227) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NagB/RpiA/CoA transferase-like
superfamily: NagB/RpiA/CoA transferase-like
family: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
domain: D-ribose-5-phosphate isomerase (RpiA), catalytic domain
species: Thermus thermophilus [TaxId: 274]

Probab=99.98  E-value=5.3e-33  Score=219.63  Aligned_cols=142  Identities=32%  Similarity=0.486  Sum_probs=121.6

Q ss_pred             HHHHHHHHHHHhccccccccCCCCCEEEECcchhHHHHHHHHHHHhhcCCCCCeEEEcCcHHHHHHHHHcCCCEEEcCCC
Q 029161           22 SSVLFRAAKHTVTFLIVDTYITSGMVVGLGSGQASAMAIEYMGRQLRAGALKDVIGIPTSVASANEAAVAGIPLDQYRDT  101 (198)
Q Consensus        22 ~~~K~~IA~~Aa~~~~~~~~I~~g~~IgLgsGST~~~la~~L~~~~~~~~l~~itvVTnS~~~a~~l~~~gi~v~~l~~~  101 (198)
                      ..+|++||++|+      ++|+|||+||||+|||+.+++++|.++.......++..+++.+.....+...+.....+.. 
T Consensus         4 ~~~K~~IA~~A~------~~I~dg~~I~LdsGTT~~~la~~l~~~~~~~~~~~~i~~~~~~~~~~~~~~g~~~~~~l~~-   76 (151)
T d1uj4a1           4 ESYKKEAAHAAI------AYVQDGMVVGLGTGSTARYAVLELARRLREGELKGVVGVPTSRATEELAKREGIPLVDLPP-   76 (151)
T ss_dssp             HHHHHHHHHHHH------TTCCTTCEEEECCSHHHHHHHHHHHHHHHTTSSCSCEEEESSHHHHHHHHHTTCCBCCCCT-
T ss_pred             HHHHHHHHHHHH------HhCCCCCEEEECchHHHHHHHHHHHHHHhhcccceeeeccchhhHHHHHhcCCcccccccc-
Confidence            578999999999      9999999999999999999999999876644445788889988887776665666666766 


Q ss_pred             CcccEEEeecCccCCCCcceeecCCCCCcchhHHHHHHHHHhcCcEEEEEcCCccccCCC----CcccEEEecCCHHHH
Q 029161          102 SQIDFAFDDADIIEEGTLVAVIGRQQPKGDESIIQEKSVLNAADKLVFMVSENQYKGVLD----GSVPVLVQPVNWMET  176 (198)
Q Consensus       102 ~~iD~af~Gad~Vd~~~~~~ikG~g~~~~~ea~~~ek~i~~~s~~~ivlaD~sK~~~~lg----~~ipvEV~p~~~~~v  176 (198)
                      +++|++|+|||+||+ ++++.+++++     ....+|.|+++|+++|+|+|||||+++|+    .|+||||+|+++++|
T Consensus        77 ~~~D~aF~g~~gvd~-~~g~~~~~~~-----e~~~kk~~~~~A~~~ilLaD~SKlv~~L~~~~~~p~piev~p~~~~~v  149 (151)
T d1uj4a1          77 EGVDLAIDGADEIAP-GLALIKGMGG-----ALLREKIVERVAKEFIVIADHTKKVPVLLFVGMATRALVAGPFGVEEL  149 (151)
T ss_dssp             TCEEEEEECCSEEEG-GGEEECCTTS-----CHHHHHHHHHTEEEEEEEEEGGGBCSSSEECSCCSEEEEEETTEEEEE
T ss_pred             ceecEEEEccccccC-CcCcccCCHH-----HHHHHHHHHHhcCeEEEEEECCceecccccCCCCCEeEEEccchHhhc
Confidence            599999999999999 7998886655     55556888899999999999999999994    499999999998654
>d1o8ba1 c.124.1.4 (A:23-126,A:199-218) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lk5a1 c.124.1.4 (A:1-130,A:211-229) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m0sa1 c.124.1.4 (A:1-126,A:199-219) D-ribose-5-phosphate isomerase (RpiA), catalytic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vb5a_ c.124.1.5 (A:) Putative eIF-2B subunit 2-like protein PH0440 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uj4a2 d.58.40.1 (A:132-205) D-ribose-5-phosphate isomerase (RpiA), lid domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lk5a2 d.58.40.1 (A:131-210) D-ribose-5-phosphate isomerase (RpiA), lid domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m0sa2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o8ba2 d.58.40.1 (A:127-198) D-ribose-5-phosphate isomerase (RpiA), lid domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5oa_ c.124.1.5 (A:) Putative eIF-2B delta-subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ka_ c.124.1.5 (A:) Probable methylthioribose-1-phosphate isomerase TM0911 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g39a1 c.124.1.2 (A:3-223) Acetyl-CoA hydrolase (PA5445) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1poib_ c.124.1.3 (B:) Glutaconate:CoA transferase beta {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2gnpa1 c.124.1.8 (A:56-317) Transcriptional regulator SP0247 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3efba1 c.124.1.8 (A:11-265) Sor-operon regulator SorC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2okga1 c.124.1.8 (A:89-338) Central glycolytic gene regulator CggR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ahua1 c.124.1.3 (A:283-529) Putative enzyme YdiF C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a0ua1 c.124.1.5 (A:10-383) Initiation factor 2b {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xr4a1 c.124.1.2 (A:1-236) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2r5fa1 c.124.1.8 (A:59-316) Transcriptional regulator PSPTO2395 {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ahua2 c.124.1.2 (A:4-276) Putative enzyme YdiF N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ooya2 c.124.1.2 (A:1-242) Succinate:CoA transferase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ooya1 c.124.1.3 (A:261-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1poia_ c.124.1.2 (A:) Glutaconate:CoA transferase alpha {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2o0ma1 c.124.1.8 (A:95-341) Transcriptional regulator EF1965 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xr4a2 c.124.1.2 (A:237-505) Putative citrate lyase alpha chain, citF2 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure