Citrus Sinensis ID: 029661


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTSKRPQAVAV
ccccccccccccHHHHHHHccccccccccEEccccccccHHHHHHccccEEEEccccccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHcccEEEEcccccccccHHHHHHHHHHccccccccc
EEccccccEcccHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEEcccccHHHHccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccEEEccHHHHccccHHHHHHHHHcccccccccc
mdgrfvpnitigplvvdalrpvtdlpldvhlmivepeqrvpdfIKAGADIVSVHCEQSSTIHLHRTLNQIKDLgakagvvlnpatslsaIECVLDVVDLVLIMsvnpgfggqsfIESQVKKISDLRRMCLekgvnpwievdggvgpknAYKVIEAGANALVAGSAVFGAKDYAEAIKGiktskrpqavav
mdgrfvpnitigplvvdalRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVnpgfggqsfIESQVKKISDLRRMCLEKGvnpwievdggvGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIkgiktskrpqavav
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTSKRPQAVAV
****FVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKG************
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTSK*******
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK**********
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTS********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIKTSKRPQAVAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
Q43843280 Ribulose-phosphate 3-epim N/A no 1.0 0.678 0.910 1e-98
Q43157285 Ribulose-phosphate 3-epim N/A no 1.0 0.666 0.921 8e-98
Q9ZTP5274 Ribulose-phosphate 3-epim yes no 0.989 0.686 0.920 2e-97
P74061230 Ribulose-phosphate 3-epim N/A no 0.978 0.808 0.682 4e-71
O34557217 Ribulose-phosphate 3-epim yes no 0.952 0.834 0.630 2e-56
O67098222 Ribulose-phosphate 3-epim yes no 0.931 0.797 0.497 1e-44
P44756224 Ribulose-phosphate 3-epim yes no 0.942 0.799 0.489 9e-43
Q04539241 Ribulose-phosphate 3-epim yes no 0.978 0.771 0.479 2e-42
P40117241 Ribulose-phosphate 3-epim no no 0.889 0.701 0.508 1e-41
P0AG10225 Ribulose-phosphate 3-epim yes no 0.947 0.8 0.475 2e-41
>sp|Q43843|RPE_SOLTU Ribulose-phosphate 3-epimerase, chloroplastic (Fragment) OS=Solanum tuberosum PE=1 SV=1 Back     alignment and function desciption
 Score =  358 bits (919), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 173/190 (91%), Positives = 183/190 (96%)

Query: 1   MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60
           MDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSST
Sbjct: 91  MDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSST 150

Query: 61  IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVK 120
           IHLHRT+NQIK LGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVK
Sbjct: 151 IHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVK 210

Query: 121 KISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK 180
           KISDLR++C E+G+NPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGA DYAEAIKGIK
Sbjct: 211 KISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPDYAEAIKGIK 270

Query: 181 TSKRPQAVAV 190
           TSKRP+AVAV
Sbjct: 271 TSKRPEAVAV 280




Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.
Solanum tuberosum (taxid: 4113)
EC: 5EC: .EC: 1EC: .EC: 3EC: .EC: 1
>sp|Q43157|RPE_SPIOL Ribulose-phosphate 3-epimerase, chloroplastic OS=Spinacia oleracea GN=RPE PE=1 SV=1 Back     alignment and function description
>sp|Q9ZTP5|RPE_ORYSJ Ribulose-phosphate 3-epimerase, chloroplastic OS=Oryza sativa subsp. japonica GN=RPE PE=1 SV=2 Back     alignment and function description
>sp|P74061|RPE_SYNY3 Ribulose-phosphate 3-epimerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpe PE=1 SV=3 Back     alignment and function description
>sp|O34557|RPE_BACSU Ribulose-phosphate 3-epimerase OS=Bacillus subtilis (strain 168) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|O67098|RPE_AQUAE Ribulose-phosphate 3-epimerase OS=Aquifex aeolicus (strain VF5) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|P44756|RPE_HAEIN Ribulose-phosphate 3-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|Q04539|RPEP_CUPNH Ribulose-phosphate 3-epimerase, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEP PE=3 SV=1 Back     alignment and function description
>sp|P40117|RPEC_CUPNH Ribulose-phosphate 3-epimerase, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbEC PE=3 SV=1 Back     alignment and function description
>sp|P0AG10|RPE_SHIFL Ribulose-phosphate 3-epimerase OS=Shigella flexneri GN=rpe PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
356511994280 PREDICTED: ribulose-phosphate 3-epimeras 1.0 0.678 0.947 1e-100
449439289283 PREDICTED: ribulose-phosphate 3-epimeras 1.0 0.671 0.952 1e-100
225457361282 PREDICTED: ribulose-phosphate 3-epimeras 1.0 0.673 0.942 1e-98
224124194286 predicted protein [Populus trichocarpa] 1.0 0.664 0.931 2e-98
297797095281 hypothetical protein ARALYDRAFT_919384 [ 1.0 0.676 0.936 1e-97
15240250281 D-ribulose-5-phosphate-3-epimerase [Arab 1.0 0.676 0.931 5e-97
2499728280 RecName: Full=Ribulose-phosphate 3-epime 1.0 0.678 0.910 6e-97
363807408280 uncharacterized protein LOC100817791 [Gl 1.0 0.678 0.915 9e-97
388495770283 unknown [Lotus japonicus] 1.0 0.671 0.921 9e-97
227206446190 AT5G61410 [Arabidopsis thaliana] 1.0 1.0 0.931 1e-96
>gi|356511994|ref|XP_003524706.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/190 (94%), Positives = 185/190 (97%)

Query: 1   MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60
           MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST
Sbjct: 91  MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 150

Query: 61  IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVK 120
           IHLHRT+NQ+K LGAKAGVVLNPAT LSAIE VLDVVDLVLIMSVNPGFGGQSFIESQVK
Sbjct: 151 IHLHRTVNQVKSLGAKAGVVLNPATPLSAIEYVLDVVDLVLIMSVNPGFGGQSFIESQVK 210

Query: 121 KISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK 180
           KISDLRR+C EKGVNPWIEVDGGVGP NAYKVIEAGANALVAGSAVFGAKDYAEAI+GIK
Sbjct: 211 KISDLRRVCAEKGVNPWIEVDGGVGPANAYKVIEAGANALVAGSAVFGAKDYAEAIRGIK 270

Query: 181 TSKRPQAVAV 190
           TSKRP+AVAV
Sbjct: 271 TSKRPEAVAV 280




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449439289|ref|XP_004137418.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Cucumis sativus] gi|449486996|ref|XP_004157465.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225457361|ref|XP_002284772.1| PREDICTED: ribulose-phosphate 3-epimerase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224124194|ref|XP_002330128.1| predicted protein [Populus trichocarpa] gi|222871262|gb|EEF08393.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297797095|ref|XP_002866432.1| hypothetical protein ARALYDRAFT_919384 [Arabidopsis lyrata subsp. lyrata] gi|297312267|gb|EFH42691.1| hypothetical protein ARALYDRAFT_919384 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15240250|ref|NP_200949.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|30697525|ref|NP_851240.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|4102703|gb|AAD09954.1| ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|9757862|dbj|BAB08496.1| ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|15027997|gb|AAK76529.1| putative ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|20259209|gb|AAM14320.1| putative ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|332010080|gb|AED97463.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] gi|332010081|gb|AED97464.1| D-ribulose-5-phosphate-3-epimerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|2499728|sp|Q43843.1|RPE_SOLTU RecName: Full=Ribulose-phosphate 3-epimerase, chloroplastic; AltName: Full=Pentose-5-phosphate 3-epimerase; Short=PPE; AltName: Full=R5P3E; Short=RPE; Flags: Precursor gi|902739|emb|CAA90426.1| pentose-5-phosphate-3-epimerase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|363807408|ref|NP_001242382.1| uncharacterized protein LOC100817791 [Glycine max] gi|255647180|gb|ACU24058.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388495770|gb|AFK35951.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|227206446|dbj|BAH57278.1| AT5G61410 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
UNIPROTKB|Q43843280 Q43843 "Ribulose-phosphate 3-e 1.0 0.678 0.910 2.2e-89
TAIR|locus:2163228281 RPE "D-ribulose-5-phosphate-3- 1.0 0.676 0.931 2.2e-89
UNIPROTKB|Q43157285 RPE "Ribulose-phosphate 3-epim 1.0 0.666 0.921 1.2e-88
TIGR_CMR|GSU_3374221 GSU_3374 "ribulose-phosphate 3 0.963 0.828 0.580 2.4e-51
TIGR_CMR|BA_3998214 BA_3998 "ribulose-phosphate 3- 0.936 0.831 0.588 1.3e-50
TIGR_CMR|CHY_1476219 CHY_1476 "ribulose-phosphate 3 0.915 0.794 0.516 4.6e-41
TIGR_CMR|ECH_0082228 ECH_0082 "ribulose-phosphate 3 0.947 0.789 0.489 1.6e-40
TIGR_CMR|APH_0002236 APH_0002 "ribulose-phosphate 3 0.942 0.758 0.475 5.3e-40
UNIPROTKB|P0AG07225 rpe [Escherichia coli K-12 (ta 0.942 0.795 0.478 1.4e-39
UNIPROTKB|Q9KNV5236 VC_2625 "Ribulose-phosphate 3- 0.936 0.754 0.464 1.6e-38
UNIPROTKB|Q43843 Q43843 "Ribulose-phosphate 3-epimerase, chloroplastic" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
 Score = 892 (319.1 bits), Expect = 2.2e-89, P = 2.2e-89
 Identities = 173/190 (91%), Positives = 183/190 (96%)

Query:     1 MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60
             MDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSST
Sbjct:    91 MDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSST 150

Query:    61 IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVK 120
             IHLHRT+NQIK LGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVK
Sbjct:   151 IHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVK 210

Query:   121 KISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK 180
             KISDLR++C E+G+NPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGA DYAEAIKGIK
Sbjct:   211 KISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPDYAEAIKGIK 270

Query:   181 TSKRPQAVAV 190
             TSKRP+AVAV
Sbjct:   271 TSKRPEAVAV 280




GO:0004750 "ribulose-phosphate 3-epimerase activity" evidence=ISS
GO:0009535 "chloroplast thylakoid membrane" evidence=ISS
TAIR|locus:2163228 RPE "D-ribulose-5-phosphate-3-epimerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q43157 RPE "Ribulose-phosphate 3-epimerase, chloroplastic" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3374 GSU_3374 "ribulose-phosphate 3-epimerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3998 BA_3998 "ribulose-phosphate 3-epimerase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1476 CHY_1476 "ribulose-phosphate 3-epimerase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0082 ECH_0082 "ribulose-phosphate 3-epimerase" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0002 APH_0002 "ribulose-phosphate 3-epimerase" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
UNIPROTKB|P0AG07 rpe [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNV5 VC_2625 "Ribulose-phosphate 3-epimerase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P74061RPE_SYNY35, ., 1, ., 3, ., 10.68270.97890.8086N/Ano
P56188RPE_HELPY5, ., 1, ., 3, ., 10.40740.96310.8433yesno
O34557RPE_BACSU5, ., 1, ., 3, ., 10.63040.95260.8341yesno
Q9ZJ75RPE_HELPJ5, ., 1, ., 3, ., 10.40740.96310.8433yesno
Q43843RPE_SOLTU5, ., 1, ., 3, ., 10.91051.00.6785N/Ano
Q43157RPE_SPIOL5, ., 1, ., 3, ., 10.92101.00.6666N/Ano
Q9ZTP5RPE_ORYSJ5, ., 1, ., 3, ., 10.92020.98940.6861yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.10.991
3rd Layer5.1.30.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
PLN02334229 PLN02334, PLN02334, ribulose-phosphate 3-epimerase 1e-113
PRK05581220 PRK05581, PRK05581, ribulose-phosphate 3-epimerase 1e-103
cd00429211 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RP 1e-101
COG0036220 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Car 5e-92
pfam00834201 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 ep 4e-91
TIGR01163210 TIGR01163, rpe, ribulose-phosphate 3-epimerase 8e-91
PRK09722229 PRK09722, PRK09722, allulose-6-phosphate 3-epimera 1e-55
PTZ00170228 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epime 2e-53
PRK08883220 PRK08883, PRK08883, ribulose-phosphate 3-epimerase 2e-53
PRK08745223 PRK08745, PRK08745, ribulose-phosphate 3-epimerase 3e-52
PRK08005210 PRK08005, PRK08005, epimerase; Validated 2e-22
PRK14057254 PRK14057, PRK14057, epimerase; Provisional 1e-17
PRK08091228 PRK08091, PRK08091, ribulose-phosphate 3-epimerase 3e-16
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 4e-11
TIGR03128206 TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synth 1e-04
COG0269217 COG0269, SgbH, 3-hexulose-6-phosphate synthase and 2e-04
PRK00043212 PRK00043, thiE, thiamine-phosphate pyrophosphoryla 6e-04
TIGR01740214 TIGR01740, pyrF, orotidine 5'-phosphate decarboxyl 6e-04
cd00564196 cd00564, TMP_TenI, Thiamine monophosphate synthase 0.001
cd04726202 cd04726, KGPDC_HPS, 3-Keto-L-gulonate 6-phosphate 0.002
COG0352211 COG0352, ThiE, Thiamine monophosphate synthase [Co 0.004
>gnl|CDD|215192 PLN02334, PLN02334, ribulose-phosphate 3-epimerase Back     alignment and domain information
 Score =  320 bits (823), Expect = e-113
 Identities = 117/192 (60%), Positives = 134/192 (69%), Gaps = 6/192 (3%)

Query: 1   MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60
           MDG FVPN+TIGP VV ALR  TD PLD HLM+  PE  VPDF KAGA I + H EQ+ST
Sbjct: 42  MDGHFVPNLTIGPPVVKALRKHTDAPLDCHLMVTNPEDYVPDFAKAGASIFTFHIEQAST 101

Query: 61  IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDV--VDLVLIMSVNPGFGGQSFIESQ 118
           IHLHR + QIK  G KAGVVLNP T + A+E V++   VD+VL+MSV PGFGGQSFI S 
Sbjct: 102 IHLHRLIQQIKSAGMKAGVVLNPGTPVEAVEPVVEKGLVDMVLVMSVEPGFGGQSFIPSM 161

Query: 119 VKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKG 178
           + K+  LR+   E      IEVDGGVGP    K  EAGAN +VAGSAVFGA DYAE I G
Sbjct: 162 MDKVRALRKKYPEL----DIEVDGGVGPSTIDKAAEAGANVIVAGSAVFGAPDYAEVISG 217

Query: 179 IKTSKRPQAVAV 190
           ++ S    AVAV
Sbjct: 218 LRASVEKAAVAV 229


Length = 229

>gnl|CDD|235515 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|238244 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>gnl|CDD|223114 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|216142 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase Back     alignment and domain information
>gnl|CDD|236616 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|240303 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|181575 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|136958 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|169179 PRK08005, PRK08005, epimerase; Validated Back     alignment and domain information
>gnl|CDD|172549 PRK14057, PRK14057, epimerase; Provisional Back     alignment and domain information
>gnl|CDD|169215 PRK08091, PRK08091, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|132172 TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synthase Back     alignment and domain information
>gnl|CDD|223347 COG0269, SgbH, 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234590 PRK00043, thiE, thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>gnl|CDD|233555 TIGR01740, pyrF, orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>gnl|CDD|238317 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>gnl|CDD|240077 cd04726, KGPDC_HPS, 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>gnl|CDD|223429 COG0352, ThiE, Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 100.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 100.0
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 100.0
PRK08091228 ribulose-phosphate 3-epimerase; Validated 100.0
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 100.0
PRK08005210 epimerase; Validated 100.0
PRK14057254 epimerase; Provisional 100.0
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 100.0
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 100.0
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 100.0
PLN02334229 ribulose-phosphate 3-epimerase 100.0
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 100.0
PRK05581220 ribulose-phosphate 3-epimerase; Validated 100.0
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 100.0
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 100.0
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 100.0
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 99.98
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 99.97
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 99.97
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.97
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 99.96
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 99.95
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 99.94
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 99.92
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 99.88
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 99.87
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.84
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 99.81
PLN02591250 tryptophan synthase 99.8
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 99.75
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 99.75
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 99.72
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 99.71
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 99.66
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 99.61
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 99.59
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 99.57
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 99.5
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 99.49
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.49
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 99.48
PRK07695201 transcriptional regulator TenI; Provisional 99.46
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.44
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 99.42
PF00215226 OMPdecase: Orotidine 5'-phosphate decarboxylase / 99.41
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 99.37
PRK04302223 triosephosphate isomerase; Provisional 99.36
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.36
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 99.35
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 99.34
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 99.32
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 99.3
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.28
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.26
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 99.24
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 99.22
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.17
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 99.15
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 99.06
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.05
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 99.05
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 99.04
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 99.04
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 99.02
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.01
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 99.01
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 99.0
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 98.99
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 98.96
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.95
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.95
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.95
PRK00208250 thiG thiazole synthase; Reviewed 98.94
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.9
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 98.88
TIGR02127261 pyrF_sub2 orotidine 5'-phosphate decarboxylase, su 98.88
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 98.87
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 98.85
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 98.83
TIGR01334277 modD putative molybdenum utilization protein ModD. 98.82
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.77
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.76
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.74
PRK08999312 hypothetical protein; Provisional 98.72
PRK06806281 fructose-bisphosphate aldolase; Provisional 98.72
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.72
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 98.72
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 98.71
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 98.7
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.66
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.65
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 98.65
PRK07226267 fructose-bisphosphate aldolase; Provisional 98.64
PRK05500 477 bifunctional orotidine 5'-phosphate decarboxylase/ 98.63
PLN02460338 indole-3-glycerol-phosphate synthase 98.63
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 98.63
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 98.62
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.62
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.61
PRK14024241 phosphoribosyl isomerase A; Provisional 98.6
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 98.55
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.54
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 98.52
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 98.52
PRK06096284 molybdenum transport protein ModD; Provisional 98.52
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.51
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 98.51
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 98.51
PRK00125278 pyrF orotidine 5'-phosphate decarboxylase; Reviewe 98.5
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 98.49
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 98.48
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 98.47
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 98.44
PRK07315293 fructose-bisphosphate aldolase; Provisional 98.43
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.43
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 98.41
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.41
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 98.39
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 98.38
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 98.38
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 98.38
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 98.38
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 98.37
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.37
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 98.35
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 98.35
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 98.34
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.34
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.33
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 98.32
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 98.32
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 98.32
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.32
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.32
cd02812219 PcrB_like PcrB_like proteins. One member of this f 98.31
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 98.27
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 98.25
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 98.25
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 98.24
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 98.23
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 98.22
PRK14567253 triosephosphate isomerase; Provisional 98.22
CHL00162267 thiG thiamin biosynthesis protein G; Validated 98.2
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 98.2
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 98.19
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 98.18
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.17
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 98.17
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 98.15
PRK08227264 autoinducer 2 aldolase; Validated 98.14
PLN02274505 inosine-5'-monophosphate dehydrogenase 98.14
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 98.13
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 98.12
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 98.12
PRK14565237 triosephosphate isomerase; Provisional 98.12
PRK00042250 tpiA triosephosphate isomerase; Provisional 98.11
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.11
PRK06801286 hypothetical protein; Provisional 98.11
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 98.11
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 98.1
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 98.1
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 98.08
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 98.07
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 98.07
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 98.05
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 98.03
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 98.03
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 98.02
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 98.02
PF00697197 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome 97.99
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 97.99
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 97.96
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 97.95
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 97.95
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 97.92
PLN02429315 triosephosphate isomerase 97.91
PLN02446 262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.89
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 97.87
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 97.87
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 97.87
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 97.86
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 97.86
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 97.85
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 97.85
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 97.83
PRK11572248 copper homeostasis protein CutC; Provisional 97.83
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 97.82
PRK15492260 triosephosphate isomerase; Provisional 97.81
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.81
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 97.81
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.8
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 97.8
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.8
PTZ00333255 triosephosphate isomerase; Provisional 97.79
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.78
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 97.75
PRK09016296 quinolinate phosphoribosyltransferase; Validated 97.75
PLN02617 538 imidazole glycerol phosphate synthase hisHF 97.75
PRK14114 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.74
PF00977 229 His_biosynth: Histidine biosynthesis protein; Inte 97.73
PF00121244 TIM: Triosephosphate isomerase; InterPro: IPR00065 97.73
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.72
PRK13586 232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.71
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 97.7
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 97.7
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 97.7
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 97.69
PLN02561253 triosephosphate isomerase 97.69
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 97.68
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 97.68
PRK13587 234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.68
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 97.67
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 97.66
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.65
PRK14024 241 phosphoribosyl isomerase A; Provisional 97.64
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 97.64
PRK13585 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.62
PRK00748 233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.61
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 97.6
KOG4201289 consensus Anthranilate synthase component II [Amin 97.6
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 97.59
COG3142241 CutC Uncharacterized protein involved in copper re 97.58
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 97.57
PRK06852304 aldolase; Validated 97.57
TIGR00007 230 phosphoribosylformimino-5-aminoimidazole carboxami 97.56
PRK08185283 hypothetical protein; Provisional 97.56
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 97.56
PRK12331 448 oxaloacetate decarboxylase; Provisional 97.56
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.55
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 97.53
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 97.53
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 97.5
COG0106 241 HisA Phosphoribosylformimino-5-aminoimidazole carb 97.49
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 97.47
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 97.46
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 97.45
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 97.45
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 97.44
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 97.42
PRK06256336 biotin synthase; Validated 97.41
PLN02979366 glycolate oxidase 97.41
PLN02826409 dihydroorotate dehydrogenase 97.41
PRK14041 467 oxaloacetate decarboxylase; Provisional 97.39
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 97.38
PRK07188352 nicotinate phosphoribosyltransferase; Provisional 97.38
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 97.37
PRK09282 592 pyruvate carboxylase subunit B; Validated 97.36
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 97.36
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 97.36
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 97.35
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 97.35
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 97.34
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 97.34
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.33
TIGR01919 243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.32
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 97.31
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 97.31
PLN02617538 imidazole glycerol phosphate synthase hisHF 97.3
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 97.3
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 97.29
PF01645368 Glu_synthase: Conserved region in glutamate syntha 97.28
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.25
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 97.25
PRK13523337 NADPH dehydrogenase NamA; Provisional 97.24
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 97.22
PRK09250348 fructose-bisphosphate aldolase; Provisional 97.21
cd07943263 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te 97.19
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.19
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 97.17
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 97.13
PLN02623 581 pyruvate kinase 97.13
PRK12330 499 oxaloacetate decarboxylase; Provisional 97.13
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 97.13
TIGR00433296 bioB biotin synthetase. Catalyzes the last step of 97.11
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 97.08
PRK14566260 triosephosphate isomerase; Provisional 97.07
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 97.07
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 97.06
PLN02411391 12-oxophytodienoate reductase 97.06
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 97.05
PRK11197381 lldD L-lactate dehydrogenase; Provisional 97.05
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 97.05
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 97.03
PRK07094323 biotin synthase; Provisional 97.0
cd07938274 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, 96.99
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 96.99
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 96.95
PRK14042 596 pyruvate carboxylase subunit B; Provisional 96.94
PLN02363256 phosphoribosylanthranilate isomerase 96.92
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 96.9
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 96.9
PRK14040 593 oxaloacetate decarboxylase; Provisional 96.88
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 96.88
PRK10605362 N-ethylmaleimide reductase; Provisional 96.79
PRK08508279 biotin synthase; Provisional 96.78
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 96.76
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 96.73
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 96.72
PRK12581 468 oxaloacetate decarboxylase; Provisional 96.72
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 96.64
PRK13962645 bifunctional phosphoglycerate kinase/triosephospha 96.63
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 96.62
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 96.6
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 96.55
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 96.53
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 96.51
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 96.51
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 96.5
PF00682237 HMGL-like: HMGL-like of this family is not conserv 96.5
PLN02746347 hydroxymethylglutaryl-CoA lyase 96.47
PRK05826 465 pyruvate kinase; Provisional 96.45
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 96.44
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 96.41
PLN02389379 biotin synthase 96.41
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 96.39
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 96.38
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 96.37
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 96.36
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 96.36
PLN02535364 glycolate oxidase 96.35
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 96.35
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 96.34
PRK08662343 nicotinate phosphoribosyltransferase; Reviewed 96.34
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 96.33
PRK15452 443 putative protease; Provisional 96.33
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 96.31
TIGR01306 321 GMP_reduct_2 guanosine monophosphate reductase, ba 96.3
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 96.3
PRK04165 450 acetyl-CoA decarbonylase/synthase complex subunit 96.3
TIGR01417565 PTS_I_fam phosphoenolpyruvate-protein phosphotrans 96.29
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 96.27
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 96.26
PRK12999 1146 pyruvate carboxylase; Reviewed 96.25
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 96.23
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 96.21
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 96.2
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 96.18
COG0325228 Predicted enzyme with a TIM-barrel fold [General f 96.17
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 96.17
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 96.15
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 96.14
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 96.05
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 96.04
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 96.01
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 96.01
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 96.0
cd07945280 DRE_TIM_CMS Leptospira interrogans citramalate syn 96.0
PTZ00300 454 pyruvate kinase; Provisional 95.97
PRK05835307 fructose-bisphosphate aldolase; Provisional 95.93
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 95.87
COG1411229 Uncharacterized protein related to proFAR isomeras 95.82
COG1856275 Uncharacterized homolog of biotin synthetase [Func 95.75
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 95.74
PRK12457281 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 95.72
cd07940268 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N- 95.71
PRK08610286 fructose-bisphosphate aldolase; Reviewed 95.7
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 95.63
PF00224348 PK: Pyruvate kinase, barrel domain; InterPro: IPR0 95.62
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 95.6
TIGR01418782 PEP_synth phosphoenolpyruvate synthase. Also calle 95.57
PRK07709285 fructose-bisphosphate aldolase; Provisional 95.57
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 95.54
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 95.53
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 95.5
COG2108353 Uncharacterized conserved protein related to pyruv 95.49
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 95.48
PF06073110 DUF934: Bacterial protein of unknown function (DUF 95.47
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 95.45
TIGR00284 499 dihydropteroate synthase-related protein. This pro 95.43
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 95.43
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 95.43
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 95.42
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.41
COG0854243 PdxJ Pyridoxal phosphate biosynthesis protein [Coe 95.38
PRK06464795 phosphoenolpyruvate synthase; Validated 95.37
PF03740239 PdxJ: Pyridoxal phosphate biosynthesis protein Pdx 95.35
PRK01362214 putative translaldolase; Provisional 95.33
PRK15447 301 putative protease; Provisional 95.3
PRK07084321 fructose-bisphosphate aldolase; Provisional 95.28
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 95.27
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 95.26
KOG3055 263 consensus Phosphoribosylformimino-5-aminoimidazole 95.19
COG1891235 Uncharacterized protein conserved in archaea [Func 95.18
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 95.17
TIGR00559237 pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req 95.15
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 95.12
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 95.09
PRK05265239 pyridoxine 5'-phosphate synthase; Provisional 95.09
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.06
PRK08649 368 inosine 5-monophosphate dehydrogenase; Validated 95.05
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 95.05
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 95.01
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 94.99
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 94.96
cd00003234 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase 94.94
TIGR01334277 modD putative molybdenum utilization protein ModD. 94.9
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 94.83
PRK09197350 fructose-bisphosphate aldolase; Provisional 94.79
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 94.79
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 94.78
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 94.71
COG0826 347 Collagenase and related proteases [Posttranslation 94.67
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 94.62
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 94.59
cd00288 480 Pyruvate_Kinase Pyruvate kinase (PK): Large allost 94.59
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 94.57
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 94.53
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 94.5
PRK15108345 biotin synthase; Provisional 94.49
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 94.48
KOG0538363 consensus Glycolate oxidase [Energy production and 94.47
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 94.46
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 94.42
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 94.42
PRK09240371 thiH thiamine biosynthesis protein ThiH; Reviewed 94.41
PRK02261137 methylaspartate mutase subunit S; Provisional 94.4
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 94.38
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 94.33
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 94.32
PRK09389 488 (R)-citramalate synthase; Provisional 94.28
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 94.27
PRK06739352 pyruvate kinase; Validated 94.1
cd00946345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 94.08
PRK02227238 hypothetical protein; Provisional 94.02
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 93.91
PRK00915 513 2-isopropylmalate synthase; Validated 93.81
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 93.74
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 93.73
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 93.67
PRK00507221 deoxyribose-phosphate aldolase; Provisional 93.6
PLN02274 505 inosine-5'-monophosphate dehydrogenase 93.53
PF03599 386 CdhD: CO dehydrogenase/acetyl-CoA synthase delta s 93.5
cd00739257 DHPS DHPS subgroup of Pterin binding enzymes. DHPS 93.47
TIGR01064 473 pyruv_kin pyruvate kinase. This enzyme is a homote 93.47
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 93.44
PRK12656222 fructose-6-phosphate aldolase; Reviewed 93.44
PLN028581378 fructose-bisphosphate aldolase 93.39
PRK12653220 fructose-6-phosphate aldolase; Reviewed 93.33
KOG1643247 consensus Triosephosphate isomerase [Carbohydrate 93.28
TIGR00676272 fadh2 5,10-methylenetetrahydrofolate reductase, pr 93.25
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 93.24
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 93.13
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 93.04
PRK09206 470 pyruvate kinase; Provisional 93.03
COG0502335 BioB Biotin synthase and related enzymes [Coenzyme 92.96
PLN03033290 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 92.96
PF09587250 PGA_cap: Bacterial capsule synthesis protein PGA_c 92.89
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 92.78
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 92.69
PRK12344 524 putative alpha-isopropylmalate/homocitrate synthas 92.66
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 92.64
PRK10076213 pyruvate formate lyase II activase; Provisional 92.57
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 92.56
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 92.56
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 92.55
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 92.53
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 92.53
PF13277 253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 92.5
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 92.41
PRK06267350 hypothetical protein; Provisional 92.4
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 92.37
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 92.36
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 92.3
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 92.29
PRK09250348 fructose-bisphosphate aldolase; Provisional 92.27
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 92.25
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 92.2
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 92.09
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 92.08
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 92.06
PRK02227238 hypothetical protein; Provisional 92.04
PRK05437 352 isopentenyl pyrophosphate isomerase; Provisional 92.01
PRK12655220 fructose-6-phosphate aldolase; Reviewed 91.98
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 91.88
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 91.82
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 91.81
cd07939259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 91.76
TIGR02351366 thiH thiazole biosynthesis protein ThiH. Members t 91.75
smart00812 384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 91.73
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 91.72
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 91.7
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 91.67
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 91.61
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 91.6
PRK06096284 molybdenum transport protein ModD; Provisional 91.58
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 91.53
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 91.51
cd06822227 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)- 91.47
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 91.42
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 91.39
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 91.31
TIGR00486249 YbgI_SA1388 dinuclear metal center protein, YbgI/S 91.28
PRK04452319 acetyl-CoA decarbonylase/synthase complex subunit 91.27
PRK06354 590 pyruvate kinase; Provisional 91.24
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 91.23
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 91.2
cd07947279 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt 91.11
TIGR00677281 fadh2_euk methylenetetrahydrofolate reductase, euk 91.06
TIGR03471472 HpnJ hopanoid biosynthesis associated radical SAM 91.05
COG0320306 LipA Lipoate synthase [Coenzyme metabolism] 91.03
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=5.7e-62  Score=383.35  Aligned_cols=181  Identities=57%  Similarity=0.898  Sum_probs=175.2

Q ss_pred             CCccccCcCCCCHHHHHHhccCCCCcEEEEEeecChHHHHHHHHHcCCCEEEEcccCCCcchHHHHHHHHHHhCCcEEEE
Q 029661            1 MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVV   80 (190)
Q Consensus         1 mDg~fvpn~~~G~~~v~~i~~~~~~~i~~hlmv~dp~~~i~~~~~~Gad~v~vh~e~~~~~~~~~~i~~i~~~g~~~g~~   80 (190)
                      ||||||||+||||..+++||+.++.|+||||||.+|++|++.++++|||+||||.|+  .+++.++++.||++|+++|++
T Consensus        38 MDghFVPNiTfGp~~v~~l~~~t~~p~DvHLMV~~p~~~i~~fa~agad~It~H~E~--~~~~~r~i~~Ik~~G~kaGv~  115 (220)
T COG0036          38 MDGHFVPNITFGPPVVKALRKITDLPLDVHLMVENPDRYIEAFAKAGADIITFHAEA--TEHIHRTIQLIKELGVKAGLV  115 (220)
T ss_pred             cCCCcCCCcccCHHHHHHHhhcCCCceEEEEecCCHHHHHHHHHHhCCCEEEEEecc--CcCHHHHHHHHHHcCCeEEEE
Confidence            999999999999999999999999999999999999999999999999999999996  678999999999999999999


Q ss_pred             EcCCCCHHHHHHhhcccceEEEEeeecCCCCcccchhhHHHHHHHHHHHhhcCCCCeEEEeCCCCcccHHHHHHcCCCEE
Q 029661           81 LNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANAL  160 (190)
Q Consensus        81 i~p~t~~~~~~~~~~~~d~i~~m~v~pG~~gq~~~~~~~~ki~~~~~~~~~~~~~~~i~vdGGI~~e~~~~~~~aGad~~  160 (190)
                      +||.||++.++++++.+|+|++|||+|||+||+|+|.+++||+++|+++++++ ++.|+||||||.+|++++.++|||++
T Consensus       116 lnP~Tp~~~i~~~l~~vD~VllMsVnPGfgGQ~Fi~~~l~Ki~~lr~~~~~~~-~~~IeVDGGI~~~t~~~~~~AGad~~  194 (220)
T COG0036         116 LNPATPLEALEPVLDDVDLVLLMSVNPGFGGQKFIPEVLEKIRELRAMIDERL-DILIEVDGGINLETIKQLAAAGADVF  194 (220)
T ss_pred             ECCCCCHHHHHHHHhhCCEEEEEeECCCCcccccCHHHHHHHHHHHHHhcccC-CeEEEEeCCcCHHHHHHHHHcCCCEE
Confidence            99999999999999999999999999999999999999999999999998766 88999999999999999999999999


Q ss_pred             EEcccccCCCCHHHHHHHHHHhhc
Q 029661          161 VAGSAVFGAKDYAEAIKGIKTSKR  184 (190)
Q Consensus       161 VvGsaI~~~~dp~~~~~~l~~~~~  184 (190)
                      |+||++|+++|..+.++.++....
T Consensus       195 VaGSalF~~~d~~~~i~~~~~~~~  218 (220)
T COG0036         195 VAGSALFGADDYKATIRELRGELL  218 (220)
T ss_pred             EEEEEEeCCccHHHHHHHHHHHhh
Confidence            999999999999999999987654



>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>PRK06256 biotin synthase; Validated Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>TIGR00433 bioB biotin synthetase Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PRK14566 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK07094 biotin synthase; Provisional Back     alignment and domain information
>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK13962 bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02389 biotin synthase Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional Back     alignment and domain information
>TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PTZ00300 pyruvate kinase; Provisional Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown] Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PF00224 PK: Pyruvate kinase, barrel domain; InterPro: IPR015793 Pyruvate kinase (2 Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>TIGR01418 PEP_synth phosphoenolpyruvate synthase Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only] Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PF06073 DUF934: Bacterial protein of unknown function (DUF934); InterPro: IPR008318 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK06464 phosphoenolpyruvate synthase; Validated Back     alignment and domain information
>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>PRK15447 putative protease; Provisional Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>KOG3055 consensus Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>PRK05265 pyridoxine 5'-phosphate synthase; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>cd00288 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>PRK09389 (R)-citramalate synthase; Provisional Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06739 pyruvate kinase; Validated Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PF03599 CdhD: CO dehydrogenase/acetyl-CoA synthase delta subunit; InterPro: IPR016041 This entry represents a conserved region predicted to form a TIM alpha/beta barrel, and is found in the delta subunit of a number of CO dehydrogenase/acetyl-CoA synthase enzymes Back     alignment and domain information
>cd00739 DHPS DHPS subgroup of Pterin binding enzymes Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>KOG1643 consensus Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>PF09587 PGA_cap: Bacterial capsule synthesis protein PGA_cap; InterPro: IPR019079 CapA is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK06267 hypothetical protein; Provisional Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR02351 thiH thiazole biosynthesis protein ThiH Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>cd06822 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Eukaryotic YBL036c-like proteins Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00486 YbgI_SA1388 dinuclear metal center protein, YbgI/SA1388 family Back     alignment and domain information
>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional Back     alignment and domain information
>PRK06354 pyruvate kinase; Provisional Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00677 fadh2_euk methylenetetrahydrofolate reductase, eukaryotic type Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>COG0320 LipA Lipoate synthase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1rpx_A230 D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tub 4e-97
1tqj_A230 Crystal Structure Of D-Ribulose 5-Phosphate 3-Epime 3e-72
2fli_A220 The Crystal Structure Of D-Ribulose 5-Phosphate 3-E 4e-44
3inp_A246 2.05 Angstrom Resolution Crystal Structure Of D-Rib 8e-34
1h1y_A228 The Structure Of The Cytosolic D-Ribulose-5-Phospha 9e-30
3ovp_A228 Crystal Structure Of Hrpe Length = 228 3e-28
3ct7_A231 Crystal Structure Of D-Allulose 6-Phosphate 3-Epime 1e-27
3qc3_A225 Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epi 3e-24
1tqx_A227 Crystal Structure Of Pfal009167 A Putative D-Ribulo 9e-23
>pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tuberosum Chloroplasts Length = 230 Back     alignment and structure

Iteration: 1

Score = 350 bits (897), Expect = 4e-97, Method: Compositional matrix adjust. Identities = 169/186 (90%), Positives = 179/186 (96%) Query: 1 MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60 MDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSST Sbjct: 45 MDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSST 104 Query: 61 IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVK 120 IHLHRT+NQIK LGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVK Sbjct: 105 IHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVK 164 Query: 121 KISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK 180 KISDLR++C E+G+NPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGA DYAEAIKGIK Sbjct: 165 KISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPDYAEAIKGIK 224 Query: 181 TSKRPQ 186 TSKRP+ Sbjct: 225 TSKRPE 230
>pdb|1TQJ|A Chain A, Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Synechocystis To 1.6 Angstrom Resolution Length = 230 Back     alignment and structure
>pdb|2FLI|A Chain A, The Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Streptococus Pyogenes Complexed With D-Xylitol 5- Phosphate Length = 220 Back     alignment and structure
>pdb|3INP|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of D-Ribulose-Phosphate 3- Epimerase From Francisella Tularensis Length = 246 Back     alignment and structure
>pdb|1H1Y|A Chain A, The Structure Of The Cytosolic D-Ribulose-5-Phosphate 3- Epimerase From Rice Complexed With Sulfate Length = 228 Back     alignment and structure
>pdb|3OVP|A Chain A, Crystal Structure Of Hrpe Length = 228 Back     alignment and structure
>pdb|3CT7|A Chain A, Crystal Structure Of D-Allulose 6-Phosphate 3-Epimerase From Escherichia Coli K-12 Length = 231 Back     alignment and structure
>pdb|3QC3|A Chain A, Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epimerase (Np_954699) From Homo Sapiens At 2.20 A Resolution Length = 225 Back     alignment and structure
>pdb|1TQX|A Chain A, Crystal Structure Of Pfal009167 A Putative D-Ribulose 5-Phosphate 3- Epimerase From P.Falciparum Length = 227 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 1e-122
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 1e-121
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 1e-112
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 1e-108
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 1e-103
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 1e-102
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 1e-100
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 2e-96
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 3e-93
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 1e-29
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 2e-28
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 4e-28
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 7e-27
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 6e-23
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 5e-04
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Length = 230 Back     alignment and structure
 Score =  343 bits (882), Expect = e-122
 Identities = 169/186 (90%), Positives = 179/186 (96%)

Query: 1   MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60
           MDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSST
Sbjct: 45  MDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSST 104

Query: 61  IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVK 120
           IHLHRT+NQIK LGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVK
Sbjct: 105 IHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVK 164

Query: 121 KISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK 180
           KISDLR++C E+G+NPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGA DYAEAIKGIK
Sbjct: 165 KISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPDYAEAIKGIK 224

Query: 181 TSKRPQ 186
           TSKRP+
Sbjct: 225 TSKRPE 230


>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Length = 230 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Length = 220 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Length = 246 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Length = 231 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Length = 228 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} PDB: 3ovq_A* 3ovr_A* 3qc3_A Length = 228 Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Length = 237 Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Length = 227 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Length = 221 Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Length = 216 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Length = 207 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A* Length = 218 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} Length = 211 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Length = 215 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d1rpxa_230 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P 4e-66
d1tqja_221 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {S 3e-59
d2flia1217 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimera 6e-55
d1h1ya_220 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {R 2e-40
d1tqxa_221 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P 4e-38
d1q6oa_213 c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarbo 2e-34
d2czda1206 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decar 3e-08
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 5e-08
d1w0ma_226 c.1.1.1 (A:) Triosephosphate isomerase {Thermoprot 5e-06
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 6e-06
d1xi3a_206 c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon 9e-06
d1wa3a1202 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga marit 2e-05
d1km4a_212 c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl 5e-05
d2tpsa_226 c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus 8e-05
d1hg3a_224 c.1.1.1 (A:) Triosephosphate isomerase {Archaeon P 7e-04
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: D-ribulose-5-phosphate 3-epimerase
domain: D-ribulose-5-phosphate 3-epimerase
species: Potato (Solanum tuberosum) [TaxId: 4113]
 Score =  200 bits (509), Expect = 4e-66
 Identities = 169/186 (90%), Positives = 179/186 (96%)

Query: 1   MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSST 60
           MDGRFVPNITIGPLVVD+LRP+TDLPLDVHLMIVEP+QRVPDFIKAGADIVSVHCEQSST
Sbjct: 45  MDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSST 104

Query: 61  IHLHRTLNQIKDLGAKAGVVLNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVK 120
           IHLHRT+NQIK LGAKAGVVLNP T L+AIE VLD VDLVLIMSVNPGFGGQSFIESQVK
Sbjct: 105 IHLHRTINQIKSLGAKAGVVLNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVK 164

Query: 121 KISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAKDYAEAIKGIK 180
           KISDLR++C E+G+NPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGA DYAEAIKGIK
Sbjct: 165 KISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANALVAGSAVFGAPDYAEAIKGIK 224

Query: 181 TSKRPQ 186
           TSKRP+
Sbjct: 225 TSKRPE 230


>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 221 Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Length = 217 Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Length = 220 Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Length = 221 Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Length = 206 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Length = 226 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Length = 206 Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Length = 202 Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 212 Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 224 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 100.0
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 100.0
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 100.0
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 100.0
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 100.0
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 99.95
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 99.71
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 99.71
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 99.7
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 99.69
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 99.67
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 99.66
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 99.6
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 99.47
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 99.43
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 99.28
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 99.18
d1vqta1198 Orotidine 5'-monophosphate decarboxylase (OMP deca 99.14
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.14
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 99.02
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.96
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 98.95
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 98.94
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 98.92
d1dqwa_267 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.92
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 98.91
d2ffca1332 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.63
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.54
d2fdsa1324 Protozoan orotidine monophosphate decarboxylase {P 98.52
d2q8za1323 Protozoan orotidine monophosphate decarboxylase {P 98.52
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 98.46
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 98.44
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.4
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 98.22
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 98.21
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 98.16
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 98.13
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 98.13
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 98.07
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 98.07
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 97.95
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 97.95
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 97.87
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 97.8
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.77
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 97.76
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 97.75
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 97.72
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 97.7
d1thfd_ 253 Cyclase subunit (or domain) of imidazoleglycerolph 97.69
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.68
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 97.67
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.67
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.62
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 97.59
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 97.57
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 97.56
d1h5ya_ 252 Cyclase subunit (or domain) of imidazoleglycerolph 97.55
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 97.53
d1m6ja_260 Triosephosphate isomerase {Entamoeba histolytica [ 97.53
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.5
d1ka9f_ 251 Cyclase subunit (or domain) of imidazoleglycerolph 97.49
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 97.47
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 97.43
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 97.38
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 97.29
d1n55a_249 Triosephosphate isomerase {Leishmania mexicana [Ta 97.27
d2btma_251 Triosephosphate isomerase {Bacillus stearothermoph 97.26
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 97.18
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 97.04
d1aw1a_255 Triosephosphate isomerase {Vibrio marinus [TaxId: 96.97
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 96.89
d1vzwa1 239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.88
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 96.87
d1kv5a_249 Triosephosphate isomerase {Trypanosoma brucei [Tax 96.85
d1r2ra_246 Triosephosphate isomerase {Rabbit (Oryctolagus cun 96.79
d1qo2a_ 241 Phosphoribosylformimino-5-aminoimidazole carboxami 96.75
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 96.64
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 96.56
d1o5xa_246 Triosephosphate isomerase {Plasmodium falciparum [ 96.43
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 96.41
d1b9ba_252 Triosephosphate isomerase {Thermotoga maritima [Ta 96.41
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 96.34
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 96.34
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 96.25
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 96.17
d1mo0a_257 Triosephosphate isomerase {Nematode (Caenorhabditi 96.16
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 96.09
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 95.95
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 95.92
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 95.87
d1r30a_312 Biotin synthase {Escherichia coli [TaxId: 562]} 95.78
d1ofda2809 Alpha subunit of glutamate synthase, central and F 95.7
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 95.68
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 95.64
d1neya_247 Triosephosphate isomerase {Baker's yeast (Saccharo 95.5
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 95.48
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 95.41
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 95.29
d1pkla2258 Pyruvate kinase, N-terminal domain {Leishmania mex 94.89
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 94.73
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 94.32
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 93.87
d1a3xa2265 Pyruvate kinase, N-terminal domain {Baker's yeast 93.55
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 93.52
d1m5wa_242 Pyridoxine 5'-phosphate synthase {Escherichia coli 92.14
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 92.12
d1ytda1270 Nicotinate phosphoribosyltransferase Ta1145 {Therm 92.06
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 91.98
d2g50a2282 Pyruvate kinase, N-terminal domain {Rabbit (Orycto 91.5
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 90.98
d1e0ta2246 Pyruvate kinase, N-terminal domain {Escherichia co 90.77
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 88.05
d2i14a1279 Nicotinate-nucleotide pyrophosphorylase PF1904 {Py 87.61
d1wx0a1211 Decameric fructose-6-phosphate aldolase/transaldol 86.86
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 86.49
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 84.27
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 83.42
d2f7fa1 345 Putative nicotinate phosphoribosyltransferase EF26 82.79
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: D-ribulose-5-phosphate 3-epimerase
domain: D-ribulose-5-phosphate 3-epimerase
species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00  E-value=0  Score=323.30  Aligned_cols=185  Identities=91%  Similarity=1.380  Sum_probs=177.9

Q ss_pred             CCCCCCCCCCCCHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             98644686777988898703479993788881129588999998749999999113788521999999999809949999
Q 029661            1 MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTLNQIKDLGAKAGVV   80 (190)
Q Consensus         1 mDg~fv~n~~~g~~~i~~i~~~~~~~i~vhlmv~~p~~~i~~~~~~Gad~i~vh~e~~~~~~~~~~i~~i~~~g~~~gl~   80 (190)
                      |||+||||++||+..++++|+.+++++|+|||+.+|..|++.+.++|+|.+++|.|+....++.++++.+|++|+++|++
T Consensus        45 mDG~Fvpn~t~~~~~v~~i~~~t~~~~dvHLMv~~P~~~i~~~~~~g~~~i~~H~E~~~~~~~~~~i~~ik~~g~k~Gia  124 (230)
T d1rpxa_          45 MDGRFVPNITIGPLVVDSLRPITDLPLDVHLMIVEPDQRVPDFIKAGADIVSVHCEQSSTIHLHRTINQIKSLGAKAGVV  124 (230)
T ss_dssp             EBSSSSSCBCCCHHHHHHHGGGCCSCEEEEEESSSHHHHHHHHHHTTCSEEEEECSTTTCSCHHHHHHHHHHTTSEEEEE
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCEEEEE
T ss_conf             46971776552857876655335750645333220666678875325622577322235305999999999869859999


Q ss_pred             ECCCCCHHHHHHHHCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHCCCCEE
Q ss_conf             73899988899743113657997330688875332245899999999876329998089827889115899998099799
Q 029661           81 LNPATSLSAIECVLDVVDLVLIMSVNPGFGGQSFIESQVKKISDLRRMCLEKGVNPWIEVDGGVGPKNAYKVIEAGANAL  160 (190)
Q Consensus        81 i~~~t~~~~~~~~~~~~d~vl~m~v~pG~~gq~~~~~~~~ki~~~~~~~~~~~~~~~i~vdGGI~~~~~~~~~~aGad~i  160 (190)
                      ++|.||++.+.+|++.+|+|++||++||++||+|.+.+++||+++++++.+++.++.|+||||||.+|++++.++|||.+
T Consensus       125 lnp~T~~~~l~~~l~~vD~VllM~V~PGf~GQ~f~~~~~~kI~~~~~~~~~~~~~~~I~vDGGIn~~~i~~l~~~Gad~~  204 (230)
T d1rpxa_         125 LNPGTPLTAIEYVLDAVDLVLIMSVNPGFGGQSFIESQVKKISDLRKICAERGLNPWIEVDGGVGPKNAYKVIEAGANAL  204 (230)
T ss_dssp             ECTTCCGGGGTTTTTTCSEEEEESSCTTCSSCCCCTTHHHHHHHHHHHHHHHTCCCEEEEESSCCTTTHHHHHHHTCCEE
T ss_pred             ECCCCCHHHHHHHHHHCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCCEE
T ss_conf             67999879999999657989998736886420013566899999877777537734899987768999999997699999


Q ss_pred             EECCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             9864256988999999999971031
Q 029661          161 VAGSAVFGAKDYAEAIKGIKTSKRP  185 (190)
Q Consensus       161 VvGsai~~~~d~~~~~~~l~~~~~~  185 (190)
                      |+||+||+++||.+++++||++.++
T Consensus       205 V~GS~if~~~d~~~~i~~lk~~~~~  229 (230)
T d1rpxa_         205 VAGSAVFGAPDYAEAIKGIKTSKRP  229 (230)
T ss_dssp             EESHHHHTSSCHHHHHHHHHTCCCC
T ss_pred             EECHHHHCCCCHHHHHHHHHHHCCC
T ss_conf             9886987899999999999974489



>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]} Back     information, alignment and structure
>d2q8za1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2g50a2 c.1.12.1 (A:12-115,A:218-395) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure