Citrus Sinensis ID: 032180

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MASMVSTNCAQFSGLRRSSPTQSFSQHVNSHLRLFSSRRPRRGSSVVAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISGLNVS
ccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEEEEccccccccHHHHHHHHHHHHccccccccccEEEEcHHHHHHHHHHHHccccccccccccccHHHHHccccEEEEEcccEEEEEccccc
cccHHccccHHHcccccccccccccccccHHHccccccccccccEEEEEcccccEEEEEEccEcccHHHHHHHHHHHHHccccccEEEEEEEcHHcccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHEEcccccc
masmvstncaqfsglrrssptqsfsqHVNSHLRLfssrrprrgssVVAMassnkffvggnwkcngtkESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHfaisglnvs
masmvstncaqfsglrrssptqsfSQHVNSHlrlfssrrprrgSSVVAmassnkffvggnwkcngTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNShfaisglnvs
MASMVSTNCAQFSGLRRSSPTQSFSQHVNshlrlfssrrprrgssVVAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISGLNVS
***************************************************SNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISG****
******************************************************FFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISGLNV*
******************************HLRLFSSRRPRRGSSVVAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISGLNVS
****************************************RRGSSVVAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISGL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASMVSTNCAQFSGLRRSSPTQSFSQHVNSHLRLFSSRRPRRGSSVVAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSSLDAYLVIRFHCEHYVWVYLLVADVCSILEKDLVWAILVVNSHFAISGLNVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
P48496 322 Triosephosphate isomerase N/A no 0.534 0.242 0.680 2e-17
Q9SKP6 315 Triosephosphate isomerase yes no 0.589 0.273 0.577 6e-16
Q9M4S8 314 Triosephosphate isomerase N/A no 0.5 0.232 0.610 1e-15
P46225 298 Triosephosphate isomerase N/A no 0.280 0.137 0.829 5e-13
P60174 286 Triosephosphate isomerase yes no 0.301 0.153 0.608 1e-07
Q5R928 249 Triosephosphate isomerase yes no 0.253 0.148 0.621 8e-07
P60175 249 Triosephosphate isomerase yes no 0.253 0.148 0.621 8e-07
Q2QD07 249 Triosephosphate isomerase N/A no 0.253 0.148 0.621 9e-07
P48497 257 Triosephosphate isomerase N/A no 0.219 0.124 0.625 1e-06
P15426 249 Triosephosphate isomerase yes no 0.253 0.148 0.594 2e-06
>sp|P48496|TPIC_SPIOL Triosephosphate isomerase, chloroplastic OS=Spinacia oleracea GN=TPIP1 PE=1 SV=1 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 66/94 (70%), Gaps = 16/94 (17%)

Query: 3   SMVSTNCAQFSGLRRS--------SPTQSFSQHVNSHLRLFSSRR--PRRGSSVVAMASS 52
           S VST   QFSGLRRS        S   SF Q+V+SHLRL SS R  PR    VVAMA S
Sbjct: 17  SAVST---QFSGLRRSFLKLENSVSTQSSFFQNVDSHLRLSSSSRRCPR---GVVAMAGS 70

Query: 53  NKFFVGGNWKCNGTKESITKLVSDLNDAKLEADV 86
            KFFVGGNWKCNGTKESITKLVSDLN A LEADV
Sbjct: 71  GKFFVGGNWKCNGTKESITKLVSDLNSATLEADV 104

Spinacia oleracea (taxid: 3562)
EC: 5EC: .EC: 3EC: .EC: 1EC: .EC: 1
>sp|Q9SKP6|TPIC_ARATH Triosephosphate isomerase, chloroplastic OS=Arabidopsis thaliana GN=TIM PE=1 SV=1 Back     alignment and function description
>sp|Q9M4S8|TPIC_FRAAN Triosephosphate isomerase, chloroplastic OS=Fragaria ananassa GN=TPI PE=2 SV=1 Back     alignment and function description
>sp|P46225|TPIC_SECCE Triosephosphate isomerase, chloroplastic OS=Secale cereale PE=1 SV=1 Back     alignment and function description
>sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens GN=TPI1 PE=1 SV=3 Back     alignment and function description
>sp|Q5R928|TPIS_PONAB Triosephosphate isomerase OS=Pongo abelii GN=TPI1 PE=2 SV=1 Back     alignment and function description
>sp|P60175|TPIS_PANTR Triosephosphate isomerase OS=Pan troglodytes GN=TPI1 PE=2 SV=2 Back     alignment and function description
>sp|Q2QD07|TPIS_GORGO Triosephosphate isomerase OS=Gorilla gorilla gorilla GN=TPI1 PE=3 SV=1 Back     alignment and function description
>sp|P48497|TPIS_STELP Triosephosphate isomerase, cytosolic OS=Stellaria longipes GN=TPI PE=2 SV=1 Back     alignment and function description
>sp|P15426|TPIS_MACMU Triosephosphate isomerase OS=Macaca mulatta GN=TPI1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
295687231 307 triosephosphate isomerase [Gossypium hir 0.561 0.267 0.677 2e-25
255576721 313 triosephosphate isomerase, putative [Ric 0.575 0.268 0.621 3e-21
225427917 324 PREDICTED: triosephosphate isomerase, ch 0.506 0.228 0.643 2e-18
118487691 313 unknown [Populus trichocarpa] 0.520 0.242 0.625 6e-18
388515189 307 unknown [Lotus japonicus] 0.554 0.263 0.582 1e-16
224103243 315 predicted protein [Populus trichocarpa] 0.541 0.250 0.576 6e-16
449458564 306 PREDICTED: triosephosphate isomerase, ch 0.575 0.274 0.566 9e-16
357159648 302 PREDICTED: triosephosphate isomerase, ch 0.547 0.264 0.552 1e-15
1351271 322 RecName: Full=Triosephosphate isomerase, 0.534 0.242 0.680 1e-15
388507284 312 unknown [Medicago truncatula] 0.575 0.269 0.541 1e-15
>gi|295687231|gb|ADG27841.1| triosephosphate isomerase [Gossypium hirsutum] Back     alignment and taxonomy information
 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/90 (67%), Positives = 69/90 (76%), Gaps = 8/90 (8%)

Query: 3  SMVSTNCAQFSGLRRSSP------TQSFSQHVNSHLRLFSSRRPRRGSSVVAMASSNKFF 56
          +M+ST C  F+GL RSSP      +QSF QH+NS LRL SSR+P R  +V AMA S KFF
Sbjct: 2  AMISTYCPHFNGLHRSSPKLDSSQSQSFLQHINSQLRLASSRKPCR--AVTAMAGSGKFF 59

Query: 57 VGGNWKCNGTKESITKLVSDLNDAKLEADV 86
          VGGNWKCNGTK+SITKLVSDLN AKLE DV
Sbjct: 60 VGGNWKCNGTKDSITKLVSDLNSAKLETDV 89

Source: Gossypium hirsutum

Species: Gossypium hirsutum

Genus: Gossypium

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255576721|ref|XP_002529248.1| triosephosphate isomerase, putative [Ricinus communis] gi|223531284|gb|EEF33126.1| triosephosphate isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225427917|ref|XP_002274871.1| PREDICTED: triosephosphate isomerase, chloroplastic-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|118487691|gb|ABK95670.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388515189|gb|AFK45656.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224103243|ref|XP_002312980.1| predicted protein [Populus trichocarpa] gi|222849388|gb|EEE86935.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458564|ref|XP_004147017.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cucumis sativus] gi|449489711|ref|XP_004158393.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357159648|ref|XP_003578514.1| PREDICTED: triosephosphate isomerase, chloroplastic-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|1351271|sp|P48496.1|TPIC_SPIOL RecName: Full=Triosephosphate isomerase, chloroplastic; Short=TIM; Short=Triose-phosphate isomerase; Flags: Precursor gi|806312|gb|AAA66289.1| triosephosphate isomerase, chloroplast isozyme [Spinacia oleracea] Back     alignment and taxonomy information
>gi|388507284|gb|AFK41708.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:2047072 315 TIM "triosephosphate isomerase 0.589 0.273 0.515 3.6e-16
UNIPROTKB|P60174 286 TPI1 "Triosephosphate isomeras 0.260 0.132 0.631 1.1e-07
TAIR|locus:2099906 254 TPI "triosephosphate isomerase 0.273 0.157 0.536 1.8e-07
UNIPROTKB|G4MVL8 250 MGG_08905 "Triosephosphate iso 0.232 0.136 0.676 2.2e-07
UNIPROTKB|P54714 249 TPI1 "Triosephosphate isomeras 0.253 0.148 0.594 4.7e-07
UNIPROTKB|D0G7F6 248 TPI1 "Triosephosphate isomeras 0.253 0.149 0.594 6.1e-07
UNIPROTKB|Q29371 248 TPI1 "Triosephosphate isomeras 0.253 0.149 0.594 6.1e-07
UNIPROTKB|Q5E956 249 TPI1 "Triosephosphate isomeras 0.253 0.148 0.594 6.2e-07
RGD|3896 249 Tpi1 "triosephosphate isomeras 0.253 0.148 0.621 6.2e-07
ZFIN|ZDB-GENE-020416-4 248 tpi1b "triosephosphate isomera 0.239 0.141 0.628 1.3e-06
TAIR|locus:2047072 TIM "triosephosphate isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 3.6e-16, P = 3.6e-16
 Identities = 50/97 (51%), Positives = 53/97 (54%)

Query:     1 MASMVSTNCAQFSGLRRSSPT---------QSFSQHVNXXXXXXXXXXXXXXX--XVVAM 49
             MA+   T    FSGLRR SP          QSF   VN                  VVAM
Sbjct:     1 MAATSLTAPPSFSGLRRISPKLDAAAVSSHQSFFHRVNSSTRLVSSSSSSHRSPRGVVAM 60

Query:    50 ASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADV 86
             A S KFFVGGNWKCNGTK+SI KL+SDLN A LEADV
Sbjct:    61 AGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADV 97
GO:0003824 "catalytic activity" evidence=IEA
GO:0004807 "triose-phosphate isomerase activity" evidence=IEA;ISS;IDA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0019253 "reductive pentose-phosphate cycle" evidence=ISS
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0006642 "triglyceride mobilization" evidence=IMP
GO:0009658 "chloroplast organization" evidence=IMP
GO:0019563 "glycerol catabolic process" evidence=IMP
GO:0032504 "multicellular organism reproduction" evidence=IMP
GO:0046166 "glyceraldehyde-3-phosphate biosynthetic process" evidence=IDA
GO:0080022 "primary root development" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006569 "tryptophan catabolic process" evidence=RCA
GO:0006816 "calcium ion transport" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0032880 "regulation of protein localization" evidence=RCA
UNIPROTKB|P60174 TPI1 "Triosephosphate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2099906 TPI "triosephosphate isomerase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4MVL8 MGG_08905 "Triosephosphate isomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|P54714 TPI1 "Triosephosphate isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D0G7F6 TPI1 "Triosephosphate isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q29371 TPI1 "Triosephosphate isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E956 TPI1 "Triosephosphate isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|3896 Tpi1 "triosephosphate isomerase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020416-4 tpi1b "triosephosphate isomerase 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.1.1LOW CONFIDENCE prediction!
3rd Layer5.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036055001
RecName- Full=Triosephosphate isomerase; EC=5.3.1.1; (321 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00035677001
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (401 aa)
•••• •• 0.995
GSVIVG00035675001
RecName- Full=Phosphoglycerate kinase; EC=2.7.2.3; (405 aa)
•••• •• 0.995
GSVIVG00035097001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (342 aa)
•• • •• 0.958
GSVIVG00020570001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (337 aa)
•• • •• 0.958
GAPDH
SubName- Full=Chromosome chr17 scaffold_246, whole genome shotgun sequence; (317 aa)
•• • •• 0.953
GSVIVG00002074001
SubName- Full=Chromosome chr19 scaffold_126, whole genome shotgun sequence; (429 aa)
•• • •• 0.946
GSVIVG00002909001
SubName- Full=Chromosome chr18 scaffold_137, whole genome shotgun sequence; (453 aa)
•    •• 0.939
GSVIVG00038435001
SubName- Full=Chromosome chr16 scaffold_94, whole genome shotgun sequence; (620 aa)
     •• 0.935
GSVIVG00014624001
RecName- Full=Glucose-6-phosphate isomerase; EC=5.3.1.9; (340 aa)
   • •• 0.935
GSVIVG00026404001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (620 aa)
     •• 0.934

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
PLN02429 315 PLN02429, PLN02429, triosephosphate isomerase 7e-16
PTZ00333 255 PTZ00333, PTZ00333, triosephosphate isomerase; Pro 1e-09
PLN02561 253 PLN02561, PLN02561, triosephosphate isomerase 2e-09
cd00311 242 cd00311, TIM, Triosephosphate isomerase (TIM) is a 3e-07
pfam00121 242 pfam00121, TIM, Triosephosphate isomerase 1e-05
PRK00042 250 PRK00042, tpiA, triosephosphate isomerase; Provisi 0.003
>gnl|CDD|166070 PLN02429, PLN02429, triosephosphate isomerase Back     alignment and domain information 
 Score = 72.1 bits (176), Expect = 7e-16
 Identities = 58/100 (58%), Positives = 61/100 (61%), Gaps = 17/100 (17%)

Query: 1  MASMVSTNCAQFSGLRRSSPT---------QSFSQHVNSHLRLFSS-----RRPRRGSSV 46
          MA+   T    FSGLRR SP          QSF   VNS  RL SS     R PR    V
Sbjct: 1  MAATSLTAPPSFSGLRRISPKLDAAAVSSHQSFFHRVNSSTRLVSSSSSSHRSPR---GV 57

Query: 47 VAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADV 86
          VAMA S KFFVGGNWKCNGTK+SI KL+SDLN A LEADV
Sbjct: 58 VAMAGSGKFFVGGNWKCNGTKDSIAKLISDLNSATLEADV 97

Length = 315
>gnl|CDD|240365 PTZ00333, PTZ00333, triosephosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|178175 PLN02561, PLN02561, triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|238190 cd00311, TIM, Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>gnl|CDD|215732 pfam00121, TIM, Triosephosphate isomerase Back     alignment and domain information
>gnl|CDD|234589 PRK00042, tpiA, triosephosphate isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PLN02429 315 triosephosphate isomerase 99.94
KOG1643 247 consensus Triosephosphate isomerase [Carbohydrate 99.89
PRK15492 260 triosephosphate isomerase; Provisional 99.87
PLN02561 253 triosephosphate isomerase 99.86
PRK14566 260 triosephosphate isomerase; Provisional 99.86
PRK14567 253 triosephosphate isomerase; Provisional 99.85
PRK00042 250 tpiA triosephosphate isomerase; Provisional 99.85
PTZ00333 255 triosephosphate isomerase; Provisional 99.85
PF00121 244 TIM: Triosephosphate isomerase; InterPro: IPR00065 99.84
PRK14565 237 triosephosphate isomerase; Provisional 99.84
cd00311 242 TIM Triosephosphate isomerase (TIM) is a glycolyti 99.83
PRK14905 355 triosephosphate isomerase/PTS system glucose/sucro 99.83
COG0149 251 TpiA Triosephosphate isomerase [Carbohydrate trans 99.82
PRK13962 645 bifunctional phosphoglycerate kinase/triosephospha 99.81
TIGR00419 205 tim triosephosphate isomerase. Triosephosphate iso 99.8
PRK04302 223 triosephosphate isomerase; Provisional 99.64
>PLN02429 triosephosphate isomerase Back     alignment and domain information 
Probab=99.94  E-value=2.5e-27  Score=201.87  Aligned_cols=128  Identities=49%  Similarity=0.690  Sum_probs=99.7

Q ss_pred             cccccCCcccCCCCc---------cccccccccce---e-cccCCCCCcchhHhhhhcCCceeEeeecccCCHHHHHHHH
Q 032180            8 NCAQFSGLRRSSPTQ---------SFSQHVNSHLR---L-FSSRRPRRGSSVVAMASSNKFFVGGNWKCNGTKESITKLV   74 (146)
Q Consensus         8 ~~~~~~~~~~~~~~~---------~~~~~~~~~~~---~-~~~~~~~r~~~~~~m~~~rk~lViGNWKMNgt~aei~eLl   74 (146)
                      ..++|.|+||.+++.         ++++.+...++   . ++.+++.|+  +++|++.||+||+||||||++.+++.+|+
T Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~k~~i~gNWKmn~t~~~~~~~~   85 (315)
T PLN02429          8 APPSFSGLRRISPKLDAAAVSSHQSFFHRVNSSTRLVSSSSSSHRSPRG--VVAMAGSGKFFVGGNWKCNGTKDSIAKLI   85 (315)
T ss_pred             cCcccccccCCCccccccccccccchhhccccccccccccccccccccc--cccccccCCEEEEEECCcCCCHHHHHHHH
Confidence            446799999999652         22222222111   1 344788888  99999989999999999999999999999


Q ss_pred             HHHhhcccCCCccEEEechHH-H---HHHhcCCee-eecccCccC---CccccchhhhcCC--cEEEEEcccc
Q 032180           75 SDLNDAKLEADVGEMMLLLSS-L---DAYLVIRFH-CEHYVWVYL---LVADVCSILEKDL--VWAILVVNSH  137 (146)
Q Consensus        75 ~~L~~~~~~~~VdVvVaPP~t-v---~~~l~~~I~-GAQNV~~~~---~g~~~~~~~~~~~--~~~~~~~~~~  137 (146)
                      ++++......+++|+|||||+ +   .+.+++.|. |||||++++   .|||||++||||+  .||||||--+
T Consensus        86 ~~l~~~~~~~~v~v~iaPp~~~L~~~~~~~~~~i~vgAQnv~~~~~GayTGEVSa~mLkd~Gv~~ViiGHSER  158 (315)
T PLN02429         86 SDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIDISGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSER  158 (315)
T ss_pred             HHHHhcccCCCceEEEeCCHHHHHHHHHHhcCCCeEEecccCCCCCCCccCcCCHHHHHHcCCCEEEeCcccc
Confidence            999764333469999999997 3   334444688 999999986   5999999999999  9999999643

>KOG1643 consensus Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>PRK14566 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13962 bifunctional phosphoglycerate kinase/triosephosphate isomerase; Provisional Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1wyi_A 250 Human Triosephosphate Isomerase Of New Crystal Form 3e-07
1hti_A 248 Crystal Structure Of Recombinant Human Triosephosph 3e-07
2vom_A 250 Structural Basis Of Human Triosephosphate Isomerase 3e-07
1r2r_A 248 Crystal Structure Of Rabbit Muscle Triosephosphate 8e-07
1sw3_A 248 Triosephosphate Isomerase From Gallus Gallus, Loop 1e-06
1sw0_A 248 Triosephosphate Isomerase From Gallus Gallus, Loop 1e-06
1ssd_A 247 Understanding Protein Lids: Structural Analysis Of 1e-06
1tpw_A 247 Triosephosphate Isomerase Drinks Water To Keep Heal 1e-06
1sw7_A 248 Triosephosphate Isomerase From Gallus Gallus, Loop 1e-06
1sq7_A 247 Understanding Protein Lids: Structural Analysis Of 1e-06
1tpc_1 247 Offset Of A Catalytic Lesion By A Bound Water Solub 1e-06
1tph_1 247 1.8 Angstroms Crystal Structure Of Wild Type Chicke 1e-06
1spq_A 247 Understanding Protein Lids: Structural Analysis Of 1e-06
1tpb_1 247 Offset Of A Catalytic Lesion By A Bound Water Solub 1e-06
1su5_A 247 Understanding Protein Lids: Structural Analysis Of 1e-06
1tpv_A 247 S96p Change Is A Second-Site Suppressor For H95n Sl 1e-06
1tpu_A 247 S96p Change Is A Second-Site Suppressor For H95n Sl 2e-06
3krs_A 271 Structure Of Triosephosphate Isomerase From Cryptos 5e-06
1tim_A 247 Structure Of Triose Phosphate Isomerase From Chicke 6e-06
1i45_A 248 Yeast Triosephosphate Isomerase (Mutant) Length = 2 4e-04
1nf0_A 247 Triosephosphate Isomerase In Complex With Dhap Leng 4e-04
4ff7_A 248 Structure Of C126s Mutant Of Saccharomyces Cerevisi 7e-04
3ypi_A 247 Electrophilic Catalysis In Triosephosphase Isomeras 7e-04
1ypi_A 247 Structure Of Yeast Triosephosphate Isomerase At 1.9 7e-04
>pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form Length = 250 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 27/37 (72%)
Query: 50 ASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADV 86
          A S KFFVGGNWK NG K+S+ +L+  LN AK+ AD 
Sbjct: 3  APSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADT 39
>pdb|1HTI|A Chain A, Crystal Structure Of Recombinant Human Triosephosphate Isomerase At 2.8 Angstroms Resolution. Triosephosphate Isomerase Related Human Genetic Disorders And Comparison With The Trypanosomal Enzyme Length = 248 Back     alignment and structure
>pdb|2VOM|A Chain A, Structural Basis Of Human Triosephosphate Isomerase Deficiency. Mutation E104d And Correlation To Solvent Perturbation. Length = 250 Back     alignment and structure
>pdb|1R2R|A Chain A, Crystal Structure Of Rabbit Muscle Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|1SW3|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant T175v Length = 248 Back     alignment and structure
>pdb|1SW0|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Hinge Mutant K174l, T175w Length = 248 Back     alignment and structure
>pdb|1SSD|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPW|A Chain A, Triosephosphate Isomerase Drinks Water To Keep Healthy Length = 247 Back     alignment and structure
>pdb|1SW7|A Chain A, Triosephosphate Isomerase From Gallus Gallus, Loop 6 Mutant K174n, T175s, A176s Length = 248 Back     alignment and structure
>pdb|1SQ7|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPC|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>pdb|1TPH|1 Chain 1, 1.8 Angstroms Crystal Structure Of Wild Type Chicken Triosephosphate Isomerase-Phosphoglycolohydroxamate Complex Length = 247 Back     alignment and structure
>pdb|1SPQ|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPB|1 Chain 1, Offset Of A Catalytic Lesion By A Bound Water Soluble Length = 247 Back     alignment and structure
>pdb|1SU5|A Chain A, Understanding Protein Lids: Structural Analysis Of Active Hinge Mutants In Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPV|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|1TPU|A Chain A, S96p Change Is A Second-Site Suppressor For H95n Sluggish Mutant Triosephosphate Isomerase Length = 247 Back     alignment and structure
>pdb|3KRS|A Chain A, Structure Of Triosephosphate Isomerase From Cryptosporidium Parvum At 1.55a Resolution Length = 271 Back     alignment and structure
>pdb|1TIM|A Chain A, Structure Of Triose Phosphate Isomerase From Chicken Muscle Length = 247 Back     alignment and structure
>pdb|1I45|A Chain A, Yeast Triosephosphate Isomerase (Mutant) Length = 248 Back     alignment and structure
>pdb|1NF0|A Chain A, Triosephosphate Isomerase In Complex With Dhap Length = 247 Back     alignment and structure
>pdb|4FF7|A Chain A, Structure Of C126s Mutant Of Saccharomyces Cerevisiae Triosephosphate Isomerase Length = 248 Back     alignment and structure
>pdb|3YPI|A Chain A, Electrophilic Catalysis In Triosephosphase Isomerase: The Role Of Histidine-95 Length = 247 Back     alignment and structure
>pdb|1YPI|A Chain A, Structure Of Yeast Triosephosphate Isomerase At 1.9- Angstroms Resolution Length = 247 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
2v5b_A 244 Triosephosphate isomerase; TIM, unfolding, monotct 2e-13
1r2r_A 248 TIM, triosephosphate isomerase; closed loop confor 3e-13
1mo0_A 275 TIM, triosephosphate isomerase; structural genomic 4e-13
2vxn_A 251 Triosephosphate isomerase; fatty acid biosynthesis 5e-13
3th6_A 249 Triosephosphate isomerase; alpha/beta barrel, embr 4e-12
2i9e_A 259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 4e-12
2yc6_A 257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 9e-12
1ney_A 247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 1e-11
2j27_A 250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 1e-11
1o5x_A 248 TIM, triosephosphate isomerase; 2- phosphoglycerat 6e-11
3krs_A 271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 1e-10
3qst_A 255 Triosephosphate isomerase, putative; TIM barrel; 1 9e-10
1m6j_A 261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 4e-09
1tre_A 255 Triosephosphate isomerase; intramolecular oxidored 5e-08
2jgq_A 233 Triosephosphate isomerase; glycolysis, pentose shu 1e-06
1b9b_A 255 TIM, protein (triosephosphate isomerase); thermoph 2e-06
3m9y_A 254 Triosephosphate isomerase; TIM barrel, glycolysis, 2e-05
1aw2_A 256 Triosephosphate isomerase; psychrophilic, vibrio m 3e-05
3kxq_A 275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 6e-05
4g1k_A 272 Triosephosphate isomerase; structural genomics, se 1e-04
1hg3_A 225 Triosephosphate isomerase; thermostability, tetram 2e-04
1w0m_A 226 TIM, triosephosphate isomerase; glycolysis, glucon 3e-04
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Length = 244 Back     alignment and structure
 Score = 64.4 bits (158), Expect = 2e-13
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 49 MASSNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADV 86
          MAS  +     NWKCNG++  +  L+  LN A  + DV
Sbjct: 1  MASKPQPIAAANWKCNGSESLLVPLIETLNAATFDHDV 38
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Length = 248 Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Length = 275 Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Length = 251 Back     alignment and structure
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Length = 249 Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Length = 259 Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Length = 257 Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Length = 247 Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Length = 250 Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Length = 248 Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Length = 271 Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Length = 255 Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Length = 261 Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Length = 255 Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Length = 233 Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Length = 255 Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} Length = 254 Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Length = 256 Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Length = 275 Back     alignment and structure
>4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} Length = 272 Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Length = 225 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Length = 226 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
4g1k_A 272 Triosephosphate isomerase; structural genomics, se 99.91
3th6_A 249 Triosephosphate isomerase; alpha/beta barrel, embr 99.91
2vxn_A 251 Triosephosphate isomerase; fatty acid biosynthesis 99.91
1mo0_A 275 TIM, triosephosphate isomerase; structural genomic 99.91
3kxq_A 275 Triosephosphate isomerase; ssgcid, NIH, niaid, SBR 99.91
1r2r_A 248 TIM, triosephosphate isomerase; closed loop confor 99.91
3krs_A 271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 99.91
3qst_A 255 Triosephosphate isomerase, putative; TIM barrel; 1 99.9
2yc6_A 257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 99.9
2j27_A 250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 99.9
1o5x_A 248 TIM, triosephosphate isomerase; 2- phosphoglycerat 99.9
2i9e_A 259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 99.9
1ney_A 247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 99.9
1m6j_A 261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 99.9
3m9y_A 254 Triosephosphate isomerase; TIM barrel, glycolysis, 99.9
1b9b_A 255 TIM, protein (triosephosphate isomerase); thermoph 99.9
1yya_A 250 Triosephosphate isomerase; riken structural genomi 99.9
3ta6_A 267 Triosephosphate isomerase; HET: FLC; 1.41A {Mycoba 99.9
1tre_A 255 Triosephosphate isomerase; intramolecular oxidored 99.89
1aw2_A 256 Triosephosphate isomerase; psychrophilic, vibrio m 99.89
3s6d_A 310 Putative triosephosphate isomerase; seattle struct 99.88
2btm_A 252 TIM, protein (triosephosphate isomerase); thermoph 99.88
2jgq_A 233 Triosephosphate isomerase; glycolysis, pentose shu 99.86
2v5b_A 244 Triosephosphate isomerase; TIM, unfolding, monotct 99.86
1hg3_A 225 Triosephosphate isomerase; thermostability, tetram 99.79
1w0m_A 226 TIM, triosephosphate isomerase; glycolysis, glucon 99.75
2h6r_A 219 Triosephosphate isomerase; beta-alpha barrel; 2.30 99.51
>4g1k_A Triosephosphate isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel, TPIA; 2.35A {Burkholderia thailandensis} Back     alignment and structure
Probab=99.91  E-value=4.3e-25  Score=183.81  Aligned_cols=95  Identities=18%  Similarity=0.175  Sum_probs=73.2

Q ss_pred             CCCCcchhHhhhhcCCceeEeeecccCCHHHHHHHHHHHhhcc-c-CCCccEEEechHH----HHHHhc-CCee-eeccc
Q 032180           39 RPRRGSSVVAMASSNKFFVGGNWKCNGTKESITKLVSDLNDAK-L-EADVGEMMLLLSS----LDAYLV-IRFH-CEHYV  110 (146)
Q Consensus        39 ~~~r~~~~~~m~~~rk~lViGNWKMNgt~aei~eLl~~L~~~~-~-~~~VdVvVaPP~t----v~~~l~-~~I~-GAQNV  110 (146)
                      .+..+  .-.|..||||||+||||||++.+++.+|++.+.... . ..++||+|||||+    +.+.++ +.|. |||||
T Consensus        14 ~~~~~--~~~~~~Mrk~~i~gNWKMn~t~~~~~~l~~~l~~~~~~~~~~veVvV~PP~~~L~~v~~~~~~~~i~vgAQN~   91 (272)
T 4g1k_A           14 AQTQG--PGSMSKQRIKRVIGNWKMHGRLSGNQALLTEVAQGAQAVHDNVAIGVCVPFPYLAQAQAQLQGGRVSWGSQDV   91 (272)
T ss_dssp             -------------CCCEEEEEECCBCCCHHHHHHHHHHHHHHHTTSCTTEEEEEECCGGGHHHHHHHHTTSSEEEEESCC
T ss_pred             hhhcc--CcHHHhCCCCEEEEEhhhCcCHHHHHHHHHHHHhccccccCCceEEEeCCHHHHHHHHHHhcCCCceEEeccc
Confidence            34445  556666899999999999999999999999997754 2 3479999999997    344444 5799 99999


Q ss_pred             CccC---CccccchhhhcCC--cEEEEEcc
Q 032180          111 WVYL---LVADVCSILEKDL--VWAILVVN  135 (146)
Q Consensus       111 ~~~~---~g~~~~~~~~~~~--~~~~~~~~  135 (146)
                      |+++   .||||||+||||+  .||||||-
T Consensus        92 ~~~~~GAfTGEISa~MLkd~G~~~VIiGHS  121 (272)
T 4g1k_A           92 SAHEQGAYTGEVAAGMVAEFGAAYAIVGHS  121 (272)
T ss_dssp             CSSSSBSCTTCCCHHHHHTTTCCEEEESCH
T ss_pred             CCCCCCCCcCcCCHHHHHHcCCCEEEECch
Confidence            9986   5999999999999  99999995
>3th6_A Triosephosphate isomerase; alpha/beta barrel, embryogenesis, glycolysis; 2.40A {Rhipicephalus microplus} Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>3kxq_A Triosephosphate isomerase; ssgcid, NIH, niaid, SBRI, UW, gluconeogenesis, glycolysis, pentose shunt; 1.60A {Bartonella henselae} Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>3ta6_A Triosephosphate isomerase; HET: FLC; 1.41A {Mycobacterium tuberculosis} SCOP: c.1.1.0 PDB: 3tao_A* 3gvg_A Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>2v5b_A Triosephosphate isomerase; TIM, unfolding, monotctim, glycosome, gluconeogenesis, lipid synthesis, monomeric mutant, glycolysis, pentose shunt; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1neya_ 247 c.1.1.1 (A:) Triosephosphate isomerase {Baker's ye 3e-09
d1r2ra_ 246 c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Or 6e-09
d1mo0a_ 257 c.1.1.1 (A:) Triosephosphate isomerase {Nematode ( 3e-08
d1o5xa_ 246 c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium 4e-08
d1b9ba_ 252 c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga 9e-08
d1trea_ 255 c.1.1.1 (A:) Triosephosphate isomerase {Escherichi 2e-07
d1kv5a_ 249 c.1.1.1 (A:) Triosephosphate isomerase {Trypanosom 5e-07
d1n55a_ 249 c.1.1.1 (A:) Triosephosphate isomerase {Leishmania 6e-07
d2btma_ 251 c.1.1.1 (A:) Triosephosphate isomerase {Bacillus s 6e-07
d1m6ja_ 260 c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba 6e-07
d1aw1a_ 255 c.1.1.1 (A:) Triosephosphate isomerase {Vibrio mar 1e-06
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 51.8 bits (123), Expect = 3e-09
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 52 SNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADV 86
          +  FFVGGN+K NG+K+SI ++V  LN A +  +V
Sbjct: 1  ARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENV 35
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 246 Back     information, alignment and structure
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 257 Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Length = 246 Back     information, alignment and structure
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Length = 252 Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Length = 249 Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Length = 249 Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Length = 251 Back     information, alignment and structure
>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} Length = 260 Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Length = 255 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1neya_ 247 Triosephosphate isomerase {Baker's yeast (Saccharo 99.9
d1mo0a_ 257 Triosephosphate isomerase {Nematode (Caenorhabditi 99.9
d1r2ra_ 246 Triosephosphate isomerase {Rabbit (Oryctolagus cun 99.9
d1b9ba_ 252 Triosephosphate isomerase {Thermotoga maritima [Ta 99.89
d1trea_ 255 Triosephosphate isomerase {Escherichia coli [TaxId 99.89
d1o5xa_ 246 Triosephosphate isomerase {Plasmodium falciparum [ 99.88
d1aw1a_ 255 Triosephosphate isomerase {Vibrio marinus [TaxId: 99.88
d2btma_ 251 Triosephosphate isomerase {Bacillus stearothermoph 99.87
d1kv5a_ 249 Triosephosphate isomerase {Trypanosoma brucei [Tax 99.86
d1n55a_ 249 Triosephosphate isomerase {Leishmania mexicana [Ta 99.86
d1m6ja_ 260 Triosephosphate isomerase {Entamoeba histolytica [ 99.85
d1hg3a_ 224 Triosephosphate isomerase {Archaeon Pyrococcus woe 99.8
d1w0ma_ 226 Triosephosphate isomerase {Thermoproteus tenax [Ta 99.73
>d1neya_ c.1.1.1 (A:) Triosephosphate isomerase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Triosephosphate isomerase (TIM)
family: Triosephosphate isomerase (TIM)
domain: Triosephosphate isomerase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.90  E-value=1.2e-24  Score=176.40  Aligned_cols=84  Identities=25%  Similarity=0.370  Sum_probs=73.0

Q ss_pred             cCCceeEeeecccCCHHHHHHHHHHHhhcccCCCccEEEechHH----HHHHhc-CCee-eecccCccC---Cccccchh
Q 032180           52 SNKFFVGGNWKCNGTKESITKLVSDLNDAKLEADVGEMMLLLSS----LDAYLV-IRFH-CEHYVWVYL---LVADVCSI  122 (146)
Q Consensus        52 ~rk~lViGNWKMNgt~aei~eLl~~L~~~~~~~~VdVvVaPP~t----v~~~l~-~~I~-GAQNV~~~~---~g~~~~~~  122 (146)
                      +||+||+||||||++.+++.+|++.++......+++|+||||++    +.+.++ +.|. ||||||+++   .|||||+.
T Consensus         1 sRk~~IagNWKMN~~~~~~~~~~~~l~~~~~~~~~~v~i~Pp~~~L~~~~~~~~~~~i~iGAQn~~~~~~GA~TGeiSa~   80 (247)
T d1neya_           1 ARTFFVGGNFKLNGSKQSIKEIVERLNTASIPENVEVVICPPATYLDYSVSLVKKPQVTVGAQNAYLKASGAFTGENSVD   80 (247)
T ss_dssp             CCCEEEEEECCBCCCHHHHHHHHHHHHHSCCCTTEEEEEECCGGGHHHHHHHCCCTTEEEEESCCCSSSSBSCTTCCCHH
T ss_pred             CCCcEEEEeccccCCHHHHHHHHHHHHccCCCCCceEEEECCHHHHHHHHHHHhhccccccccccccccccchhhhhhHH
Confidence            48999999999999999999999999765445679999999997    344454 4899 999999976   48999999


Q ss_pred             hhcCC--cEEEEEcc
Q 032180          123 LEKDL--VWAILVVN  135 (146)
Q Consensus       123 ~~~~~--~~~~~~~~  135 (146)
                      ||||+  .|||+||-
T Consensus        81 mLkd~G~~yviIGHS   95 (247)
T d1neya_          81 QIKDVGAKYVILGHS   95 (247)
T ss_dssp             HHHHTTCCEEEESCH
T ss_pred             HHHhhccchhhhcch
Confidence            99999  99999994
>d1mo0a_ c.1.1.1 (A:) Triosephosphate isomerase {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1r2ra_ c.1.1.1 (A:) Triosephosphate isomerase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1b9ba_ c.1.1.1 (A:) Triosephosphate isomerase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5xa_ c.1.1.1 (A:) Triosephosphate isomerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1aw1a_ c.1.1.1 (A:) Triosephosphate isomerase {Vibrio marinus [TaxId: 90736]} Back     information, alignment and structure
>d2btma_ c.1.1.1 (A:) Triosephosphate isomerase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kv5a_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1n55a_ c.1.1.1 (A:) Triosephosphate isomerase {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1m6ja_ c.1.1.1 (A:) Triosephosphate isomerase {Entamoeba histolytica [TaxId: 5759]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure