Citrus Sinensis ID: 033026

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MCGTSAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDKWAV
cccccccccccccccccccEEEEEEEEEccEEEEcHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHHccc
ccccccccccHHcEccccccEEEEEEEccccEEEcHHHHHHHHHHccccEEEEEEEccccEcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHH
mcgtsagdvtcmatiPLDMEVEAHFLAKEDGIIAGIALAEMIFhevdpslkvewslkdgdhvhkglqfgkvsgRAHSIVIAERVVLNFMQRMSGIATLTRAMADlahpatiletrktaptlrlldkwav
mcgtsagdvtcMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLqfgkvsgraHSIVIAERVVLNFMQRMSGIATLTRAMADLAHpatiletrktaptlrlldkwav
MCGTSAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDKWAV
*******DVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLL*****
**GTSAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDKWAV
********VTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDKWAV
******GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDKWAV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGTSAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDKWAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
P77938 296 Probable nicotinate-nucle yes no 0.961 0.418 0.428 1e-19
P30819 282 Nicotinate-nucleotide pyr yes no 0.953 0.436 0.380 7e-17
P39666 289 Probable nicotinate-nucle yes no 0.945 0.422 0.408 9e-17
P74301 295 Probable nicotinate-nucle N/A no 0.813 0.355 0.396 8e-16
O27860 279 Probable nicotinate-nucle yes no 0.930 0.430 0.388 1e-14
A7SG73 289 Nicotinate-nucleotide pyr N/A no 0.821 0.366 0.375 2e-14
P43619 295 Nicotinate-nucleotide pyr yes no 0.821 0.359 0.355 3e-14
P46714 284 Nicotinate-nucleotide pyr yes no 0.945 0.429 0.373 1e-13
O28439 258 Probable nicotinate-nucle yes no 0.906 0.453 0.354 8e-13
O06594 285 Nicotinate-nucleotide pyr yes no 0.945 0.428 0.357 2e-12
>sp|P77938|NADC_RHORU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rhodospirillum rubrum GN=nadC PE=3 SV=1 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 75/126 (59%), Gaps = 2/126 (1%)

Query: 6   AGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKG 65
           AGD+T  ATIP      A F+A++ GI+AG+  A   F  +D ++     L+DG  +  G
Sbjct: 30  AGDITSTATIPAATRAHARFVARQPGILAGLGCARSAFALLDDTVTFTTPLEDGAEIAAG 89

Query: 66  LQFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMAD-LAHP-ATILETRKTAPTLRL 123
               +V+G A +I+ AER  LNF+  +SGIAT TR   D +AH  A +  TRKT P LR 
Sbjct: 90  QTVAEVAGAARTILAAERTALNFLGHLSGIATRTRRFGDAIAHTRARLTCTRKTTPGLRG 149

Query: 124 LDKWAV 129
           L+K+AV
Sbjct: 150 LEKYAV 155
Involved in the catabolism of quinolinic acid (QA).
Rhodospirillum rubrum (taxid: 1085)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 1EC: 9
>sp|P30819|NADC_PSEAE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nadC PE=3 SV=2 Back     alignment and function description
>sp|P39666|NADC_BACSU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Bacillus subtilis (strain 168) GN=nadC PE=1 SV=2 Back     alignment and function description
>sp|P74301|NADC_SYNY3 Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nadC PE=3 SV=1 Back     alignment and function description
>sp|O27860|NADC_METTH Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=nadC PE=3 SV=1 Back     alignment and function description
>sp|A7SG73|NADC_NEMVE Nicotinate-nucleotide pyrophosphorylase [carboxylating] (Fragment) OS=Nematostella vectensis GN=qprt PE=3 SV=1 Back     alignment and function description
>sp|P43619|NADC_YEAST Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA6 PE=1 SV=1 Back     alignment and function description
>sp|P46714|NADC_MYCLE Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium leprae (strain TN) GN=nadC PE=3 SV=1 Back     alignment and function description
>sp|O28439|NADC_ARCFU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=nadC PE=3 SV=1 Back     alignment and function description
>sp|O06594|NADC_MYCTU Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium tuberculosis GN=nadC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
359472633 363 PREDICTED: probable nicotinate-nucleotid 0.953 0.338 0.878 8e-58
224101821 329 predicted protein [Populus trichocarpa] 0.953 0.373 0.861 1e-57
297737712 314 unnamed protein product [Vitis vinifera] 0.953 0.391 0.878 1e-57
111035808 350 putative quinolinate phosphirobosyltrans 0.953 0.351 0.869 2e-57
217072004 374 unknown [Medicago truncatula] 0.953 0.328 0.861 3e-57
356530754 377 PREDICTED: probable nicotinate-nucleotid 0.953 0.326 0.853 1e-56
388495338217 unknown [Medicago truncatula] 0.953 0.566 0.861 1e-56
255570096 353 Nicotinate-nucleotide pyrophosphorylase 0.953 0.348 0.853 2e-56
363807606 377 uncharacterized protein LOC100776131 [Gl 0.953 0.326 0.845 3e-56
187942098 350 putative quinolinate phosphoribosyltrans 0.953 0.351 0.861 4e-56
>gi|359472633|ref|XP_002284233.2| PREDICTED: probable nicotinate-nucleotide pyrophosphorylase [carboxylating] [Vitis vinifera] Back     alignment and taxonomy information
 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 108/123 (87%), Positives = 116/123 (94%)

Query: 7   GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGL 66
           GDVTCMATIP DMEVEAHFLAKEDGI+AGIALAEM+F+EVDPSLKVEWS KDGD+VHKGL
Sbjct: 78  GDVTCMATIPDDMEVEAHFLAKEDGIVAGIALAEMVFNEVDPSLKVEWSQKDGDYVHKGL 137

Query: 67  QFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDK 126
           +FGKV GRAH+IV AERVVLNFMQRMSGIATLT+AMAD AHPA ILETRKTAP LRL+DK
Sbjct: 138 KFGKVHGRAHNIVRAERVVLNFMQRMSGIATLTKAMADAAHPALILETRKTAPGLRLVDK 197

Query: 127 WAV 129
           WAV
Sbjct: 198 WAV 200

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class: N/A

Phylum: Streptophyta

Superkingdom:

>gi|224101821|ref|XP_002312433.1| predicted protein [Populus trichocarpa] gi|222852253|gb|EEE89800.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297737712|emb|CBI26913.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|111035808|emb|CAH04306.1| putative quinolinate phosphirobosyltransferase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|217072004|gb|ACJ84362.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356530754|ref|XP_003533945.1| PREDICTED: probable nicotinate-nucleotide pyrophosphorylase [carboxylating]-like [Glycine max] Back     alignment and taxonomy information
>gi|388495338|gb|AFK35735.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255570096|ref|XP_002526010.1| Nicotinate-nucleotide pyrophosphorylase [carboxylating], putative [Ricinus communis] gi|223534657|gb|EEF36350.1| Nicotinate-nucleotide pyrophosphorylase [carboxylating], putative [Ricinus communis] Back     alignment and taxonomy information
>gi|363807606|ref|NP_001242666.1| uncharacterized protein LOC100776131 [Glycine max] gi|255641879|gb|ACU21208.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|187942098|emb|CAP57999.1| putative quinolinate phosphoribosyltransferase1 [Nicotiana glauca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2038791 348 QPT "quinolinate phoshoribosyl 0.953 0.353 0.821 1.3e-50
TIGR_CMR|BA_4661 277 BA_4661 "nicotinate-nucleotide 0.937 0.436 0.456 1.2e-19
TIGR_CMR|GSU_1936 276 GSU_1936 "nicotinate-nucleotid 0.953 0.445 0.408 1.2e-19
TIGR_CMR|CBU_0098 274 CBU_0098 "nicotinate-nucleotid 0.953 0.448 0.380 1.7e-18
TIGR_CMR|CHY_2372 283 CHY_2372 "nicotinate-nucleotid 0.953 0.434 0.384 4.6e-18
TIGR_CMR|DET_1382 285 DET_1382 "nicotinate-nucleotid 0.953 0.431 0.352 8.6e-17
TIGR_CMR|SPO_3245 288 SPO_3245 "nicotinate-nucleotid 0.953 0.427 0.4 1.6e-15
TIGR_CMR|CPS_4813 298 CPS_4813 "nicotinate-nucleotid 0.937 0.406 0.371 2.8e-15
SGD|S000001943 295 BNA6 "Quinolinate phosphoribos 0.821 0.359 0.355 4.1e-14
UNIPROTKB|O06594 285 nadC "Nicotinate-nucleotide py 0.945 0.428 0.357 1e-13
TAIR|locus:2038791 QPT "quinolinate phoshoribosyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 526 (190.2 bits), Expect = 1.3e-50, P = 1.3e-50
 Identities = 101/123 (82%), Positives = 111/123 (90%)

Query:     7 GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGL 66
             GDVTCMATIP DMEVEA+FLAKEDGI+AG+ALA+MIF  VDPSLKVEW  KDGD+VHKGL
Sbjct:    63 GDVTCMATIPFDMEVEAYFLAKEDGIVAGVALADMIFEHVDPSLKVEWMRKDGDYVHKGL 122

Query:    67 QFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDK 126
             +FGKVSG AH IV+AERV+LNFMQRMSGIATLT+ MAD A PA ILETRKTAP LRL+DK
Sbjct:   123 KFGKVSGNAHKIVVAERVLLNFMQRMSGIATLTKLMADAASPACILETRKTAPGLRLVDK 182

Query:   127 WAV 129
             WAV
Sbjct:   183 WAV 185
GO:0003824 "catalytic activity" evidence=IEA
GO:0004514 "nicotinate-nucleotide diphosphorylase (carboxylating) activity" evidence=IEA;IGI;ISS;IMP
GO:0009435 "NAD biosynthetic process" evidence=IEA;IGI;IMP
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016763 "transferase activity, transferring pentosyl groups" evidence=IEA
GO:0019363 "pyridine nucleotide biosynthetic process" evidence=IEA
TIGR_CMR|BA_4661 BA_4661 "nicotinate-nucleotide pyrophosphorylase, carboxylating" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1936 GSU_1936 "nicotinate-nucleotide pyrophosphorylase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0098 CBU_0098 "nicotinate-nucleotide pyrophosphorylase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2372 CHY_2372 "nicotinate-nucleotide pyrophosphorylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1382 DET_1382 "nicotinate-nucleotide pyrophosphorylase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3245 SPO_3245 "nicotinate-nucleotide pyrophosphorylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4813 CPS_4813 "nicotinate-nucleotide pyrophosphorylase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
SGD|S000001943 BNA6 "Quinolinate phosphoribosyl transferase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|O06594 nadC "Nicotinate-nucleotide pyrophosphorylase [carboxylating]" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030474001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (329 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00019510001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (557 aa)
•    •• 0.982
GSVIVG00020737001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (289 aa)
•••   • 0.968
GSVIVG00020736001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (192 aa)
•••   • 0.952
GSVIVG00015962001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (742 aa)
     •• 0.925
GSVIVG00024946001
SubName- Full=Chromosome chr4 scaffold_32, whole genome shotgun sequence; (528 aa)
••    • 0.916
GSVIVG00033381001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (93 aa)
     •• 0.908
GSVIVG00034123001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (384 aa)
     •  0.899
GSVIVG00019982001
SubName- Full=Chromosome chr5 scaffold_2, whole genome shotgun sequence; (308 aa)
     •  0.899
GSVIVG00016858001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa)
     •  0.899
GSVIVG00016539001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (337 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
PLN02716 308 PLN02716, PLN02716, nicotinate-nucleotide diphosph 1e-74
cd01572 268 cd01572, QPRTase, Quinolinate phosphoribosyl trans 2e-54
cd01568 269 cd01568, QPRTase_NadC, Quinolinate phosphoribosyl 4e-47
COG0157 280 COG0157, NadC, Nicotinate-nucleotide pyrophosphory 2e-43
PRK08072 277 PRK08072, PRK08072, nicotinate-nucleotide pyrophos 3e-38
TIGR00078 265 TIGR00078, nadC, nicotinate-nucleotide pyrophospho 1e-37
PRK08385 278 PRK08385, PRK08385, nicotinate-nucleotide pyrophos 4e-32
PRK06543 281 PRK06543, PRK06543, nicotinate-nucleotide pyrophos 2e-31
pfam0274988 pfam02749, QRPTase_N, Quinolinate phosphoribosyl t 2e-30
PRK06106 281 PRK06106, PRK06106, nicotinate-nucleotide pyrophos 4e-28
PRK05742 277 PRK05742, PRK05742, nicotinate-nucleotide pyrophos 2e-27
PRK07896 289 PRK07896, PRK07896, nicotinate-nucleotide pyrophos 4e-26
PRK07428 288 PRK07428, PRK07428, nicotinate-nucleotide pyrophos 2e-25
cd00516 281 cd00516, PRTase_typeII, Phosphoribosyltransferase 3e-24
PRK05848 273 PRK05848, PRK05848, nicotinate-nucleotide pyrophos 2e-22
PRK06978 294 PRK06978, PRK06978, nicotinate-nucleotide pyrophos 2e-20
PRK06559 290 PRK06559, PRK06559, nicotinate-nucleotide pyrophos 8e-20
PRK09016 296 PRK09016, PRK09016, quinolinate phosphoribosyltran 4e-18
PRK06096 284 PRK06096, PRK06096, molybdenum transport protein M 2e-09
cd01573 272 cd01573, modD_like, ModD; Quinolinate phosphoribos 3e-08
pfam01729 169 pfam01729, QRPTase_C, Quinolinate phosphoribosyl t 2e-07
TIGR01334 277 TIGR01334, modD, putative molybdenum utilization p 3e-07
>gnl|CDD|178318 PLN02716, PLN02716, nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information 
 Score =  223 bits (570), Expect = 1e-74
 Identities = 98/123 (79%), Positives = 110/123 (89%)

Query: 7   GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGL 66
           GDVTC+ATIP DME EA FLAK DG++AGIALA+M+F EVDPSLKVEW+  DGD VHKGL
Sbjct: 35  GDVTCLATIPGDMEAEATFLAKADGVLAGIALADMVFEEVDPSLKVEWAAIDGDFVHKGL 94

Query: 67  QFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMADLAHPATILETRKTAPTLRLLDK 126
           +FGKV+G AHSI++AERVVLNFMQRMSGIATLT+AMAD A PA ILETRKTAP LRL+DK
Sbjct: 95  KFGKVTGPAHSILVAERVVLNFMQRMSGIATLTKAMADAAKPACILETRKTAPGLRLVDK 154

Query: 127 WAV 129
           WAV
Sbjct: 155 WAV 157

Length = 308
>gnl|CDD|238806 cd01572, QPRTase, Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>gnl|CDD|238802 cd01568, QPRTase_NadC, Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>gnl|CDD|223235 COG0157, NadC, Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181221 PRK08072, PRK08072, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|232814 TIGR00078, nadC, nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>gnl|CDD|236255 PRK08385, PRK08385, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|180612 PRK06543, PRK06543, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|217214 pfam02749, QRPTase_N, Quinolinate phosphoribosyl transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|180402 PRK06106, PRK06106, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|180230 PRK05742, PRK05742, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|236125 PRK07896, PRK07896, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|236017 PRK07428, PRK07428, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|238286 cd00516, PRTase_typeII, Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>gnl|CDD|180286 PRK05848, PRK05848, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|235900 PRK06978, PRK06978, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|235831 PRK06559, PRK06559, nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|181612 PRK09016, PRK09016, quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>gnl|CDD|180397 PRK06096, PRK06096, molybdenum transport protein ModD; Provisional Back     alignment and domain information
>gnl|CDD|238807 cd01573, modD_like, ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>gnl|CDD|216667 pfam01729, QRPTase_C, Quinolinate phosphoribosyl transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|130401 TIGR01334, modD, putative molybdenum utilization protein ModD Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
COG0157 280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 100.0
PRK06543 281 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
PRK06106 281 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
PRK06978 294 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
PLN02716 308 nicotinate-nucleotide diphosphorylase (carboxylati 100.0
PRK08072 277 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
PRK07428 288 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
PRK06096 284 molybdenum transport protein ModD; Provisional 100.0
PRK06559 290 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
cd01572 268 QPRTase Quinolinate phosphoribosyl transferase (QA 100.0
PRK05742 277 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
TIGR01334 277 modD putative molybdenum utilization protein ModD. 100.0
PRK07896 289 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
PRK08385 278 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
TIGR00078 265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 100.0
PRK09016 296 quinolinate phosphoribosyltransferase; Validated 100.0
cd01573 272 modD_like ModD; Quinolinate phosphoribosyl transfe 100.0
cd01568 269 QPRTase_NadC Quinolinate phosphoribosyl transferas 100.0
PRK05848 273 nicotinate-nucleotide pyrophosphorylase; Provision 100.0
KOG3008 300 consensus Quinolinate phosphoribosyl transferase [ 100.0
PRK08662 343 nicotinate phosphoribosyltransferase; Reviewed 100.0
cd01571 302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 100.0
PF0274988 QRPTase_N: Quinolinate phosphoribosyl transferase, 99.97
cd00516 281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 99.97
PRK07188 352 nicotinate phosphoribosyltransferase; Provisional 99.97
cd01570 327 NAPRTase_A Nicotinate phosphoribosyltransferase (N 99.33
PRK09243 464 nicotinate phosphoribosyltransferase; Validated 99.33
cd01567 343 NAPRTase_PncB Nicotinate phosphoribosyltransferase 99.15
TIGR01513 443 NAPRTase_put putative nicotinate phosphoribosyltra 98.93
PRK12484 443 nicotinate phosphoribosyltransferase; Provisional 98.88
COG1488 405 PncB Nicotinic acid phosphoribosyltransferase [Coe 98.84
PRK09198 463 putative nicotinate phosphoribosyltransferase; Pro 98.38
cd01569 407 PBEF_like pre-B-cell colony-enhancing factor (PBEF 98.18
PHA02594 470 nadV nicotinamide phosphoribosyl transferase; Prov 98.06
PLN02885 545 nicotinate phosphoribosyltransferase 97.9
cd01401 377 PncB_like Nicotinate phosphoribosyltransferase (NA 97.13
PRK05321 400 nicotinate phosphoribosyltransferase; Provisional 96.09
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 94.74
TIGR01514 394 NAPRTase nicotinate phosphoribosyltransferase. Thi 94.52
PF0783175 PYNP_C: Pyrimidine nucleoside phosphorylase C-term 93.37
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 92.66
TIGR02645493 ARCH_P_rylase putative thymidine phosphorylase. Me 92.36
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 92.16
PRK0674883 hypothetical protein; Validated 91.93
TIGR03327500 AMP_phos AMP phosphorylase. This enzyme family is 89.76
PRK04350490 thymidine phosphorylase; Provisional 89.52
PRK05820440 deoA thymidine phosphorylase; Reviewed 88.46
PRK06078434 pyrimidine-nucleoside phosphorylase; Reviewed 88.22
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 87.76
TIGR02644405 Y_phosphoryl pyrimidine-nucleoside phosphorylase. 87.51
COG0508 404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 87.16
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 86.55
TIGR02643437 T_phosphoryl thymidine phosphorylase. Thymidine ph 86.12
COG0213435 DeoA Thymidine phosphorylase [Nucleotide transport 85.36
KOG0557 470 consensus Dihydrolipoamide acetyltransferase [Ener 85.12
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 84.95
KOG2511 420 consensus Nicotinic acid phosphoribosyltransferase 83.05
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 82.63
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 82.07
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 81.57
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 81.57
PTZ00144 418 dihydrolipoamide succinyltransferase; Provisional 80.55
PF00529 305 HlyD: HlyD family secretion protein the correspond 80.41
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.1e-47  Score=307.55  Aligned_cols=125  Identities=45%  Similarity=0.739  Sum_probs=122.0

Q ss_pred             CCCCcccccccCCCCEEEEEEEeeCCeEEEcHHHHHHHHhhcCCCcEEEEecCCCCeeecCCEEEEEEechhhHHHHHHH
Q 033026            5 SAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERV   84 (129)
Q Consensus         5 ~~gDlTt~~~~~~~~~~~a~i~are~gvvaG~~~~~~~~~~~~~~~~v~~~~~dG~~v~~g~~i~~i~G~a~~ll~~ER~   84 (129)
                      |+||+||++++|++.++++.|++||+||+||++++.++|+.+||+++++|+++||++++||++|++++|+++.||++||+
T Consensus        19 g~gDiTt~al~~~~~~a~a~i~ake~GvvaG~~~a~~~f~~l~~~i~~~~~~~DG~~v~~g~~i~~~~G~a~~lL~~ER~   98 (280)
T COG0157          19 GRGDITTEALIPEDRKAEAVIIAKEAGVVAGLDVAEEVFELLGPSIEIQWLVKDGDRVKPGDVLAEIEGPARALLTAERT   98 (280)
T ss_pred             CCCCcccccccCCCCeEEEEEEEcCCcEEEcHHHHHHHHHHhCCceEEEEEcCCCCEeCCCCEEEEEeccHHHHHHHHHH
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHHHHHHHHHHHhC--CCeEeeccCCCCCchhhhhhcC
Q 033026           85 VLNFMQRMSGIATLTRAMADLAH--PATILETRKTAPTLRLLDKWAV  129 (129)
Q Consensus        85 ~LN~L~~~SGIAT~T~~~v~~a~--~~~i~~TRKt~PGlR~leKyAV  129 (129)
                      +||||||+|||||+|++||++++  +++|+|||||+||+|.||||||
T Consensus        99 aLN~L~~lSGIAT~T~~~V~~~~~~~~~i~~TRKT~PglR~leKyAV  145 (280)
T COG0157          99 ALNFLQHLSGIATATARMVEALRGTNVRIADTRKTTPGLRLLEKYAV  145 (280)
T ss_pred             HHHHHHHHhhHHHHHHHHHHHhhccCcEEEeccCCCccHHHHHHHHH
Confidence            99999999999999999999995  6899999999999999999997

>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>KOG3008 consensus Quinolinate phosphoribosyl transferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>PF02749 QRPTase_N: Quinolinate phosphoribosyl transferase, N-terminal domain; InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01570 NAPRTase_A Nicotinate phosphoribosyltransferase (NAPRTase), subgroup A Back     alignment and domain information
>PRK09243 nicotinate phosphoribosyltransferase; Validated Back     alignment and domain information
>cd01567 NAPRTase_PncB Nicotinate phosphoribosyltransferase (NAPRTase) family Back     alignment and domain information
>TIGR01513 NAPRTase_put putative nicotinate phosphoribosyltransferase Back     alignment and domain information
>PRK12484 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG1488 PncB Nicotinic acid phosphoribosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK09198 putative nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01569 PBEF_like pre-B-cell colony-enhancing factor (PBEF)-like Back     alignment and domain information
>PHA02594 nadV nicotinamide phosphoribosyl transferase; Provisional Back     alignment and domain information
>PLN02885 nicotinate phosphoribosyltransferase Back     alignment and domain information
>cd01401 PncB_like Nicotinate phosphoribosyltransferase (NAPRTase), related to PncB Back     alignment and domain information
>PRK05321 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>TIGR01514 NAPRTase nicotinate phosphoribosyltransferase Back     alignment and domain information
>PF07831 PYNP_C: Pyrimidine nucleoside phosphorylase C-terminal domain; InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ] Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>TIGR03327 AMP_phos AMP phosphorylase Back     alignment and domain information
>PRK04350 thymidine phosphorylase; Provisional Back     alignment and domain information
>PRK05820 deoA thymidine phosphorylase; Reviewed Back     alignment and domain information
>PRK06078 pyrimidine-nucleoside phosphorylase; Reviewed Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR02644 Y_phosphoryl pyrimidine-nucleoside phosphorylase Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>TIGR02643 T_phosphoryl thymidine phosphorylase Back     alignment and domain information
>COG0213 DeoA Thymidine phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0557 consensus Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>KOG2511 consensus Nicotinic acid phosphoribosyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PF00529 HlyD: HlyD family secretion protein the corresponding Prosite entry Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1x1o_A 286 Crystal Structure Of Project Id Tt0268 From Thermus 6e-23
3gnn_A 298 Crystal Structure Of Nicotinate-Nucleotide Pyrophos 2e-16
3tqv_A 287 Structure Of The Nicotinate-Nucleotide Pyrophosphor 2e-16
3c2r_A 295 Crystal Structure Of The Quinolinate Phosphoribosyl 2e-15
3c2e_A 294 Crystal Structure At 1.9a Of The Apo Quinolinate Ph 2e-15
3l0g_A 300 Crystal Structure Of Nicotinate-Nucleotide Pyrophos 2e-14
1qpr_A 284 Quinolinate Phosphoribosyltransferase (Qaprtase) Fr 1e-13
1qap_A 296 Quinolinic Acid Phosphoribosyltransferase With Boun 3e-13
3paj_A 320 2.00 Angstrom Resolution Crystal Structure Of A Qui 7e-13
1o4u_A 285 Crystal Structure Of A Nicotinate Nucleotide Pyroph 2e-10
2jbm_A 299 Qprtase Structure From Human Length = 299 9e-09
3lar_A 305 Crystal Structure Of Human Quinolinate Phosphoribos 9e-09
2b7n_A 273 Crystal Structure Of Quinolinic Acid Phosphoribosyl 2e-08
>pdb|1X1O|A Chain A, Crystal Structure Of Project Id Tt0268 From Thermus Thermophilus Hb8 Length = 286 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (254), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 77/125 (61%), Gaps = 2/125 (1%)
Query: 7   GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGL 66
           GD+T +  +P D+E EA  LAKE G++AG+ +AE +F   DP       + +G  V +G 
Sbjct: 29  GDLTSLLVVPEDLEGEAVILAKEGGVLAGLWVAERVFALADPRTAFTPLVAEGARVAEGT 88
Query: 67  QFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMAD--LAHPATILETRKTAPTLRLL 124
           +  +V G    I+  ER+ LN +QR+SGIATLTRA  +      A IL+TRKT P LR L
Sbjct: 89  EVARVRGPLRGILAGERLALNLLQRLSGIATLTRAYVEALAGTKAQILDTRKTTPGLRAL 148
Query: 125 DKWAV 129
           +K+AV
Sbjct: 149 EKYAV 153
>pdb|3GNN|A Chain A, Crystal Structure Of Nicotinate-Nucleotide Pyrophosphorylase From Burkholderi Pseudomallei Length = 298 Back     alignment and structure
>pdb|3TQV|A Chain A, Structure Of The Nicotinate-Nucleotide Pyrophosphorylase From Francisella Tularensis. Length = 287 Back     alignment and structure
>pdb|3C2R|A Chain A, Crystal Structure Of The Quinolinate Phosphoribosyl Transferase (Bna6) From Sachharomyces Cerevisiae Complexed With The Inhibitor Phthalate Length = 295 Back     alignment and structure
>pdb|3C2E|A Chain A, Crystal Structure At 1.9a Of The Apo Quinolinate Phosphoribosyl Transferase (Bna6) From Saccharomyces Cerevisiae Length = 294 Back     alignment and structure
>pdb|3L0G|A Chain A, Crystal Structure Of Nicotinate-Nucleotide Pyrophosphorylase From Ehrlichia Chaffeensis At 2.05a Resolution Length = 300 Back     alignment and structure
>pdb|1QPR|A Chain A, Quinolinate Phosphoribosyltransferase (Qaprtase) From Mycobacterium Tuberculosis In Complex With Phthalate And Prpcp Length = 284 Back     alignment and structure
>pdb|1QAP|A Chain A, Quinolinic Acid Phosphoribosyltransferase With Bound Quinolinic Acid Length = 296 Back     alignment and structure
>pdb|3PAJ|A Chain A, 2.00 Angstrom Resolution Crystal Structure Of A Quinolinate Phosphoribosyltransferase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 320 Back     alignment and structure
>pdb|1O4U|A Chain A, Crystal Structure Of A Nicotinate Nucleotide Pyrophosphorylase (Tm1645) From Thermotoga Maritima At 2.50 A Resolution Length = 285 Back     alignment and structure
>pdb|2JBM|A Chain A, Qprtase Structure From Human Length = 299 Back     alignment and structure
>pdb|3LAR|A Chain A, Crystal Structure Of Human Quinolinate Phosphoribosyltransferase Length = 305 Back     alignment and structure
>pdb|2B7N|A Chain A, Crystal Structure Of Quinolinic Acid Phosphoribosyltransferase From Helicobacter Pylori Length = 273 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1x1o_A 286 Nicotinate-nucleotide pyrophosphorylase; transfera 4e-54
3tqv_A 287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 1e-52
3gnn_A 298 Nicotinate-nucleotide pyrophosphorylase; decode bi 7e-52
1qpo_A 284 Quinolinate acid phosphoribosyl transferase; type 4e-51
3paj_A 320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 1e-50
3l0g_A 300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 3e-50
1qap_A 296 Quinolinic acid phosphoribosyltransferase; glycosy 4e-50
2b7n_A 273 Probable nicotinate-nucleotide pyrophosphorylase; 2e-48
2jbm_A 299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 2e-46
1o4u_A 285 Type II quinolic acid phosphoribosyltransferase; s 1e-45
3c2e_A 294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 2e-44
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Length = 286 Back     alignment and structure
 Score =  169 bits (432), Expect = 4e-54
 Identities = 57/125 (45%), Positives = 79/125 (63%), Gaps = 2/125 (1%)

Query: 7   GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGL 66
           GD+T +  +P D+E EA  LAKE G++AG+ +AE +F   DP       + +G  V +G 
Sbjct: 29  GDLTSLLVVPEDLEGEAVILAKEGGVLAGLWVAERVFALADPRTAFTPLVAEGARVAEGT 88

Query: 67  QFGKVSGRAHSIVIAERVVLNFMQRMSGIATLTRAMAD-LAH-PATILETRKTAPTLRLL 124
           +  +V G    I+  ER+ LN +QR+SGIATLTRA  + LA   A IL+TRKT P LR L
Sbjct: 89  EVARVRGPLRGILAGERLALNLLQRLSGIATLTRAYVEALAGTKAQILDTRKTTPGLRAL 148

Query: 125 DKWAV 129
           +K+AV
Sbjct: 149 EKYAV 153
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Length = 287 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Length = 298 Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Length = 284 Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Length = 320 Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Length = 300 Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Length = 296 Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Length = 273 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Length = 299 Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Length = 285 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Length = 294 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
1x1o_A 286 Nicotinate-nucleotide pyrophosphorylase; transfera 100.0
3l0g_A 300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 100.0
3tqv_A 287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 100.0
1o4u_A 285 Type II quinolic acid phosphoribosyltransferase; s 100.0
3gnn_A 298 Nicotinate-nucleotide pyrophosphorylase; decode bi 100.0
3paj_A 320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 100.0
1qpo_A 284 Quinolinate acid phosphoribosyl transferase; type 100.0
2b7n_A 273 Probable nicotinate-nucleotide pyrophosphorylase; 100.0
1qap_A 296 Quinolinic acid phosphoribosyltransferase; glycosy 100.0
2jbm_A 299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 100.0
3c2e_A 294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 100.0
2i1o_A 398 Nicotinate phosphoribosyltransferase; ZIN ION, zin 99.94
2i14_A 395 Nicotinate-nucleotide pyrophosphorylase; ligand bi 99.94
2f7f_A 494 Nicotinate phosphoribosyltransferase, putative; st 99.83
3os4_A 407 Naprtase, nicotinate phosphoribosyltransferase; st 98.39
4hl7_A 446 Naprtase, nicotinate phosphoribosyltransferase; st 98.07
1yir_A 408 Naprtase 2, nicotinate phosphoribosyltransferase 2 97.99
3dhf_A 484 Nicotinamide phosphoribosyltransferase; NMPRTASE, 97.84
1vlp_A 441 Naprtase, nicotinate phosphoribosyltransferase; st 97.67
2im5_A 394 Nicotinate phosphoribosyltransferase; structural g 97.54
1ybe_A 449 Naprtase, nicotinate phosphoribosyltransferase; st 97.31
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 91.11
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 90.77
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 90.44
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 90.38
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 89.74
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 89.46
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 88.85
2dsj_A423 Pyrimidine-nucleoside (thymidine) phosphorylase; p 88.8
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 88.48
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 88.2
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 87.67
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 87.67
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 87.17
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 87.17
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 87.1
1brw_A433 PYNP, protein (pyrimidine nucleoside phosphorylase 86.9
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 86.86
3h5q_A436 PYNP, pyrimidine-nucleoside phosphorylase; structu 86.44
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 86.22
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 85.74
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 85.35
1uou_A474 Thymidine phosphorylase; transferase, glycosyltran 84.37
2tpt_A440 Thymidine phosphorylase; transferase, salvage path 83.84
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 82.98
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=5.1e-45  Score=293.15  Aligned_cols=125  Identities=44%  Similarity=0.670  Sum_probs=121.3

Q ss_pred             CCCCcccccccCCCCEEEEEEEeeCCeEEEcHHHHHHHHhhcCCCcEEEEecCCCCeeecCCEEEEEEechhhHHHHHHH
Q 033026            5 SAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEVDPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIAERV   84 (129)
Q Consensus         5 ~~gDlTt~~~~~~~~~~~a~i~are~gvvaG~~~~~~~~~~~~~~~~v~~~~~dG~~v~~g~~i~~i~G~a~~ll~~ER~   84 (129)
                      |+||+||.++++++.+++++|++|++||+||++++.++|+.++|+++++|+++||+.++||++|++++|++++||++||+
T Consensus        27 ~~gD~Tt~~~~~~~~~~~a~~~ar~~gv~aG~~~~~~~f~~~~~~~~v~~~~~dG~~v~~g~~v~~i~G~~~~ll~~Er~  106 (286)
T 1x1o_A           27 GQGDLTSLLVVPEDLEGEAVILAKEGGVLAGLWVAERVFALADPRTAFTPLVAEGARVAEGTEVARVRGPLRGILAGERL  106 (286)
T ss_dssp             TTCCHHHHHHSCTTCEEEEEEEESSCEECCCHHHHHHHHHHHCTTCEEEESSCTTCEECTTCEEEEEEEEHHHHHHHHHH
T ss_pred             CCCCccchhhcCCCCeEEEEEEECCCEEEECHHHHHHHHHHcCCCEEEEEEcCCCCCccCCCEEEEEEEcHHHHHHHHHH
Confidence            57899999888889999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhHHHHHHHHHHHHhC--CCeEeeccCCCCCchhhhhhcC
Q 033026           85 VLNFMQRMSGIATLTRAMADLAH--PATILETRKTAPTLRLLDKWAV  129 (129)
Q Consensus        85 ~LN~L~~~SGIAT~T~~~v~~a~--~~~i~~TRKt~PGlR~leKyAV  129 (129)
                      +||||||+|||||+|++||+++.  +++++|||||+||+|.+|||||
T Consensus       107 aLn~l~~~SGIAT~t~~~v~~~~~~~~~i~~TRKt~Pglr~~~kyAv  153 (286)
T 1x1o_A          107 ALNLLQRLSGIATLTRAYVEALAGTKAQILDTRKTTPGLRALEKYAV  153 (286)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTTSSCEEECCSCCCTTCHHHHHHHH
T ss_pred             HHHHHHHHhHHHHHHHHHHHHhcCCCcEEEEcCCCChhhHHHHHHHH
Confidence            99999999999999999999995  6999999999999999999996
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI; 2.00A {Enterococcus faecalis} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3os4_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel; HET: MSE; 1.60A {Yersinia pestis} Back     alignment and structure
>4hl7_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative; 1.80A {Vibrio cholerae} Back     alignment and structure
>1yir_A Naprtase 2, nicotinate phosphoribosyltransferase 2; structural genomics, protein structure initiative, hypothetical protein, NYSGXRC, PSI; 2.10A {Pseudomonas aeruginosa} SCOP: c.1.17.2 d.41.2.2 Back     alignment and structure
>3dhf_A Nicotinamide phosphoribosyltransferase; NMPRTASE, NAMPRTASE, visfatin, beryllium fluoride, nicotinamide D-ribonucleotide, pyrophosphate; HET: NMN; 1.80A {Homo sapiens} PDB: 3dgr_A* 3dhd_A* 3dkj_A* 3dkl_A* 2gvj_A* 2gvg_A* 2e5b_A 2e5c_A* 2e5d_A 2h3d_A* 2gvl_A 2h3b_A 2g95_A 2g96_A* 2g97_A* 3g8e_A* Back     alignment and structure
>1vlp_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, joint center for structural genomics; HET: MSE MES; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.17.2 d.41.2.2 Back     alignment and structure
>2im5_A Nicotinate phosphoribosyltransferase; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.20A {Porphyromonas gingivalis} Back     alignment and structure
>1ybe_A Naprtase, nicotinate phosphoribosyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.50A {Agrobacterium tumefaciens} SCOP: c.1.17.2 d.41.2.2 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2dsj_A Pyrimidine-nucleoside (thymidine) phosphorylase; pyrimidine-nucleoside phosphorylase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1brw_A PYNP, protein (pyrimidine nucleoside phosphorylase); domain movement, transferase; HET: MES; 2.10A {Geobacillus stearothermophilus} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>3h5q_A PYNP, pyrimidine-nucleoside phosphorylase; structural genomics, glycosyltransferase, transferase; HET: MSE THM; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>1uou_A Thymidine phosphorylase; transferase, glycosyltransferase, chemotaxis, angiogenesis; HET: CMU; 2.11A {Homo sapiens} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 2wk6_A 2wk5_A 2j0f_A Back     alignment and structure
>2tpt_A Thymidine phosphorylase; transferase, salvage pathway; 2.60A {Escherichia coli} SCOP: a.46.2.1 c.27.1.1 d.41.3.1 PDB: 1azy_A 1tpt_A 1otp_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1qapa2122 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosylt 5e-26
d1qpoa2115 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosylt 4e-24
d1o4ua2103 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosylt 1e-17
d1o4ua1 170 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosy 1e-07
d1qapa1 167 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosy 1e-06
d1qpoa1 169 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosy 3e-06
d2i14a1 279 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyropho 3e-04
>d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: alpha/beta-Hammerhead
superfamily: Nicotinate/Quinolinate PRTase N-terminal domain-like
family: NadC N-terminal domain-like
domain: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain
species: Salmonella typhimurium [TaxId: 90371]

 Score = 92.3 bits (229), Expect = 5e-26
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 3   GTSAGDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEV-DPSLKVEWSLKDGDH 61
              AG+      +P D +  A  + +EDG+  G    E +F ++    +++ W + DGD 
Sbjct: 30  EVDAGNDITAQLLPADTQAHATVITREDGVFCGKRWVEEVFIQLAGDDVRLTWHVDDGDA 89

Query: 62  VHKGLQFGKVSGRAHSIVIAERVVLNFMQRMSG 94
           +H      ++ G A  ++  ER  LNF+Q +SG
Sbjct: 90  IHANQTVFELQGPARVLLTGERTALNFVQTLSG 122
>d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure
>d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 103 Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 170 Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 167 Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 169 Back     information, alignment and structure
>d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Length = 279 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1qpoa2115 Quinolinic acid phosphoribosyltransferase (Nicotin 99.97
d1qapa2122 Quinolinic acid phosphoribosyltransferase (Nicotin 99.96
d1o4ua2103 Quinolinic acid phosphoribosyltransferase (Nicotin 99.94
d1ytda2119 Nicotinate phosphoribosyltransferase Ta1145 {Therm 99.21
d2i14a2110 Nicotinate-nucleotide pyrophosphorylase PF1904 {Py 99.17
d2f7fa2137 Putative nicotinate phosphoribosyltransferase EF26 98.04
d1uoua3105 Thymidine phosphorylase {Human (Homo sapiens) [Tax 95.52
d1brwa3103 Pyrimidine nucleoside phosphorylase {Bacillus stea 95.31
d2tpta3105 Thymidine phosphorylase {Escherichia coli [TaxId: 93.96
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 93.02
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 92.56
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 92.48
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 92.29
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 92.06
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 92.04
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 91.54
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 91.06
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 88.49
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 87.82
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 83.56
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 83.54
d1vf7a_ 237 Multidrug resistance protein MexA domain {Pseudomo 81.21
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 80.02
>d1qpoa2 d.41.2.1 (A:2-116) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: alpha/beta-Hammerhead
superfamily: Nicotinate/Quinolinate PRTase N-terminal domain-like
family: NadC N-terminal domain-like
domain: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.97  E-value=5.5e-32  Score=190.07  Aligned_cols=90  Identities=29%  Similarity=0.497  Sum_probs=85.8

Q ss_pred             CC-CCcccccccCCCCEEEEEEEeeCCeEEEcHHHHHHHHhhc--CCCcEEEEecCCCCeeecCCEEEEEEechhhHHHH
Q 033026            5 SA-GDVTCMATIPLDMEVEAHFLAKEDGIIAGIALAEMIFHEV--DPSLKVEWSLKDGDHVHKGLQFGKVSGRAHSIVIA   81 (129)
Q Consensus         5 ~~-gDlTt~~~~~~~~~~~a~i~are~gvvaG~~~~~~~~~~~--~~~~~v~~~~~dG~~v~~g~~i~~i~G~a~~ll~~   81 (129)
                      |+ +|+||++++|++..++|.+++|++||+||++++.++|+.+  ++++++.|+++||+.|+||++|++++|++++||++
T Consensus        23 g~g~DiTt~~li~~~~~~~A~i~ake~gVlaG~~~~~~if~~l~~~~~i~~~~~~~DG~~v~~G~~I~~i~G~a~~iL~~  102 (115)
T d1qpoa2          23 RYGPDVTTLATVPASATTTASLVTREAGVVAGLDVALLTLNEVLGTNGYRVLDRVEDGARVPPGEALMTLEAQTRGLLTA  102 (115)
T ss_dssp             TTCCCHHHHHHSCTTCEEEEEEEESSCEECCCHHHHHHHHHHHHCTTSEEEEEECCTTCEECTTCEEEEEEEEHHHHHHH
T ss_pred             CCCCCcCchhhcCCCCeEEEEEEECCCCceehHHHHHHHHHHhccccccceeeecCCCCEEecceeEEEEechHHHHHHH
Confidence            34 4999999999999999999999999999999999999987  56799999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhH
Q 033026           82 ERVVLNFMQRMSG   94 (129)
Q Consensus        82 ER~~LN~L~~~SG   94 (129)
                      ||++|||||||||
T Consensus       103 ER~~LN~lq~lSG  115 (115)
T d1qpoa2         103 ERTMLNLVGHLSG  115 (115)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhccC
Confidence            9999999999998
>d1qapa2 d.41.2.1 (A:8-129) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1o4ua2 d.41.2.1 (A:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ytda2 d.41.2.1 (A:1-119) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i14a2 d.41.2.1 (A:1-110) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2f7fa2 d.41.2.1 (A:4-140) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1uoua3 d.41.3.1 (A:374-480) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brwa3 d.41.3.1 (A:331-433) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2tpta3 d.41.3.1 (A:336-440) Thymidine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure