Citrus Sinensis ID: 034072

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQCFLP
cccEEEEcccccEEEEEEccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccEEHHHcccccEEEEEcHHHcccHHHHHHHHHHHcEEcEEccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccc
mgyelvsggteNHLVLVNLKNKGIDGSRVEKVLEAVHIAAnkntvpgdvsamvpggirmgtpaltsrgfveedFAKVAYFFDAAVKLTVKIKsetqgsyqcflp
mgyelvsggtenHLVLVNLKNKGIDGSRVEKVLEAVHiaankntvpgdvsamVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKsetqgsyqcflp
MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQCFLP
*********TENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSET***YQC***
MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQCFLP
********GTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQCFLP
MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQ*FLP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQCFLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
P49358517 Serine hydroxymethyltrans N/A no 0.932 0.187 0.938 5e-47
P49357517 Serine hydroxymethyltrans N/A no 0.932 0.187 0.927 9e-47
P50433518 Serine hydroxymethyltrans N/A no 0.932 0.187 0.896 7e-46
P34899518 Serine hydroxymethyltrans N/A no 0.932 0.187 0.865 4e-44
Q9SZJ5517 Serine hydroxymethyltrans no no 0.932 0.187 0.865 7e-44
Q7S5N8527 Putative serine hydroxyme N/A no 0.875 0.172 0.681 5e-32
Q3SZ20504 Serine hydroxymethyltrans yes no 0.903 0.186 0.638 6e-31
Q5RFK5483 Serine hydroxymethyltrans yes no 0.913 0.196 0.6 2e-30
P34896483 Serine hydroxymethyltrans no no 0.913 0.196 0.6 2e-30
P07511484 Serine hydroxymethyltrans yes no 0.913 0.196 0.6 3e-30
>sp|P49358|GLYN_FLAPR Serine hydroxymethyltransferase 2, mitochondrial OS=Flaveria pringlei PE=2 SV=1 Back     alignment and function desciption
 Score =  185 bits (470), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 91/97 (93%), Positives = 92/97 (94%)

Query: 2   GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT 61
           GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT
Sbjct: 375 GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT 434

Query: 62  PALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGS 98
           PALTSRGFVEEDFAKVAY FD AVKL VKIK E QG+
Sbjct: 435 PALTSRGFVEEDFAKVAYLFDLAVKLAVKIKGEAQGT 471
Interconversion of serine and glycine.
Flaveria pringlei (taxid: 4226)
EC: 2EC: .EC: 1EC: .EC: 2EC: .EC: 1
>sp|P49357|GLYM_FLAPR Serine hydroxymethyltransferase 1, mitochondrial OS=Flaveria pringlei PE=2 SV=1 Back     alignment and function description
>sp|P50433|GLYM_SOLTU Serine hydroxymethyltransferase, mitochondrial OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P34899|GLYM_PEA Serine hydroxymethyltransferase, mitochondrial OS=Pisum sativum PE=1 SV=1 Back     alignment and function description
>sp|Q9SZJ5|GLYM_ARATH Serine hydroxymethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=SHM1 PE=1 SV=1 Back     alignment and function description
>sp|Q7S5N8|GLYM_NEUCR Putative serine hydroxymethyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU05805 PE=3 SV=1 Back     alignment and function description
>sp|Q3SZ20|GLYM_BOVIN Serine hydroxymethyltransferase, mitochondrial OS=Bos taurus GN=SHMT2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RFK5|GLYC_PONAB Serine hydroxymethyltransferase, cytosolic OS=Pongo abelii GN=SHMT1 PE=2 SV=1 Back     alignment and function description
>sp|P34896|GLYC_HUMAN Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens GN=SHMT1 PE=1 SV=1 Back     alignment and function description
>sp|P07511|GLYC_RABIT Serine hydroxymethyltransferase, cytosolic OS=Oryctolagus cuniculus GN=SHMT1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
118488863 520 unknown [Populus trichocarpa x Populus d 0.932 0.186 0.938 1e-45
255572585 515 serine hydroxymethyltransferase, putativ 0.932 0.188 0.938 1e-45
1346156 517 RecName: Full=Serine hydroxymethyltransf 0.932 0.187 0.938 2e-45
134142077 520 mitochondrial serine hydroxymethyltransf 0.932 0.186 0.927 4e-45
1346155 517 RecName: Full=Serine hydroxymethyltransf 0.932 0.187 0.927 4e-45
224109940 520 precursor of transferase serine hydroxym 0.932 0.186 0.927 4e-45
134142067 520 mitochondrial serine hydroxymethyltransf 0.932 0.186 0.917 8e-45
224097398 518 precursor of transferase serine hydroxym 0.932 0.187 0.917 8e-45
255572828 513 serine hydroxymethyltransferase, putativ 0.932 0.189 0.907 1e-44
351722703 518 serine hydroxymethyltransferase 5 [Glyci 0.932 0.187 0.917 2e-44
>gi|118488863|gb|ABK96241.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
 Score =  186 bits (472), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/97 (93%), Positives = 95/97 (97%)

Query: 2   GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT 61
           GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLE+VHIAANKNTVPGDVSAMVPGGIRMGT
Sbjct: 378 GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLESVHIAANKNTVPGDVSAMVPGGIRMGT 437

Query: 62  PALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGS 98
           PALTSRGFVEEDFAKVA FFDAAVKL VKIK+ET+G+
Sbjct: 438 PALTSRGFVEEDFAKVADFFDAAVKLAVKIKAETKGT 474

Source: Populus trichocarpa x Populus deltoides

Species: Populus trichocarpa x Populus deltoides

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255572585|ref|XP_002527226.1| serine hydroxymethyltransferase, putative [Ricinus communis] gi|223533402|gb|EEF35152.1| serine hydroxymethyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|1346156|sp|P49358.1|GLYN_FLAPR RecName: Full=Serine hydroxymethyltransferase 2, mitochondrial; Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; AltName: Full=Serine methylase; Flags: Precursor gi|437997|emb|CAA81079.1| glycine hydroxymethyltransferase [Flaveria pringlei] Back     alignment and taxonomy information
>gi|134142077|gb|ABO61382.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides] Back     alignment and taxonomy information
>gi|1346155|sp|P49357.1|GLYM_FLAPR RecName: Full=Serine hydroxymethyltransferase 1, mitochondrial; Short=SHMT; AltName: Full=Glycine hydroxymethyltransferase; AltName: Full=Serine methylase; Flags: Precursor gi|437995|emb|CAA81078.1| glycine hydroxymethyltransferase [Flaveria pringlei] Back     alignment and taxonomy information
>gi|224109940|ref|XP_002315363.1| precursor of transferase serine hydroxymethyltransferase 7 [Populus trichocarpa] gi|222864403|gb|EEF01534.1| precursor of transferase serine hydroxymethyltransferase 7 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|134142067|gb|ABO61377.1| mitochondrial serine hydroxymethyltransferase [Populus tremuloides] Back     alignment and taxonomy information
>gi|224097398|ref|XP_002310916.1| precursor of transferase serine hydroxymethyltransferase 2 [Populus trichocarpa] gi|222850736|gb|EEE88283.1| precursor of transferase serine hydroxymethyltransferase 2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255572828|ref|XP_002527346.1| serine hydroxymethyltransferase, putative [Ricinus communis] gi|223533265|gb|EEF35018.1| serine hydroxymethyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351722703|ref|NP_001237509.1| serine hydroxymethyltransferase 5 [Glycine max] gi|222142537|gb|ACM45955.1| serine hydroxymethyltransferase 5 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
TAIR|locus:2148463533 SHM2 "serine hydroxymethyltran 0.932 0.181 0.865 3.6e-41
TAIR|locus:2005518517 SHM1 "serine transhydroxymethy 0.932 0.187 0.865 2e-40
UNIPROTKB|Q3SZ20504 SHMT2 "Serine hydroxymethyltra 0.903 0.186 0.638 1.5e-28
UNIPROTKB|G4MRB4516 MGG_13781 "Serine hydroxymethy 0.875 0.176 0.659 1.7e-28
UNIPROTKB|F1SL74504 LOC100626911 "Serine hydroxyme 0.903 0.186 0.648 2.5e-28
UNIPROTKB|B4DPM9345 SHMT1 "Serine hydroxymethyltra 0.913 0.275 0.6 3.1e-28
UNIPROTKB|P34896483 SHMT1 "Serine hydroxymethyltra 0.913 0.196 0.6 5.2e-28
ASPGD|ASPL0000008876600 AN10745 [Emericella nidulans ( 0.942 0.163 0.602 9.6e-28
MGI|MGI:98299478 Shmt1 "serine hydroxymethyltra 0.894 0.194 0.602 1.8e-27
UNIPROTKB|B4DLV4408 SHMT2 "Serine hydroxymethyltra 0.903 0.230 0.617 2.8e-27
TAIR|locus:2148463 SHM2 "serine hydroxymethyltransferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 437 (158.9 bits), Expect = 3.6e-41, P = 3.6e-41
 Identities = 84/97 (86%), Positives = 93/97 (95%)

Query:     2 GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT 61
             GY+LVSGGT+NHLVLVNLKNKGIDGSRVEKVLE VHIAANKNTVPGDVSAMVPGGIRMGT
Sbjct:   390 GYDLVSGGTDNHLVLVNLKNKGIDGSRVEKVLELVHIAANKNTVPGDVSAMVPGGIRMGT 449

Query:    62 PALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGS 98
             PALTSRGF+EEDFAKVA +FD AVK+ +KIK+E+QG+
Sbjct:   450 PALTSRGFIEEDFAKVAEYFDLAVKIALKIKAESQGT 486
GO:0003824 "catalytic activity" evidence=IEA
GO:0004372 "glycine hydroxymethyltransferase activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0006544 "glycine metabolic process" evidence=IEA;ISS
GO:0006563 "L-serine metabolic process" evidence=IEA;ISS
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0005747 "mitochondrial respiratory chain complex I" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
TAIR|locus:2005518 SHM1 "serine transhydroxymethyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ20 SHMT2 "Serine hydroxymethyltransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G4MRB4 MGG_13781 "Serine hydroxymethyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1SL74 LOC100626911 "Serine hydroxymethyltransferase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4DPM9 SHMT1 "Serine hydroxymethyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P34896 SHMT1 "Serine hydroxymethyltransferase, cytosolic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008876 AN10745 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
MGI|MGI:98299 Shmt1 "serine hydroxymethyltransferase 1 (soluble)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B4DLV4 SHMT2 "Serine hydroxymethyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P49357GLYM_FLAPR2, ., 1, ., 2, ., 10.92780.93260.1876N/Ano
P49358GLYN_FLAPR2, ., 1, ., 2, ., 10.93810.93260.1876N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.2LOW CONFIDENCE prediction!
4th Layer2.1.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
PLN03226475 PLN03226, PLN03226, serine hydroxymethyltransferas 2e-60
PTZ00094452 PTZ00094, PTZ00094, serine hydroxymethyltransferas 2e-46
pfam00464380 pfam00464, SHMT, Serine hydroxymethyltransferase 2e-41
cd00378402 cd00378, SHMT, Serine-glycine hydroxymethyltransfe 1e-38
PRK00011416 PRK00011, glyA, serine hydroxymethyltransferase; R 4e-37
COG0112413 COG0112, GlyA, Glycine/serine hydroxymethyltransfe 1e-34
PRK13034416 PRK13034, PRK13034, serine hydroxymethyltransferas 1e-28
PLN02271586 PLN02271, PLN02271, serine hydroxymethyltransferas 9e-25
PRK13580493 PRK13580, PRK13580, serine hydroxymethyltransferas 1e-19
>gnl|CDD|215639 PLN03226, PLN03226, serine hydroxymethyltransferase; Provisional Back     alignment and domain information 
 Score =  190 bits (486), Expect = 2e-60
 Identities = 60/102 (58%), Positives = 76/102 (74%)

Query: 1   MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMG 60
            GY+LV+GGT+NHLVL +L+  G+ GSRVEKVL+  HI  NKN VPGD SA+VPGG+R+G
Sbjct: 333 KGYKLVTGGTDNHLVLWDLRPLGLTGSRVEKVLDLAHITLNKNAVPGDSSALVPGGVRIG 392

Query: 61  TPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSETQGSYQCF 102
           TPA+TSRG VE+DF KVA F   AV + +KI+ E     + F
Sbjct: 393 TPAMTSRGLVEKDFEKVAEFLHRAVTIALKIQKEHGKKLKDF 434

Length = 475
>gnl|CDD|240264 PTZ00094, PTZ00094, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|189558 pfam00464, SHMT, Serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|99733 cd00378, SHMT, Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>gnl|CDD|234571 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223190 COG0112, GlyA, Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237280 PRK13034, PRK13034, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215153 PLN02271, PLN02271, serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|184161 PRK13580, PRK13580, serine hydroxymethyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 100.0
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 100.0
PLN02271586 serine hydroxymethyltransferase 100.0
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.96
PLN03226475 serine hydroxymethyltransferase; Provisional 99.91
PRK13580493 serine hydroxymethyltransferase; Provisional 99.83
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.66
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.56
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.06
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 98.95
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 98.15
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 98.04
PRK06225380 aspartate aminotransferase; Provisional 93.12
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 92.92
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 91.82
PRK00950361 histidinol-phosphate aminotransferase; Validated 91.27
PRK02731367 histidinol-phosphate aminotransferase; Validated 91.08
PRK13520371 L-tyrosine decarboxylase; Provisional 90.24
PLN02721353 threonine aldolase 89.79
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 89.27
PRK09440416 avtA valine--pyruvate transaminase; Provisional 88.81
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 88.35
PRK05387353 histidinol-phosphate aminotransferase; Provisional 88.09
PRK07179407 hypothetical protein; Provisional 86.58
PRK04366481 glycine dehydrogenase subunit 2; Validated 85.65
PLN03227392 serine palmitoyltransferase-like protein; Provisio 84.92
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 84.55
PRK08153369 histidinol-phosphate aminotransferase; Provisional 84.45
PRK07908349 hypothetical protein; Provisional 84.31
PRK10534333 L-threonine aldolase; Provisional 83.08
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 83.07
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 83.03
PRK09064407 5-aminolevulinate synthase; Validated 82.58
PRK10874401 cysteine sulfinate desulfinase; Provisional 81.96
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 81.86
PRK13392410 5-aminolevulinate synthase; Provisional 81.58
PRK02610374 histidinol-phosphate aminotransferase; Provisional 81.46
KOG1486 364 consensus GTP-binding protein DRG2 (ODN superfamil 81.4
PRK06108382 aspartate aminotransferase; Provisional 81.37
PRK03321352 putative aminotransferase; Provisional 80.66
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 80.24
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 80.19
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 80.19
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=8e-35  Score=235.49  Aligned_cols=97  Identities=69%  Similarity=1.088  Sum_probs=94.7

Q ss_pred             CCCeeeeCCCCCceeeEeccCCCCCHHHHHHHHhhcCceeccCCCCCCCCCCCCCeeeEcchhHhhcCCCHHHHHHHHHH
Q 034072            1 MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYF   80 (104)
Q Consensus         1 ~G~~vv~ggTd~Hlvlvdl~~~gi~g~~a~~~Le~~gI~vnkn~lP~d~~~~~~sglRlGT~a~T~RG~~e~dm~~Ia~~   80 (104)
                      +||++++||||||||||||++.|++|..+|++||.++|.+|||++|+|++++.|+|||||||+||+|||.|+||++|+++
T Consensus       340 ~Gy~lvtgGTDnHlvLvDLr~~G~dGarvE~vle~~~I~~NKNtvpGD~Sal~PgGiRiGtPAmTsRG~~e~df~~v~~f  419 (477)
T KOG2467|consen  340 RGYKLVTGGTDNHLVLVDLRPKGVDGARVEKVLELCHIALNKNTVPGDKSALSPGGIRIGTPAMTSRGFGEEDFEKVADF  419 (477)
T ss_pred             cCceEecCCccceEEEEeccccCCchHHHHHHHHHhhhhhcCCcCCCCccccCCCceeccchhhcccCccHHHHHHHHHH
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhccC
Q 034072           81 FDAAVKLTVKIKSETQG   97 (104)
Q Consensus        81 i~~~l~~~~~~~~~~~~   97 (104)
                      |.++++++.++|.+.++
T Consensus       420 i~~av~i~~~~~~~~~~  436 (477)
T KOG2467|consen  420 IDRAVKIALEIQKEAGG  436 (477)
T ss_pred             HHHHHHHHHHHHhhccc
Confidence            99999999999988854

>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
1bj4_A470 Recombinant Serine Hydroxymethyltransferase (human) 1e-31
1rv3_A483 E75l Mutant Of Rabbit Cytosolic Serine Hydroxymethy 2e-31
1cj0_A470 Crystal Structure Of Rabbit Cytosolic Serine Hydrox 2e-31
1ls3_B483 Crystal Structure Of The Complex Between Rabbit Cyt 2e-31
1rvu_A483 E75q Mutant Of Rabbit Cytosolic Serine Hydroxymethy 2e-31
3ou5_A490 Human Mitochondrial Serine Hydroxymethyltransferase 3e-30
1eji_A478 Recombinant Serine Hydroxymethyltransferase (Mouse) 3e-30
2dkj_A407 Crystal Structure Of T.Th.Hb8 Serine Hydroxymethylt 3e-17
3pgy_A415 Serine Hydroxymethyltransferase From Staphylococcus 1e-15
1yjs_A419 K226q Mutant Of Serine Hydroxymethyltransferase Fro 3e-15
1yjy_A419 K226m Mutant Of Serine Hydroxymethyltransferase Fro 3e-15
1kkj_A419 Crystal Structure Of Serine Hydroxymethyltransferas 3e-15
2vi8_A405 Crystal Structure Of S172absshmt Internal Aldimine 3e-15
2w7i_A405 Crystal Structure Of Y61absshmt Internal Aldimine L 3e-15
2w7d_A405 Crystal Structure Of Y51fbsshmt Internal Aldimine L 3e-15
2vmr_A405 Crystal Structure Of Y60absshmt Internal Aldimine L 3e-15
2vgs_A407 Crystal Structure Of E53qbsshmt Internal Aldimine L 3e-15
3ecd_A425 Crystal Structure Of Serine Hydroxymethyltransferas 5e-15
2vmv_A405 Crystal Structure Of F351gbsshmt Internal Aldimine 7e-15
3h7f_A447 Crystal Structure Of Serine Hydroxymethyltransferas 1e-14
1eqb_A417 X-Ray Crystal Structure At 2.7 Angstroms Resolution 2e-14
3g8m_A417 Serine Hydroxymethyltransferase Y55f Mutant Length 2e-14
2vmn_A405 Crystal Structure Of N341absshmt Internal Aldimine 2e-14
1dfo_A417 Crystal Structure At 2.4 Angstrom Resolution Of E. 2e-14
3gbx_A420 Serine Hydroxymethyltransferase From Salmonella Typ 4e-14
3n0l_A417 Crystal Structure Of Serine Hydroxymethyltransferas 5e-13
>pdb|1BJ4|A Chain A, Recombinant Serine Hydroxymethyltransferase (human) Length = 470 Back     alignment and structure 
Iteration: 1

 Score =  131 bits (329), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 79/95 (83%)
Query: 1   MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMG 60
           +GY++V+GG++NHL+LV+L++KG DG R EKVLEA  IA NKNT PGD SA+ P G+R+G
Sbjct: 335 LGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLG 394
Query: 61  TPALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSET 95
           TPALTSRG +E+DF KVA+F    ++LT++I+S+T
Sbjct: 395 TPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDT 429
>pdb|1RV3|A Chain A, E75l Mutant Of Rabbit Cytosolic Serine Hydroxymethyltransferase, Complex With Glycine Length = 483 Back     alignment and structure
>pdb|1CJ0|A Chain A, Crystal Structure Of Rabbit Cytosolic Serine Hydroxymethyltransferase At 2.8 Angstrom Resolution Length = 470 Back     alignment and structure
>pdb|1LS3|B Chain B, Crystal Structure Of The Complex Between Rabbit Cytosolic Serine Hydroxymethyltransferase And Triglu-5-Formyl-Tetrahydrofolate Length = 483 Back     alignment and structure
>pdb|1RVU|A Chain A, E75q Mutant Of Rabbit Cytosolic Serine Hydroxymethyltransferase Length = 483 Back     alignment and structure
>pdb|3OU5|A Chain A, Human Mitochondrial Serine Hydroxymethyltransferase 2 Length = 490 Back     alignment and structure
>pdb|1EJI|A Chain A, Recombinant Serine Hydroxymethyltransferase (Mouse) Length = 478 Back     alignment and structure
>pdb|2DKJ|A Chain A, Crystal Structure Of T.Th.Hb8 Serine Hydroxymethyltransferase Length = 407 Back     alignment and structure
>pdb|3PGY|A Chain A, Serine Hydroxymethyltransferase From Staphylococcus Aureus, S95p Mutant. Length = 415 Back     alignment and structure
>pdb|1YJS|A Chain A, K226q Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Glycine Length = 419 Back     alignment and structure
>pdb|1YJY|A Chain A, K226m Mutant Of Serine Hydroxymethyltransferase From B. Stearothermophilus, Complex With Serine Length = 419 Back     alignment and structure
>pdb|1KKJ|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From B.Stearothermophilus Length = 419 Back     alignment and structure
>pdb|2VI8|A Chain A, Crystal Structure Of S172absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2W7I|A Chain A, Crystal Structure Of Y61absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2W7D|A Chain A, Crystal Structure Of Y51fbsshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2VMR|A Chain A, Crystal Structure Of Y60absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|2VGS|A Chain A, Crystal Structure Of E53qbsshmt Internal Aldimine Length = 407 Back     alignment and structure
>pdb|3ECD|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Burkholderia Pseudomallei Length = 425 Back     alignment and structure
>pdb|2VMV|A Chain A, Crystal Structure Of F351gbsshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|3H7F|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Mycobacterium Tuberculosis Length = 447 Back     alignment and structure
>pdb|1EQB|A Chain A, X-Ray Crystal Structure At 2.7 Angstroms Resolution Of Ternary Complex Between The Y65f Mutant Of E-Coli Serine Hydroxymethyltransferase, Glycine And 5-Formyl Tetrahydrofolate Length = 417 Back     alignment and structure
>pdb|3G8M|A Chain A, Serine Hydroxymethyltransferase Y55f Mutant Length = 417 Back     alignment and structure
>pdb|2VMN|A Chain A, Crystal Structure Of N341absshmt Internal Aldimine Length = 405 Back     alignment and structure
>pdb|1DFO|A Chain A, Crystal Structure At 2.4 Angstrom Resolution Of E. Coli Serine Hydroxymethyltransferase In Complex With Glycine And 5-Formyl Tetrahydrofolate Length = 417 Back     alignment and structure
>pdb|3GBX|A Chain A, Serine Hydroxymethyltransferase From Salmonella Typhimurium Length = 420 Back     alignment and structure
>pdb|3N0L|A Chain A, Crystal Structure Of Serine Hydroxymethyltransferase From Campylobacter Jejuni Length = 417 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 2e-51
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 5e-51
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 4e-34
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 6e-34
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 1e-33
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 1e-33
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 2e-33
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 3e-33
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Length = 483 Back     alignment and structure
 Score =  167 bits (424), Expect = 2e-51
 Identities = 57/94 (60%), Positives = 77/94 (81%)

Query: 2   GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT 61
           GY++V+GG++NHL+LV+L++KG DG R EKVLEA  IA NKNT PGD SA+ P G+R+GT
Sbjct: 345 GYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRLGT 404

Query: 62  PALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSET 95
           PALTSRG +E+DF KVA+F    ++LTV+I+ +T
Sbjct: 405 PALTSRGLLEKDFQKVAHFIHRGIELTVQIQDDT 438
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} SCOP: c.67.1.4 PDB: 3ou5_A Length = 490 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Length = 407 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Length = 405 Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Length = 447 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} PDB: 1dfo_A* 3g8m_A* 1eqb_A* Length = 420 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} Length = 417 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Length = 425 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 100.0
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.88
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.63
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.48
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.16
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 98.96
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.82
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 97.91
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 97.87
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 94.99
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 94.87
1iug_A352 Putative aspartate aminotransferase; wild type, py 94.73
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 94.64
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 94.17
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 94.09
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 93.99
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 93.96
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 93.59
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 93.5
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 93.44
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 93.38
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 93.27
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 93.12
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 93.09
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 93.02
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 92.98
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 92.92
3nra_A407 Aspartate aminotransferase; structural genomics, j 92.92
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 92.77
2yrr_A353 Aminotransferase, class V; structural genomics, NP 92.77
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 92.71
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 92.67
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 92.59
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 92.25
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 92.21
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 91.96
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 91.9
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 91.84
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 91.64
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 91.41
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 91.35
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 91.23
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 91.17
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 90.88
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 90.84
3ele_A398 Amino transferase; RER070207001803, structural gen 90.67
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 90.66
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 90.65
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 90.52
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 90.47
3l8a_A421 METC, putative aminotransferase, probable beta-cys 90.3
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 90.01
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 89.94
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 89.87
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 89.83
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 89.74
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 89.74
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 89.71
1vp4_A425 Aminotransferase, putative; structural genomics, j 89.57
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 89.42
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 88.74
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 88.68
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 88.65
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 88.56
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 88.44
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 88.42
2fnu_A375 Aminotransferase; protein-product complex, structu 88.35
3f0h_A376 Aminotransferase; RER070207000802, structural geno 88.18
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 87.94
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 87.5
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 87.35
3ftb_A361 Histidinol-phosphate aminotransferase; structural 87.1
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 86.71
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 86.29
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 86.16
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 86.12
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 86.07
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 86.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 85.69
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 85.6
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 85.58
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 85.54
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 85.44
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 85.42
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 85.41
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 85.21
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 85.07
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 84.92
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 84.77
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 84.52
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 84.33
3ruy_A392 Ornithine aminotransferase; structural genomics, c 84.24
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 84.19
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 84.04
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 83.95
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 83.71
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 83.34
2z61_A370 Probable aspartate aminotransferase 2; amino acid 82.42
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 81.91
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 81.91
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 81.2
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 81.11
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 80.92
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 80.27
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 80.06
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.2e-35  Score=243.04  Aligned_cols=95  Identities=61%  Similarity=1.009  Sum_probs=91.9

Q ss_pred             CCCeeeeCCCCCceeeEeccCCCCCHHHHHHHHhhcCceeccCCCCCCCCCCCCCeeeEcchhHhhcCCCHHHHHHHHHH
Q 034072            1 MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYF   80 (104)
Q Consensus         1 ~G~~vv~ggTd~Hlvlvdl~~~gi~g~~a~~~Le~~gI~vnkn~lP~d~~~~~~sglRlGT~a~T~RG~~e~dm~~Ia~~   80 (104)
                      +||+|++|||||||+|||++++|++|++|+++|+++||++|||.+|+|++++.+|||||||+++|||||+|+||++||+|
T Consensus       354 ~G~~vvsGgTdnHlvLvDl~~~g~tG~~ae~~Le~agItvNkN~iP~D~sp~~~SGiRiGTpa~TtRG~~e~dm~~IA~~  433 (490)
T 3ou5_A          354 RGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDF  433 (490)
T ss_dssp             TTCEEGGGSCSSSEEEEECGGGTCCHHHHHHHHHHTTEECEEECCTTCCCSSSCSEEEEESHHHHHTTCCHHHHHHHHHH
T ss_pred             CCCeeecCCCCceEEEEeccccCCCHHHHHHHHHHcCcEECCCCCCCCCCCCCCCeeEECCHHHHhCCCCHHHHHHHHHH
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhc
Q 034072           81 FDAAVKLTVKIKSET   95 (104)
Q Consensus        81 i~~~l~~~~~~~~~~   95 (104)
                      |+++|..+++++++.
T Consensus       434 I~~~l~~~~~~~~~~  448 (490)
T 3ou5_A          434 IDEGVNIGLEVKSKT  448 (490)
T ss_dssp             HHHHHHHHHHHHHTC
T ss_pred             HHHHHHhhhhhhhhh
Confidence            999999988887655
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d1rv3a_470 c.67.1.4 (A:) Serine hydroxymethyltransferase {Rab 6e-33
d1dfoa_416 c.67.1.4 (A:) Serine hydroxymethyltransferase {Esc 4e-31
d1kl1a_405 c.67.1.4 (A:) Serine hydroxymethyltransferase {Bac 7e-31
d2a7va1463 c.67.1.4 (A:26-488) Serine hydroxymethyltransferas 8e-31
d2v1pa1467 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptop 5e-07
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 8e-05
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 470 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Serine hydroxymethyltransferase
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score =  116 bits (292), Expect = 6e-33
 Identities = 57/94 (60%), Positives = 77/94 (81%)

Query: 2   GYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGT 61
           GY++V+GG++NHL+LV+L++KG DG R EKVLEA  IA NKNT PGD SA+ P G+R+GT
Sbjct: 332 GYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSALRPSGLRLGT 391

Query: 62  PALTSRGFVEEDFAKVAYFFDAAVKLTVKIKSET 95
           PALTSRG +E+DF KVA+F    ++LTV+I+ +T
Sbjct: 392 PALTSRGLLEKDFQKVAHFIHRGIELTVQIQDDT 425
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Length = 416 Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 405 Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Length = 467 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 100.0
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 100.0
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.98
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.98
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 97.35
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 94.94
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 94.79
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 94.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 92.13
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 91.56
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 90.88
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 88.88
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 88.71
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 88.39
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 88.18
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 87.8
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 86.26
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 86.06
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 85.48
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 84.75
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 84.52
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 84.38
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 83.91
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 83.47
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 83.3
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 82.36
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 81.96
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 81.69
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 81.24
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Serine hydroxymethyltransferase
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]

Probab=100.00  E-value=1.2e-34  Score=235.67  Aligned_cols=97  Identities=60%  Similarity=0.990  Sum_probs=93.5

Q ss_pred             CCCeeeeCCCCCceeeEeccCCCCCHHHHHHHHhhcCceeccCCCCCCCCCCCCCeeeEcchhHhhcCCCHHHHHHHHHH
Q 034072            1 MGYELVSGGTENHLVLVNLKNKGIDGSRVEKVLEAVHIAANKNTVPGDVSAMVPGGIRMGTPALTSRGFVEEDFAKVAYF   80 (104)
Q Consensus         1 ~G~~vv~ggTd~Hlvlvdl~~~gi~g~~a~~~Le~~gI~vnkn~lP~d~~~~~~sglRlGT~a~T~RG~~e~dm~~Ia~~   80 (104)
                      +||+|++|||||||||||+++++++|++|+++||++||++|||.+|+|++++.+|||||||+++|+|||+|+||++||+|
T Consensus       327 ~G~~vv~ggTdnHlvlvdl~~~~~~G~~ae~~Le~~gI~~Nkn~iP~D~~~~~~sGiRiGT~a~TtrG~~e~dm~~iA~~  406 (463)
T d2a7va1         327 RGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDF  406 (463)
T ss_dssp             TTCEEGGGSCSSSEEEEECTTTTCCHHHHHHHHHHTTEECEEECCTTCCCSSSCSEEEEESHHHHHTTCCHHHHHHHHHH
T ss_pred             CCCeeecCCCCCceeeeeccccCCCHHHHHHHHHhccCccCCccCCCCCCCCCCCceEeCCHHHHhCCCCHHHHHHHHHH
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhccCc
Q 034072           81 FDAAVKLTVKIKSETQGS   98 (104)
Q Consensus        81 i~~~l~~~~~~~~~~~~~   98 (104)
                      |+++|+.++++|++. ++
T Consensus       407 I~~~l~~~~~~~~~~-~~  423 (463)
T d2a7va1         407 IDEGVNIGLEVKSKT-AK  423 (463)
T ss_dssp             HHHHHHHHHHHHHHC-CS
T ss_pred             HHHHHHHhhhhhhhh-hh
Confidence            999999999998776 44
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure