Citrus Sinensis ID: 035373
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| 225429205 | 64 | PREDICTED: uncharacterized protein LOC10 | 0.954 | 0.984 | 0.892 | 2e-20 | |
| 224105751 | 65 | predicted protein [Populus trichocarpa] | 0.969 | 0.984 | 0.892 | 3e-20 | |
| 224060879 | 64 | predicted protein [Populus trichocarpa] | 0.954 | 0.984 | 0.876 | 4e-20 | |
| 255562224 | 64 | conserved hypothetical protein [Ricinus | 0.924 | 0.953 | 0.887 | 9e-20 | |
| 297834878 | 61 | hypothetical protein ARALYDRAFT_479483 [ | 0.878 | 0.950 | 0.745 | 6e-14 | |
| 307135953 | 64 | hypothetical protein [Cucumis melo subsp | 0.924 | 0.953 | 0.838 | 1e-13 | |
| 15230915 | 64 | uncharacterized protein [Arabidopsis tha | 0.909 | 0.937 | 0.704 | 1e-13 | |
| 449465089 | 64 | PREDICTED: uncharacterized protein LOC10 | 0.924 | 0.953 | 0.822 | 2e-13 | |
| 357480709 | 71 | hypothetical protein MTR_5g005330 [Medic | 0.833 | 0.774 | 0.789 | 1e-12 | |
| 356495813 | 135 | PREDICTED: 40S ribosomal protein S20-1-l | 0.636 | 0.311 | 0.837 | 6e-09 |
| >gi|225429205|ref|XP_002276348.1| PREDICTED: uncharacterized protein LOC100258330 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 103 bits (256), Expect = 2e-20, Method: Compositional matrix adjust.
Identities = 58/65 (89%), Positives = 61/65 (93%), Gaps = 2/65 (3%)
Query: 1 MAINQLENLVESIKSKVRALKKKKNKPYIKMDKSSSVKVEIRSRKAKKLIDKTLQVADRP 60
MAI QLENLVESIKSKVRALKK K KPYIKMDKSSSVKVEIRSRKAKKLIDKT++ ADRP
Sbjct: 1 MAI-QLENLVESIKSKVRALKKSK-KPYIKMDKSSSVKVEIRSRKAKKLIDKTMRAADRP 58
Query: 61 GKRSI 65
GKR+I
Sbjct: 59 GKRTI 63
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224105751|ref|XP_002313920.1| predicted protein [Populus trichocarpa] gi|222850328|gb|EEE87875.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224060879|ref|XP_002300282.1| predicted protein [Populus trichocarpa] gi|222847540|gb|EEE85087.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255562224|ref|XP_002522120.1| conserved hypothetical protein [Ricinus communis] gi|223538719|gb|EEF40320.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297834878|ref|XP_002885321.1| hypothetical protein ARALYDRAFT_479483 [Arabidopsis lyrata subsp. lyrata] gi|297331161|gb|EFH61580.1| hypothetical protein ARALYDRAFT_479483 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|307135953|gb|ADN33813.1| hypothetical protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|15230915|ref|NP_188600.1| uncharacterized protein [Arabidopsis thaliana] gi|9294431|dbj|BAB02551.1| unnamed protein product [Arabidopsis thaliana] gi|30102564|gb|AAP21200.1| At3g19660 [Arabidopsis thaliana] gi|110743915|dbj|BAE99791.1| hypothetical protein [Arabidopsis thaliana] gi|332642751|gb|AEE76272.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449465089|ref|XP_004150261.1| PREDICTED: uncharacterized protein LOC101219359 [Cucumis sativus] gi|449484378|ref|XP_004156865.1| PREDICTED: uncharacterized LOC101219359 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357480709|ref|XP_003610640.1| hypothetical protein MTR_5g005330 [Medicago truncatula] gi|355511975|gb|AES93598.1| hypothetical protein MTR_5g005330 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356495813|ref|XP_003516766.1| PREDICTED: 40S ribosomal protein S20-1-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| TAIR|locus:2091156 | 64 | AT3G19660 "AT3G19660" [Arabido | 0.909 | 0.937 | 0.704 | 1.4e-16 |
| TAIR|locus:2091156 AT3G19660 "AT3G19660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 205 (77.2 bits), Expect = 1.4e-16, P = 1.4e-16
Identities = 43/61 (70%), Positives = 53/61 (86%)
Query: 5 QLENLVESIKSKVRALKKKKNKPYIKMDKSSSVKVEIRSRKAKKLIDKTLQVADRPGKRS 64
QLE+L+E+IKSKV L+KKK K YIKMDKSSSV+V IR +K + LIDKTL+VADRPGKR+
Sbjct: 4 QLESLMETIKSKVSLLRKKK-KTYIKMDKSSSVRVAIRRKKTRDLIDKTLKVADRPGKRT 62
Query: 65 I 65
+
Sbjct: 63 L 63
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.310 0.125 0.309 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 66 66 0.00091 102 3 10 23 0.44 28
29 0.48 28
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 393 (42 KB)
Total size of DFA: 74 KB (2064 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 15.51u 0.12s 15.63t Elapsed: 00:00:01
Total cpu time: 15.51u 0.12s 15.63t Elapsed: 00:00:01
Start: Thu May 9 14:07:48 2013 End: Thu May 9 14:07:49 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00038625001 | SubName- Full=Chromosome chr3 scaffold_95, whole genome shotgun sequence; (64 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
No hit with probability above 80.00
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00