Citrus Sinensis ID: 035513

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
METVIELADDFADDLSLQSASSESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTDNDSSTALKSQRSSGFPCLGTPK
cccHHcccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHccccEEccccccccccccccEEEEccccEEEEEcccccccHHHHHHHccEEEEEcccHHHHHHHHHcHHHHccccHHHHHHHHHHcccccHHHHcccccccccEEEcccccccHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEccccccccEEEEcHHHHHHHHHHHHccccccccEEEcccccEEccccccccEEEEEEEccHHHHHHHHHHHcccccccEEEEEcccccccEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHccccEEEEEEEccccccccccEEEccccEEEEEEEEEEccHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHcHHHHccccHccccEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHcccEEEccEcHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcccccEEEEEEEcccEEEEEEccHHHHHHHHHHHHcccccEEEEEEEEccccccEEEEEEccccHHHcEEEEEccEEcccHHHHHHHHHHHcccccHHHEEEEccEEcHHHHHHHHHHccccEEEEcEEccEEcccccEEcccccHHHHHHccccccccccccccccccccccccc
METVIELADDfaddlslqsassesttmptkqpfvigvaggtasgkTTVCNMIISRLRDQRVVLVNQdsfyhsltdeklqnlhdynfdhpdafdTELLLSDMEklkhgqavsipdydfkshkrkqqsrlinpsdvfILEGIlvlhdprvrdlMSMKIfvdtdsdvrlsrRIQRDTVERGRDIEDVLDQYARfvkpsfeefilpskkyadiiiprggdndVAIDLIVQHILTKlgqhdlckiysNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHglghlpftekqiitptgsvytGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYqklpadissrHVLLLDPILASGNSAVKAISLILskgvpesniIFLNLIAAPQGIHAICKrfpkikivtseidssidehacvipgmgefgdryfgtdndsstalksqrssgfpclgtpk
METVIELADDFADDLSLQSAssesttmptkqpfVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGqavsipdydfkshKRKQqsrlinpsdvfILEGILVLHDPRVRDLMSMKifvdtdsdvrlsrriqrdtvergrdiedvLDQYARFvkpsfeefilpskKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHlpftekqiitptgsvYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTDNDSStalksqrssgfpclgtpk
METVIELADDFADDLSLQSASSESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRAcckgikigkiLIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTDNDSSTALKSQRSSGFPCLGTPK
********************************FVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDY************LINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFG************************
*******************************PFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGT****************PCLG***
METVIELADDFADDLSLQ**********TKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDF*********RLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTDND********************
**********************ESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTDN*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METVIELADDFADDLSLQSASSESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTDNDSSTALKSQRSSGFPCLGTPK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
Q9LTY6465 Uridine kinase-like prote yes no 0.951 0.967 0.777 0.0
O65583469 Uridine kinase-like prote no no 0.917 0.925 0.762 0.0
Q8VYB2466 Uridine kinase-like prote no no 0.932 0.946 0.739 0.0
Q9FKS0486 Uridine kinase-like prote no no 0.896 0.872 0.743 0.0
Q9LK34483 Uridine kinase-like prote no no 0.926 0.906 0.726 0.0
Q9NWZ5548 Uridine-cytidine kinase-l yes no 0.894 0.771 0.457 1e-115
Q91YL3548 Uridine-cytidine kinase-l yes no 0.894 0.771 0.455 1e-114
Q55EL3499 Uridine-cytidine kinase A yes no 0.883 0.837 0.475 1e-113
O74427454 Uridine kinase OS=Schizos yes no 0.862 0.898 0.344 1e-66
Q9BZX2261 Uridine-cytidine kinase 2 no no 0.418 0.758 0.570 8e-63
>sp|Q9LTY6|UKL5_ARATH Uridine kinase-like protein 5 OS=Arabidopsis thaliana GN=UKL5 PE=2 SV=1 Back     alignment and function desciption
 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/450 (77%), Positives = 397/450 (88%)

Query: 6   ELADDFADDLSLQSASSESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVN 65
           +L++   D   +    S S   P KQPFVIGVAGGTASGKTTVCNMI+S+L DQRVVLVN
Sbjct: 3   KLSNGVRDHCLISDYVSPSAPAPLKQPFVIGVAGGTASGKTTVCNMIMSQLHDQRVVLVN 62

Query: 66  QDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQ 125
           QDSFYHSLT EKL  +H+YNFDHPDAF+TE+LLS MEKL+ GQ V+IP YDFK H+  + 
Sbjct: 63  QDSFYHSLTKEKLNKVHEYNFDHPDAFNTEVLLSCMEKLRSGQPVNIPSYDFKIHQSIES 122

Query: 126 SRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVL 185
           S  +NP DV ILEGILVL+DPRVRDLM+MKIFVDTD+DVRLSRRIQRDTVERGR+I++VL
Sbjct: 123 SSPVNPGDVIILEGILVLNDPRVRDLMNMKIFVDTDADVRLSRRIQRDTVERGRNIQNVL 182

Query: 186 DQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVD 245
           +QY +FVKPSF+E+I PS KYADIIIPRGGDNDVAIDLIVQHI TKL QH+LCKIYSN+ 
Sbjct: 183 EQYTKFVKPSFDEYIQPSMKYADIIIPRGGDNDVAIDLIVQHIRTKLCQHNLCKIYSNIF 242

Query: 246 VIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYT 305
           +I STFQI+GMHTLIRD+ TT HDFVFYADRLIRLVVEHGLGHLPFTEKQI TPTGSVYT
Sbjct: 243 IISSTFQIKGMHTLIRDINTTKHDFVFYADRLIRLVVEHGLGHLPFTEKQITTPTGSVYT 302

Query: 306 GVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSR 365
           GV FC+RLCG+S+IRSGESMENALRACC GIKIGKILIHRE N GRQLIY+KLP DISSR
Sbjct: 303 GVDFCKRLCGVSVIRSGESMENALRACCNGIKIGKILIHRENNDGRQLIYEKLPKDISSR 362

Query: 366 HVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSE 425
           HV LLDP+LASG SAVKAI+L+LSKGVPES+IIFLNLIAAPQGIHA+CK+FP +KIVTSE
Sbjct: 363 HVFLLDPVLASGYSAVKAITLLLSKGVPESHIIFLNLIAAPQGIHALCKKFPMLKIVTSE 422

Query: 426 IDSSIDEHACVIPGMGEFGDRYFGTDNDSS 455
           IDSS++E + VIPG+GEF DRYFGT+N +S
Sbjct: 423 IDSSLNEDSRVIPGLGEFADRYFGTNNINS 452
Involved in the pyrimidine salvage pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 9
>sp|O65583|UKL4_ARATH Uridine kinase-like protein 4 OS=Arabidopsis thaliana GN=UKL4 PE=1 SV=2 Back     alignment and function description
>sp|Q8VYB2|UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana GN=UKL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FKS0|UKL1_ARATH Uridine kinase-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=UKL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK34|UKL2_ARATH Uridine kinase-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=UKL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2 Back     alignment and function description
>sp|Q91YL3|UCKL1_MOUSE Uridine-cytidine kinase-like 1 OS=Mus musculus GN=Uckl1 PE=1 SV=1 Back     alignment and function description
>sp|Q55EL3|UCKA_DICDI Uridine-cytidine kinase A OS=Dictyostelium discoideum GN=udkA PE=3 SV=1 Back     alignment and function description
>sp|O74427|URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urk1 PE=3 SV=1 Back     alignment and function description
>sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
224140869454 predicted protein [Populus trichocarpa] 0.953 0.993 0.804 0.0
255560960462 uridine cytidine kinase I, putative [Ric 0.955 0.978 0.799 0.0
297613682456 uridine cytidine kinase [Carica papaya] 0.940 0.975 0.778 0.0
297815010464 predicted protein [Arabidopsis lyrata su 0.951 0.969 0.78 0.0
15232164465 putative uracil phosphoribosyltransferas 0.951 0.967 0.777 0.0
359488798448 PREDICTED: uridine kinase-like protein 5 0.911 0.962 0.819 0.0
224122116482 predicted protein [Populus trichocarpa] 0.896 0.879 0.8 0.0
255557206482 uridine cytidine kinase I, putative [Ric 0.919 0.902 0.780 0.0
356527242477 PREDICTED: uridine kinase-like protein 4 0.942 0.935 0.756 0.0
225463508479 PREDICTED: uridine kinase-like protein 4 0.926 0.914 0.769 0.0
>gi|224140869|ref|XP_002323801.1| predicted protein [Populus trichocarpa] gi|222866803|gb|EEF03934.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/451 (80%), Positives = 405/451 (89%)

Query: 2   ETVIELADDFADDLSLQSASSESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRV 61
           ET+  L ++  + L +QS    S   P +QPFVIGVAGGTASGKTTVCNMIIS+L DQRV
Sbjct: 4   ETLSTLNNNIKNHLPVQSNGLISAPDPPQQPFVIGVAGGTASGKTTVCNMIISQLHDQRV 63

Query: 62  VLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHK 121
           VLVNQDSFYHSL+D  L  ++DYNFDHPDAF+TELLLS MEKLK+G+AV IP+YDF++HK
Sbjct: 64  VLVNQDSFYHSLSDYALAQVYDYNFDHPDAFNTELLLSCMEKLKNGRAVDIPNYDFQTHK 123

Query: 122 RKQQSRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDI 181
           R      +NPSD+ ILEGILVLHDPRVRDLM+MKIFVDTDSD+RL+RRIQRDTVERGR+I
Sbjct: 124 RIGPGWKVNPSDIIILEGILVLHDPRVRDLMNMKIFVDTDSDLRLARRIQRDTVERGRNI 183

Query: 182 EDVLDQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIY 241
           ++VLDQYAR VKPSFEEFILPSKKYAD+IIPRGGDNDVAIDLI+QHI  KLGQH LCKIY
Sbjct: 184 QNVLDQYARSVKPSFEEFILPSKKYADVIIPRGGDNDVAIDLIIQHIRAKLGQHHLCKIY 243

Query: 242 SNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTG 301
            NV VI STFQ+RGMHTL+RDV TT HDFVFYADRLIRLVVEHGLGHLPFTEKQI TPTG
Sbjct: 244 PNVSVIHSTFQMRGMHTLVRDVKTTKHDFVFYADRLIRLVVEHGLGHLPFTEKQITTPTG 303

Query: 302 SVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPAD 361
           SVY GVVFC+RLCG+S+IRSGESMENALRACCKGIKIGKILIH EGN+GRQLIY+KLPAD
Sbjct: 304 SVYPGVVFCKRLCGVSVIRSGESMENALRACCKGIKIGKILIHGEGNNGRQLIYEKLPAD 363

Query: 362 ISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKI 421
           ISSRHVLLLDP+LASGNSAVKAI+L+LSKGV ESNIIFLNLIAAPQGIH +CK+FPK+KI
Sbjct: 364 ISSRHVLLLDPVLASGNSAVKAINLLLSKGVVESNIIFLNLIAAPQGIHVVCKKFPKLKI 423

Query: 422 VTSEIDSSIDEHACVIPGMGEFGDRYFGTDN 452
           VTSEID ++DE  CVIPGMGEFGDRYFGT+N
Sbjct: 424 VTSEIDVTLDEDLCVIPGMGEFGDRYFGTNN 454

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255560960|ref|XP_002521493.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223539392|gb|EEF40983.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297613682|gb|ADI48274.1| uridine cytidine kinase [Carica papaya] Back     alignment and taxonomy information
>gi|297815010|ref|XP_002875388.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321226|gb|EFH51647.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15232164|ref|NP_189380.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75311569|sp|Q9LTY6.1|UKL5_ARATH RecName: Full=Uridine kinase-like protein 5; Includes: RecName: Full=Probable uridine kinase; Short=UK; Includes: RecName: Full=Probable uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase gi|7939517|dbj|BAA95720.1| uridine kinase-like protein [Arabidopsis thaliana] gi|332643800|gb|AEE77321.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359488798|ref|XP_002271589.2| PREDICTED: uridine kinase-like protein 5 [Vitis vinifera] gi|296087584|emb|CBI34840.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122116|ref|XP_002330545.1| predicted protein [Populus trichocarpa] gi|222872103|gb|EEF09234.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255557206|ref|XP_002519634.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223541224|gb|EEF42779.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356527242|ref|XP_003532221.1| PREDICTED: uridine kinase-like protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|225463508|ref|XP_002263911.1| PREDICTED: uridine kinase-like protein 4 [Vitis vinifera] gi|296090033|emb|CBI39852.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
TAIR|locus:2086691465 UKL5 "AT3G27440" [Arabidopsis 0.951 0.967 0.757 6.8e-182
TAIR|locus:2131498469 UKL4 "AT4G26510" [Arabidopsis 0.921 0.929 0.737 3.7e-174
TAIR|locus:2012125466 UKL3 "AT1G55810" [Arabidopsis 0.894 0.907 0.742 3.3e-173
TAIR|locus:2164516486 UK/UPRT1 "AT5G40870" [Arabidop 0.926 0.901 0.707 4.5e-169
TAIR|locus:2086523483 UKL2 "AT3G27190" [Arabidopsis 0.919 0.900 0.705 6.6e-168
UNIPROTKB|Q9NWZ5548 UCKL1 "Uridine-cytidine kinase 0.894 0.771 0.453 7.9e-101
UNIPROTKB|F1NB19511 UCKL1 "Uridine kinase" [Gallus 0.894 0.827 0.448 1.3e-100
ZFIN|ZDB-GENE-040724-238533 uckl1a "uridine-cytidine kinas 0.915 0.812 0.461 1.7e-100
UNIPROTKB|E1BP85548 UCKL1 "Uridine kinase" [Bos ta 0.894 0.771 0.451 2.1e-100
UNIPROTKB|F8WAC3548 UCKL1 "Uridine kinase" [Homo s 0.894 0.771 0.451 2.1e-100
TAIR|locus:2086691 UKL5 "AT3G27440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1765 (626.4 bits), Expect = 6.8e-182, P = 6.8e-182
 Identities = 341/450 (75%), Positives = 388/450 (86%)

Query:     6 ELADDFADDLSLQSASSESTTMPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVN 65
             +L++   D   +    S S   P KQPFVIGVAGGTASGKTTVCNMI+S+L DQRVVLVN
Sbjct:     3 KLSNGVRDHCLISDYVSPSAPAPLKQPFVIGVAGGTASGKTTVCNMIMSQLHDQRVVLVN 62

Query:    66 QDSFYHSLTDEKLQNLHDYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQ 125
             QDSFYHSLT EKL  +H+YNFDHPDAF+TE+LLS MEKL+ GQ V+IP YDFK H+  + 
Sbjct:    63 QDSFYHSLTKEKLNKVHEYNFDHPDAFNTEVLLSCMEKLRSGQPVNIPSYDFKIHQSIES 122

Query:   126 SRLINPSDVFILEGILVLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVL 185
             S  +NP DV ILEGILVL+DPRVRDLM+MKIFVDTD+DVRLSRRIQRDTVERGR+I++VL
Sbjct:   123 SSPVNPGDVIILEGILVLNDPRVRDLMNMKIFVDTDADVRLSRRIQRDTVERGRNIQNVL 182

Query:   186 DQYARFVKPSFEEFILPSKKYADIIIPRGGDNDVAIDLIVQHILTKLGQHDLCKIYSNVD 245
             +QY +FVKPSF+E+I PS KYADIIIPRGGDNDVAIDLIVQHI TKL QH+LCKIYSN+ 
Sbjct:   183 EQYTKFVKPSFDEYIQPSMKYADIIIPRGGDNDVAIDLIVQHIRTKLCQHNLCKIYSNIF 242

Query:   246 VIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYT 305
             +I STFQI+GMHTLIRD+ TT HDFVFYADRLIRLVVEHGLGHLPFTEKQI TPTGSVYT
Sbjct:   243 IISSTFQIKGMHTLIRDINTTKHDFVFYADRLIRLVVEHGLGHLPFTEKQITTPTGSVYT 302

Query:   306 GVVFCRRLCGISIIRSGESMENALRAXXXXXXXXXXLIHREGNSGRQLIYQKLPADISSR 365
             GV FC+RLCG+S+IRSGESMENALRA          LIHRE N GRQLIY+KLP DISSR
Sbjct:   303 GVDFCKRLCGVSVIRSGESMENALRACCNGIKIGKILIHRENNDGRQLIYEKLPKDISSR 362

Query:   366 HVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAICKRFPKIKIVTSE 425
             HV LLDP+LASG SAVKAI+L+LSKGVPES+IIFLNLIAAPQGIHA+CK+FP +KIVTSE
Sbjct:   363 HVFLLDPVLASGYSAVKAITLLLSKGVPESHIIFLNLIAAPQGIHALCKKFPMLKIVTSE 422

Query:   426 IDSSIDEHACVIPGMGEFGDRYFGTDNDSS 455
             IDSS++E + VIPG+GEF DRYFGT+N +S
Sbjct:   423 IDSSLNEDSRVIPGLGEFADRYFGTNNINS 452
GO:0004845 "uracil phosphoribosyltransferase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016301 "kinase activity" evidence=IEA;ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2131498 UKL4 "AT4G26510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012125 UKL3 "AT1G55810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164516 UK/UPRT1 "AT5G40870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086523 UKL2 "AT3G27190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWZ5 UCKL1 "Uridine-cytidine kinase-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NB19 UCKL1 "Uridine kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040724-238 uckl1a "uridine-cytidine kinase 1-like 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BP85 UCKL1 "Uridine kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F8WAC3 UCKL1 "Uridine kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74427URK1_SCHPO2, ., 7, ., 1, ., 4, 80.34490.86250.8986yesno
O65583UKL4_ARATH2, ., 4, ., 2, ., 90.76250.91750.9253nono
Q9FKS0UKL1_ARATH2, ., 4, ., 2, ., 90.74350.89640.8724nono
P27515URK1_YEAST2, ., 7, ., 1, ., 4, 80.33400.92600.8742yesno
Q9LTY6UKL5_ARATH2, ., 4, ., 2, ., 90.77770.95130.9677yesno
Q8VYB2UKL3_ARATH2, ., 4, ., 2, ., 90.73990.93230.9463nono
Q55EL3UCKA_DICDI2, ., 7, ., 1, ., 4, 80.47570.88370.8376yesno
Q9LK34UKL2_ARATH2, ., 4, ., 2, ., 90.72660.92600.9068nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.2LOW CONFIDENCE prediction!
4th Layer2.7.1.480.824
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 1e-109
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 8e-99
TIGR00235207 TIGR00235, udk, uridine kinase 5e-80
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 6e-80
COG0035210 COG0035, Upp, Uracil phosphoribosyltransferase [Nu 5e-62
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 4e-49
TIGR01091207 TIGR01091, upp, uracil phosphoribosyltransferase 7e-37
PRK00129209 PRK00129, upp, uracil phosphoribosyltransferase; R 2e-32
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 3e-32
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 7e-29
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 1e-28
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 1e-26
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 3e-22
PLN02541244 PLN02541, PLN02541, uracil phosphoribosyltransfera 5e-18
PLN02318 656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 2e-16
COG1072283 COG1072, CoaA, Panthothenate kinase [Coenzyme meta 3e-13
cd02025220 cd02025, PanK, Pantothenate kinase (PanK) catalyze 4e-12
cd02024187 cd02024, NRK1, Nicotinamide riboside kinase (NRK) 1e-11
PRK05439311 PRK05439, PRK05439, pantothenate kinase; Provision 2e-11
TIGR00554290 TIGR00554, panK_bact, pantothenate kinase, bacteri 2e-11
PRK08233182 PRK08233, PRK08233, hypothetical protein; Provisio 2e-10
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 8e-10
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrol 1e-07
COG4240300 COG4240, COG4240, Predicted kinase [General functi 1e-07
PRK06696223 PRK06696, PRK06696, uridine kinase; Validated 6e-07
cd02022179 cd02022, DPCK, Dephospho-coenzyme A kinase (DPCK, 2e-05
COG0237201 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme meta 2e-04
pfam01121179 pfam01121, CoaE, Dephospho-CoA kinase 4e-04
TIGR00152188 TIGR00152, TIGR00152, dephospho-CoA kinase 0.002
PRK00081194 PRK00081, coaE, dephospho-CoA kinase; Reviewed 0.002
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information 
 Score =  321 bits (824), Expect = e-109
 Identities = 118/198 (59%), Positives = 160/198 (80%)

Query: 34  VIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNFDHPDAFD 93
           +IG+AGG+ SGKTTV   II +L + +VV+++QDS+Y  L+ E+L+   + N+DHPDAFD
Sbjct: 1   IIGIAGGSGSGKTTVAEEIIEQLGNPKVVIISQDSYYKDLSHEELEERKNNNYDHPDAFD 60

Query: 94  TELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDPRVRDLMS 153
            +LL+S ++ LK+G++V IP YDFK+H R +++  + P+DV ILEGIL L+D  +RDLM 
Sbjct: 61  FDLLISHLQDLKNGKSVEIPVYDFKTHSRLKETVTVYPADVIILEGILALYDKELRDLMD 120

Query: 154 MKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKYADIIIPR 213
           +KIFVDTD+DVRL RRI+RD VERGRD+E V++QY +FVKP  E+FI P+K+YAD+IIPR
Sbjct: 121 LKIFVDTDADVRLIRRIERDIVERGRDLESVINQYLKFVKPMHEQFIEPTKRYADVIIPR 180

Query: 214 GGDNDVAIDLIVQHILTK 231
           GGDN VAIDLIVQHI +K
Sbjct: 181 GGDNHVAIDLIVQHIKSK 198

7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine. Length = 198
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|223113 COG0035, Upp, Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|130163 TIGR01091, upp, uracil phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|234653 PRK00129, upp, uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|215297 PLN02541, PLN02541, uracil phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information
>gnl|CDD|223998 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238983 cd02025, PanK, Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|238982 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>gnl|CDD|235466 PRK05439, PRK05439, pantothenate kinase; Provisional Back     alignment and domain information
>gnl|CDD|200027 TIGR00554, panK_bact, pantothenate kinase, bacterial type Back     alignment and domain information
>gnl|CDD|181310 PRK08233, PRK08233, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|236442 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>gnl|CDD|226691 COG4240, COG4240, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180660 PRK06696, PRK06696, uridine kinase; Validated Back     alignment and domain information
>gnl|CDD|238980 cd02022, DPCK, Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>gnl|CDD|223315 COG0237, CoaE, Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|216308 pfam01121, CoaE, Dephospho-CoA kinase Back     alignment and domain information
>gnl|CDD|129256 TIGR00152, TIGR00152, dephospho-CoA kinase Back     alignment and domain information
>gnl|CDD|234620 PRK00081, coaE, dephospho-CoA kinase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide t 100.0
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 100.0
PLN02541244 uracil phosphoribosyltransferase 100.0
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 100.0
TIGR01091207 upp uracil phosphoribosyltransferase. that include 100.0
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 100.0
KOG1017267 consensus Predicted uracil phosphoribosyltransfera 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 100.0
PTZ00301210 uridine kinase; Provisional 99.97
PRK05480209 uridine/cytidine kinase; Provisional 99.95
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.95
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.95
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.94
PRK15453290 phosphoribulokinase; Provisional 99.93
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.93
PLN02348395 phosphoribulokinase 99.93
PLN02318 656 phosphoribulokinase/uridine kinase 99.92
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.91
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.91
PRK05439311 pantothenate kinase; Provisional 99.91
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.89
PRK07429327 phosphoribulokinase; Provisional 99.88
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.88
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.84
PRK06696223 uridine kinase; Validated 99.83
PRK07667193 uridine kinase; Provisional 99.82
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.8
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.74
PRK08233182 hypothetical protein; Provisional 99.71
PRK06547172 hypothetical protein; Provisional 99.7
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.65
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.65
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.64
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.63
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.62
PLN02422232 dephospho-CoA kinase 99.62
PTZ00451244 dephospho-CoA kinase; Provisional 99.62
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.61
PLN03046460 D-glycerate 3-kinase; Provisional 99.6
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.58
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.57
KOG3308225 consensus Uncharacterized protein of the uridine k 99.57
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.57
PLN02796347 D-glycerate 3-kinase 99.54
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 99.5
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.49
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 99.48
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 99.47
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.44
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.38
PLN02369302 ribose-phosphate pyrophosphokinase 99.37
PRK01184184 hypothetical protein; Provisional 99.36
COG4240300 Predicted kinase [General function prediction only 99.36
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 99.35
PRK06217183 hypothetical protein; Validated 99.35
COG0703172 AroK Shikimate kinase [Amino acid transport and me 99.34
PRK08118167 topology modulation protein; Reviewed 99.33
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.32
PRK06762166 hypothetical protein; Provisional 99.29
PRK13949169 shikimate kinase; Provisional 99.29
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 99.28
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 99.28
PRK04182180 cytidylate kinase; Provisional 99.27
PLN02200234 adenylate kinase family protein 99.25
PRK00625173 shikimate kinase; Provisional 99.24
PRK00131175 aroK shikimate kinase; Reviewed 99.24
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 99.23
PRK05057172 aroK shikimate kinase I; Reviewed 99.23
PRK04040188 adenylate kinase; Provisional 99.22
PRK00023225 cmk cytidylate kinase; Provisional 99.2
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 99.19
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.19
PRK13946184 shikimate kinase; Provisional 99.18
PRK08356195 hypothetical protein; Provisional 99.18
PRK07261171 topology modulation protein; Provisional 99.17
PRK13948182 shikimate kinase; Provisional 99.16
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 99.16
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.16
PRK05541176 adenylylsulfate kinase; Provisional 99.15
PRK03839180 putative kinase; Provisional 99.15
KOG2878282 consensus Predicted kinase [General function predi 99.14
PRK13947171 shikimate kinase; Provisional 99.12
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.11
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 99.11
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 99.11
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 99.11
PRK14527191 adenylate kinase; Provisional 99.09
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.08
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 99.07
PRK03731171 aroL shikimate kinase II; Reviewed 99.07
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 99.07
PRK14531183 adenylate kinase; Provisional 99.07
PRK14532188 adenylate kinase; Provisional 99.04
PRK14530215 adenylate kinase; Provisional 99.03
PRK14737186 gmk guanylate kinase; Provisional 99.03
PTZ00088229 adenylate kinase 1; Provisional 99.02
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 99.01
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.01
PRK13808333 adenylate kinase; Provisional 99.0
PRK00279215 adk adenylate kinase; Reviewed 99.0
PRK14528186 adenylate kinase; Provisional 98.98
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.97
PLN02199303 shikimate kinase 98.96
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.95
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.94
PLN02674244 adenylate kinase 98.92
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.92
PRK00698205 tmk thymidylate kinase; Validated 98.91
PLN02459261 probable adenylate kinase 98.91
PRK02496184 adk adenylate kinase; Provisional 98.9
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 98.89
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 98.89
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 98.89
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 98.88
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 98.88
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.88
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.85
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 98.84
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.83
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.83
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 98.83
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.83
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 98.83
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 98.82
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 98.82
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 98.81
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.8
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.8
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 98.8
PRK13973213 thymidylate kinase; Provisional 98.8
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.79
PRK12338319 hypothetical protein; Provisional 98.79
PRK14526211 adenylate kinase; Provisional 98.77
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.75
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 98.74
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.74
PRK09825176 idnK D-gluconate kinase; Provisional 98.73
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.73
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.72
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 98.72
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 98.72
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 98.71
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 98.71
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 98.71
PRK00889175 adenylylsulfate kinase; Provisional 98.71
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 98.7
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 98.69
PRK03846198 adenylylsulfate kinase; Provisional 98.68
PRK14529223 adenylate kinase; Provisional 98.68
PRK13975196 thymidylate kinase; Provisional 98.67
PRK12339197 2-phosphoglycerate kinase; Provisional 98.67
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.66
PLN02238189 hypoxanthine phosphoribosyltransferase 98.64
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 98.62
COG3954289 PrkB Phosphoribulokinase [Energy production and co 98.62
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.61
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.61
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.61
PRK07933213 thymidylate kinase; Validated 98.6
PRK00300205 gmk guanylate kinase; Provisional 98.59
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.58
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 98.57
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 98.56
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 98.56
COG3638258 ABC-type phosphate/phosphonate transport system, A 98.55
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 98.55
PLN02842505 nucleotide kinase 98.54
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.54
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 98.53
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 98.53
PRK14738206 gmk guanylate kinase; Provisional 98.53
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 98.52
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.51
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.51
PHA02530300 pseT polynucleotide kinase; Provisional 98.51
COG1127263 Ttg2A ABC-type transport system involved in resist 98.48
PLN02924220 thymidylate kinase 98.47
COG4088261 Predicted nucleotide kinase [Nucleotide transport 98.46
PRK11545163 gntK gluconate kinase 1; Provisional 98.46
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.46
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 98.45
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 98.44
COG4619223 ABC-type uncharacterized transport system, ATPase 98.41
PRK13537306 nodulation ABC transporter NodI; Provisional 98.39
PRK02304175 adenine phosphoribosyltransferase; Provisional 98.36
PRK13974212 thymidylate kinase; Provisional 98.35
PRK04220301 2-phosphoglycerate kinase; Provisional 98.34
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 98.33
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.33
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 98.33
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.33
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 98.32
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.31
PRK12337475 2-phosphoglycerate kinase; Provisional 98.31
COG1117253 PstB ABC-type phosphate transport system, ATPase c 98.3
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.3
cd03215182 ABC_Carb_Monos_II This family represents domain II 98.29
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 98.29
PRK13536340 nodulation factor exporter subunit NodI; Provision 98.26
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.26
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.26
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.25
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 98.25
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 98.25
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.24
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 98.24
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 98.24
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 98.23
COG0410237 LivF ABC-type branched-chain amino acid transport 98.23
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.23
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 98.22
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 98.22
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.22
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 98.22
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 98.22
cd03246173 ABCC_Protease_Secretion This family represents the 98.22
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 98.21
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 98.21
PRK13976209 thymidylate kinase; Provisional 98.21
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 98.21
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 98.2
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 98.2
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 98.2
cd03269210 ABC_putative_ATPase This subfamily is involved in 98.19
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 98.19
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 98.19
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 98.19
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 98.19
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 98.19
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 98.19
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.17
PRK11607377 potG putrescine transporter ATP-binding subunit; P 98.17
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 98.17
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 98.17
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 98.16
PLN02165334 adenylate isopentenyltransferase 98.16
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 98.16
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.16
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 98.16
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 98.16
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 98.16
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 98.15
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 98.15
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 98.15
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.15
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 98.14
PRK10762501 D-ribose transporter ATP binding protein; Provisio 98.14
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 98.13
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 98.13
KOG4235244 consensus Mitochondrial thymidine kinase 2/deoxygu 98.13
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 98.13
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 98.12
PLN02293187 adenine phosphoribosyltransferase 98.12
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 98.11
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 98.11
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.11
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.1
COG4167267 SapF ABC-type antimicrobial peptide transport syst 98.1
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 98.1
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.1
COG3709192 Uncharacterized component of phosphonate metabolis 98.1
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 98.09
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 98.09
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 98.09
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 98.09
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 98.09
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 98.09
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 98.09
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 98.08
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 98.08
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 98.08
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 98.08
PRK11153343 metN DL-methionine transporter ATP-binding subunit 98.08
PRK10938490 putative molybdenum transport ATP-binding protein 98.08
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 98.07
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.07
PLN02772398 guanylate kinase 98.06
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 98.06
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 98.06
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.06
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 98.05
PRK09984262 phosphonate/organophosphate ester transporter subu 98.05
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 98.05
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 98.04
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 98.04
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 98.04
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 98.04
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 98.04
PRK10522547 multidrug transporter membrane component/ATP-bindi 98.04
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 98.04
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 98.03
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 98.02
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 98.02
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 98.02
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 98.02
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 98.02
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 98.01
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 98.01
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 98.01
COG3842352 PotA ABC-type spermidine/putrescine transport syst 98.01
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 98.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 98.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 98.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.99
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 97.99
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 97.99
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 97.99
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.99
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 97.98
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 97.98
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 97.98
COG4175386 ProV ABC-type proline/glycine betaine transport sy 97.98
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.98
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.98
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 97.97
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 97.97
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 97.97
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 97.96
PHA03132580 thymidine kinase; Provisional 97.95
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 97.95
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 97.95
PRK14241258 phosphate transporter ATP-binding protein; Provisi 97.95
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 97.95
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.94
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 97.94
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.93
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.93
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.93
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 97.93
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.93
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.93
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 97.92
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 97.92
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 97.92
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 97.91
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 97.91
PRK13811170 orotate phosphoribosyltransferase; Provisional 97.9
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 97.89
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 97.89
COG0645170 Predicted kinase [General function prediction only 97.89
COG1119257 ModF ABC-type molybdenum transport system, ATPase 97.88
PRK10790592 putative multidrug transporter membrane\ATP-bindin 97.88
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 97.87
COG1123539 ATPase components of various ABC-type transport sy 97.87
PRK13812176 orotate phosphoribosyltransferase; Provisional 97.87
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.87
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 97.87
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 97.86
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 97.86
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 97.86
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 97.86
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 97.86
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 97.85
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.85
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.85
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.84
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.84
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 97.84
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 97.84
COG1660286 Predicted P-loop-containing kinase [General functi 97.84
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 97.84
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 97.83
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 97.83
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.82
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 97.82
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.82
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.82
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.82
PRK14239252 phosphate transporter ATP-binding protein; Provisi 97.81
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.81
PRK13545549 tagH teichoic acids export protein ATP-binding sub 97.81
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 97.81
PRK14235267 phosphate transporter ATP-binding protein; Provisi 97.8
PRK10619257 histidine/lysine/arginine/ornithine transporter su 97.8
PRK07322178 adenine phosphoribosyltransferase; Provisional 97.8
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 97.8
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.8
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 97.8
COG4987573 CydC ABC-type transport system involved in cytochr 97.8
PRK14237267 phosphate transporter ATP-binding protein; Provisi 97.8
PRK06031233 phosphoribosyltransferase; Provisional 97.8
PRK14242253 phosphate transporter ATP-binding protein; Provisi 97.79
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.79
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 97.79
PHA00729226 NTP-binding motif containing protein 97.79
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 97.79
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.78
COG1129500 MglA ABC-type sugar transport system, ATPase compo 97.78
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.78
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 97.78
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 97.78
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 97.78
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 97.78
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.78
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.78
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 97.77
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 97.77
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 97.77
PRK14240250 phosphate transporter ATP-binding protein; Provisi 97.77
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.77
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 97.77
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.76
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 97.76
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 97.76
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.75
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 97.75
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.75
COG4615546 PvdE ABC-type siderophore export system, fused ATP 97.75
PRK14238271 phosphate transporter ATP-binding protein; Provisi 97.74
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.74
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.74
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 97.74
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.74
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 97.74
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 97.73
PRK10908222 cell division protein FtsE; Provisional 97.73
COG4639168 Predicted kinase [General function prediction only 97.73
PRK09580248 sufC cysteine desulfurase ATPase component; Review 97.73
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 97.73
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 97.73
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.72
PRK09473330 oppD oligopeptide transporter ATP-binding componen 97.72
cd03299235 ABC_ModC_like Archeal protein closely related to M 97.72
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 97.72
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.72
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.71
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 97.71
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 97.71
PRK14243264 phosphate transporter ATP-binding protein; Provisi 97.71
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.71
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 97.71
PRK09700510 D-allose transporter ATP-binding protein; Provisio 97.7
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.7
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 97.7
COG4988559 CydD ABC-type transport system involved in cytochr 97.7
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 97.7
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.69
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 97.69
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.69
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 97.69
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.69
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.69
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.68
PRK14236272 phosphate transporter ATP-binding protein; Provisi 97.68
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 97.68
COG4559259 ABC-type hemin transport system, ATPase component 97.68
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.68
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 97.67
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 97.67
COG1926220 Predicted phosphoribosyltransferases [General func 97.66
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 97.66
PRK08558238 adenine phosphoribosyltransferase; Provisional 97.65
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 97.65
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 97.65
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 97.65
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 97.64
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 97.64
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.64
cd03234226 ABCG_White The White subfamily represents ABC tran 97.64
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.64
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.63
PTZ002651466 multidrug resistance protein (mdr1); Provisional 97.62
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 97.62
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.62
PLN02840421 tRNA dimethylallyltransferase 97.62
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.62
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 97.62
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.62
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 97.61
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 97.61
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 97.61
PRK10253265 iron-enterobactin transporter ATP-binding protein; 97.6
PLN02297326 ribose-phosphate pyrophosphokinase 97.6
COG0411250 LivG ABC-type branched-chain amino acid transport 97.6
PLN032321495 ABC transporter C family member; Provisional 97.6
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 97.59
PLN02748468 tRNA dimethylallyltransferase 97.59
KOG3062281 consensus RNA polymerase II elongator associated p 97.58
COG2236192 Predicted phosphoribosyltransferases [General func 97.58
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 97.58
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.57
PLN03130 1622 ABC transporter C family member; Provisional 97.57
COG4136213 ABC-type uncharacterized transport system, ATPase 97.57
PRK11819556 putative ABC transporter ATP-binding protein; Revi 97.57
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.57
COG4152300 ABC-type uncharacterized transport system, ATPase 97.57
PRK10535 648 macrolide transporter ATP-binding /permease protei 97.57
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 97.57
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 97.56
PLN031301622 ABC transporter C family member; Provisional 97.56
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 97.56
smart00382148 AAA ATPases associated with a variety of cellular 97.56
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 97.55
PLN03232 1495 ABC transporter C family member; Provisional 97.55
PRK03695248 vitamin B12-transporter ATPase; Provisional 97.55
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.55
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 97.55
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.55
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.55
COG4181228 Predicted ABC-type transport system involved in ly 97.55
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.8e-69  Score=480.43  Aligned_cols=207  Identities=37%  Similarity=0.602  Sum_probs=199.1

Q ss_pred             cceeeccccceeeeeeeeeecCCCCchhhHHHHHHHHHHHHHHHHCCCCCeeeeecCCCCceeeeeEec-ceeeEEEeec
Q 035513          242 SNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFC-RRLCGISIIR  320 (473)
Q Consensus       242 ~~v~v~~~~~~~~~~~t~lRd~~t~~~~fr~~~~~l~~~l~~ea~~~l~~~~~~v~tp~~~~~~g~~~~-~~~~~v~ilr  320 (473)
                      .++++++| |+++|++|+|||++|++.+||++++||+++|+|||++++|+++++|+||++ +++|..+. +++|+|||||
T Consensus         2 ~~v~vi~h-pli~~~lt~lRdk~t~~~~Fr~~~~ei~~lL~yEa~~~l~~e~~~ieTP~~-~~~~~~~~~~~i~~V~ILR   79 (210)
T COG0035           2 MNVYVIDH-PLVKHKLTILRDKNTGTKEFRELLDEIGRLLAYEATRDLPLEKVEIETPLG-PTEGVQIAGKKIVIVPILR   79 (210)
T ss_pred             CceEEeCc-HHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHhCcCceeEEEEECCCc-ceeeeeecCCcEEEEEEee
Confidence            46788877 699999999999999999999999999999999999999999999999999 68888886 5599999999


Q ss_pred             cCchhHHHHHhhcCCceeeEEEEEEcCCCCc-eEEeecCCCCCCCcEEEEEcccccccHHHHHHHHHHHhcCCCCCcEEE
Q 035513          321 SGESMENALRACCKGIKIGKILIHREGNSGR-QLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIF  399 (473)
Q Consensus       321 aG~~~~~~~~~~~p~a~~g~i~~~r~~~~~~-~~~~~~lP~~~~~~~v~l~dp~~aTG~t~~~~~~~L~~~g~~~~~i~~  399 (473)
                      ||++|++|+.+++|+|++|||+++||++|++ ..||.|||++++++.|+|+|||+|||+|+++|++.|+++| .+++|++
T Consensus        80 AGl~m~~gl~~~~P~a~vG~ig~~Rdeet~~p~~yy~KLP~~~~~~~viv~DPMLATG~s~i~ai~~L~~~G-~~~~I~~  158 (210)
T COG0035          80 AGLGMVEGLLKLIPSARVGHIGIYRDEETLEPVLYYEKLPEDIDERTVIVLDPMLATGGSAIAAIDLLKKRG-GPKNIKV  158 (210)
T ss_pred             ccccHHHHHHHhCCcceEEEEEEEecCccCceehhHHhCCCcccCCeEEEECchhhccHhHHHHHHHHHHhC-CCceEEE
Confidence            9999999999999999999999999999985 8999999999999999999999999999999999999997 6799999


Q ss_pred             EEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCcceecCCCchhhhccCCC
Q 035513          400 LNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTD  451 (473)
Q Consensus       400 ~~~~~~~~g~~~~~~~~p~v~i~~~~id~~l~~~~~i~PGlGd~gdr~fg~~  451 (473)
                      +|++|+|+|++++.++||+|+||||+||++|||+|||+|||||||||+|||+
T Consensus       159 v~~vAapeGi~~v~~~~p~v~I~ta~iD~~Lne~gYIvPGLGDaGDR~fGt~  210 (210)
T COG0035         159 VSLVAAPEGIKAVEKAHPDVEIYTAAIDEGLNEKGYIVPGLGDAGDRLFGTK  210 (210)
T ss_pred             EEEEecHHHHHHHHHhCCCCeEEEEEeccccccCCCCccCCCcccccccCCC
Confidence            9999999999999999999999999999999999999999999999999985

>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
1xrj_A261 Rapid Structure Determination Of Human Uridine-Cyti 5e-64
1udw_A252 Crystal Structure Of Human Uridine-cytidine Kinase 5e-64
2jeo_A245 Crystal Structure Of Human Uridine-Cytidine Kinase 9e-61
1bd3_D243 Structure Of The Apo Uracil Phosphoribosyltransfera 4e-57
1upu_D224 Structure Of The Uracil Phosphoribosyltransferase, 2e-56
3asy_A211 Ligand-Free Structure Of Uridine Kinase From Thermu 2e-48
1i5e_A209 Crystal Structure Of Bacillus Caldolyticus Uracil P 9e-24
3dmp_A217 2.6 A Crystal Structure Of Uracil Phosphoribosyltra 2e-23
1v9s_A208 Crystal Structure Of Tt0130 Protein From Thermus Th 2e-20
1o5o_A221 Crystal Structure Of Uracil Phosphoribosyltransfera 2e-19
2ehj_A208 Structure Of Uracil Phosphoribosyl Transferase Leng 7e-18
2e55_A208 Structure Of Aq2163 Protein From Aquifex Aeolicus L 4e-11
3tqc_A321 Structure Of The Pantothenate Kinase (Coaa) From Co 1e-08
1xtt_A216 Sulfolobus Solfataricus Uracil Phosphoribosyltransf 4e-08
1esm_A316 Structural Basis For The Feedback Regulation Of Esc 7e-06
1sq5_A308 Crystal Structure Of E. Coli Pantothenate Kinase Le 7e-06
1rz3_A201 Structure Of A Possible Uridine Kinase From Bacillu 1e-05
3avo_A322 Pantothenate Kinase From Mycobacterium Tuberculosis 2e-05
2zs7_A312 Pantothenate Kinase From Mycobacterium Tuberculosis 2e-05
2ges_A312 Pantothenate Kinase From Mycobacterium Tuberculosis 2e-05
>pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261 Back     alignment and structure 
Iteration: 1

 Score =  241 bits (616), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 153/207 (73%), Gaps = 9/207 (4%)
Query: 31  QPFVIGVAGGTASGKTTVCNMIISRL-------RDQRVVLVNQDSFYHSLTDE-KLQNLH 82
           +PF+IGV+GGTASGK++VC  I+  L       R ++VV+++QDSFY  LT E K + L 
Sbjct: 19  EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALK 78
Query: 83  -DYNFDHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGIL 141
             +NFDHPDAFD EL+L  ++++  G+ V IP YDF SH RK+++  + P+DV + EGIL
Sbjct: 79  GQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGIL 138
Query: 142 VLHDPRVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFIL 201
             +   VRDL  MK+FVDTD+D RLSRR+ RD  ERGRD+E +L QY  FVKP+FEEF L
Sbjct: 139 AFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCL 198
Query: 202 PSKKYADIIIPRGGDNDVAIDLIVQHI 228
           P+KKYAD+IIPRG DN VAI+LIVQHI
Sbjct: 199 PTKKYADVIIPRGADNLVAINLIVQHI 225
>pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252 Back     alignment and structure
>pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245 Back     alignment and structure
>pdb|1BD3|D Chain D, Structure Of The Apo Uracil Phosphoribosyltransferase, 2 Mutant C128v Length = 243 Back     alignment and structure
>pdb|1UPU|D Chain D, Structure Of The Uracil Phosphoribosyltransferase, Mutant C128v, Bound To Product Uridine-1-Monophosphate (Ump) Length = 224 Back     alignment and structure
>pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211 Back     alignment and structure
>pdb|1I5E|A Chain A, Crystal Structure Of Bacillus Caldolyticus Uracil Phosphoribosyltransferase With Bound Ump Length = 209 Back     alignment and structure
>pdb|3DMP|A Chain A, 2.6 A Crystal Structure Of Uracil Phosphoribosyltransferase From Burkholderia Pseudomallei Length = 217 Back     alignment and structure
>pdb|1V9S|A Chain A, Crystal Structure Of Tt0130 Protein From Thermus Thermophilus Hb8 Length = 208 Back     alignment and structure
>pdb|1O5O|A Chain A, Crystal Structure Of Uracil Phosphoribosyltransferase (Tm0721) From Thermotoga Maritima At 2.30 A Resolution Length = 221 Back     alignment and structure
>pdb|2EHJ|A Chain A, Structure Of Uracil Phosphoribosyl Transferase Length = 208 Back     alignment and structure
>pdb|2E55|A Chain A, Structure Of Aq2163 Protein From Aquifex Aeolicus Length = 208 Back     alignment and structure
>pdb|3TQC|A Chain A, Structure Of The Pantothenate Kinase (Coaa) From Coxiella Burnetii Length = 321 Back     alignment and structure
>pdb|1XTT|A Chain A, Sulfolobus Solfataricus Uracil Phosphoribosyltransferase In Complex With Uridine 5'-Monophosphate (Ump) Length = 216 Back     alignment and structure
>pdb|1ESM|A Chain A, Structural Basis For The Feedback Regulation Of Escherichia Coli Pantothenate Kinase By Coenzyme A Length = 316 Back     alignment and structure
>pdb|1SQ5|A Chain A, Crystal Structure Of E. Coli Pantothenate Kinase Length = 308 Back     alignment and structure
>pdb|1RZ3|A Chain A, Structure Of A Possible Uridine Kinase From Bacillus Stearothermophilus Length = 201 Back     alignment and structure
>pdb|3AVO|A Chain A, Pantothenate Kinase From Mycobacterium Tuberculosis (Mtpank) In Complex With Pantothenate Length = 322 Back     alignment and structure
>pdb|2ZS7|A Chain A, Pantothenate Kinase From Mycobacterium Tuberculosis (mtpank) In Complex With Citrate Anion Length = 312 Back     alignment and structure
>pdb|2GES|A Chain A, Pantothenate Kinase From Mycobacterium Tuberculosis (Mtpank) In Complex With A Coenzyme A Derivative, Form-I (Rt) Length = 312 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 1e-106
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 2e-97
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 4e-96
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 1e-83
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 3e-74
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 1e-71
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 1e-69
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 2e-69
2e55_A208 Uracil phosphoribosyltransferase; structural genom 8e-69
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 1e-68
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 3e-65
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 7e-63
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 9e-60
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 2e-59
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 2e-58
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 6e-57
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 2e-56
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 1e-53
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 9e-06
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 3e-05
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 3e-04
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 4e-04
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 5e-04
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
 Score =  314 bits (808), Expect = e-106
 Identities = 94/208 (45%), Positives = 132/208 (63%), Gaps = 1/208 (0%)

Query: 27  MPTKQPFVIGVAGGTASGKTTVCNMIISRLRDQRVVLVNQDSFYHSLTDEKLQNLHDYNF 86
           M   +PFVIG+AGGTASGKTT+   +   L  +RV L+  D +Y  L    L+     N+
Sbjct: 1   MSAPKPFVIGIAGGTASGKTTLAQALARTL-GERVALLPMDHYYKDLGHLPLEERLRVNY 59

Query: 87  DHPDAFDTELLLSDMEKLKHGQAVSIPDYDFKSHKRKQQSRLINPSDVFILEGILVLHDP 146
           DHPDAFD  L L   + L  G  V +P YDF+++ R  +   + P+ V ILEGILVL+  
Sbjct: 60  DHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAYTRSPRRTPVRPAPVVILEGILVLYPK 119

Query: 147 RVRDLMSMKIFVDTDSDVRLSRRIQRDTVERGRDIEDVLDQYARFVKPSFEEFILPSKKY 206
            +RDLM +K+FVD D+D R  RR++RD +ERGR +E V+ QY   VKP    F+ P+K+Y
Sbjct: 120 ELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRY 179

Query: 207 ADIIIPRGGDNDVAIDLIVQHILTKLGQ 234
           AD+I+PRGG N VA++++    L +L +
Sbjct: 180 ADVIVPRGGQNPVALEMLAAKALARLAR 207
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Length = 243 Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Length = 217 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Length = 209 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Length = 208 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Length = 221 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Length = 208 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Length = 216 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Length = 230 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Length = 223 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Length = 184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 100.0
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 100.0
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 100.0
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 100.0
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 100.0
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 100.0
2e55_A208 Uracil phosphoribosyltransferase; structural genom 100.0
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 100.0
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.9
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.88
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.88
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.87
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.85
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.83
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.79
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.79
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 99.75
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.75
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.71
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.66
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.65
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.64
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.58
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.52
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.51
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.48
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.46
3vaa_A199 Shikimate kinase, SK; structural genomics, center 99.45
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.41
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.39
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.39
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.39
3r20_A233 Cytidylate kinase; structural genomics, seattle st 99.37
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.36
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.36
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.36
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 99.36
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.34
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 99.33
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 99.31
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 99.3
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 99.3
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 99.28
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.28
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 99.27
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 99.26
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 99.25
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 99.25
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 99.22
1via_A175 Shikimate kinase; structural genomics, transferase 99.2
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 99.2
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 99.2
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.19
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 99.19
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 99.18
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 99.18
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 99.17
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.17
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 99.16
3tlx_A243 Adenylate kinase 2; structural genomics, structura 99.15
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.13
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 99.13
1kag_A173 SKI, shikimate kinase I; transferase, structural g 99.12
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.12
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 99.12
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.11
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 99.1
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.09
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 99.09
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.08
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.08
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.08
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.07
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 99.06
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 99.06
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 99.06
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.05
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 99.04
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 99.04
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 99.04
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 99.03
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.03
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 99.02
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 99.01
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 99.01
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 99.0
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 99.0
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.98
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.97
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.96
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 98.95
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.93
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.92
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 98.91
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 98.91
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 98.91
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 98.91
1vdm_A153 Purine phosphoribosyltransferase; structural genom 98.9
1wd5_A208 Hypothetical protein TT1426; structural genomics, 98.89
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 98.88
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.88
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 98.87
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.87
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.84
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 98.83
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 98.83
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 98.83
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.79
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.77
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 98.75
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 98.75
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.75
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 98.74
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.72
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 98.72
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 98.72
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 98.7
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 98.7
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.69
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 98.69
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 98.66
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 98.66
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.66
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 98.66
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.66
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 98.65
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 98.64
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.64
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.64
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.62
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 98.62
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.59
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 98.58
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 98.52
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 98.52
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 98.52
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.51
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.51
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 98.5
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 98.49
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 98.48
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 98.47
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 98.46
1ji0_A240 ABC transporter; ATP binding protein, structural g 98.44
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 98.44
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 98.43
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 98.43
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 98.43
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 98.43
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 98.42
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 98.42
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.42
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 98.41
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 98.41
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 98.41
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 98.41
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.41
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.4
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 98.38
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.37
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 98.36
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 98.36
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 98.35
1g6h_A257 High-affinity branched-chain amino acid transport 98.34
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 98.33
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.33
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 98.32
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.31
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 98.31
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 98.31
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 98.29
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 98.29
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 98.28
1sgw_A214 Putative ABC transporter; structural genomics, P p 98.23
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 98.23
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 98.22
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 98.21
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 98.2
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 98.19
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 98.19
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 98.19
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 98.18
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 98.16
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 98.15
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 98.14
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.14
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 98.13
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.13
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 98.13
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 98.11
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.1
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 98.09
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 98.07
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 98.06
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 98.05
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 98.03
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 98.02
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.99
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.99
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.98
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 97.97
1vch_A175 Phosphoribosyltransferase-related protein; structu 97.97
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 97.95
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 97.93
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 97.91
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.9
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 97.88
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 97.87
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 97.83
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.83
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.83
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.81
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.81
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 97.81
2ghi_A260 Transport protein; multidrug resistance protein, M 97.79
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.79
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.74
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.73
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 97.71
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.71
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 97.7
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 97.69
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 97.68
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 97.67
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 97.64
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 97.62
1o57_A291 PUR operon repressor; purine operon repressor, hel 97.6
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.59
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 97.55
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.44
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransf; 97.41
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 97.34
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 97.34
3czq_A304 Putative polyphosphate kinase 2; structural genomi 97.33
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.33
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.3
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 97.26
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.26
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.26
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.25
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 97.21
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.18
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.15
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.08
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.05
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 97.05
1xjc_A169 MOBB protein homolog; structural genomics, midwest 97.04
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.04
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.0
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 97.0
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.95
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.93
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.91
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.9
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.88
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.88
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.84
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.84
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.84
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.83
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.82
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.81
2og2_A359 Putative signal recognition particle receptor; nuc 96.8
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 96.78
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 96.75
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.72
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.72
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.68
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.68
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 96.68
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.64
1kjw_A295 Postsynaptic density protein 95; protein-protein i 96.64
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.63
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.61
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.59
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.51
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.48
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.47
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 96.46
1p9r_A418 General secretion pathway protein E; bacterial typ 96.43
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.41
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.41
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 96.39
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 96.36
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.35
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.34
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 96.32
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.32
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 96.3
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 96.3
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.27
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.27
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.26
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.25
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.24
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 96.23
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 96.23
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.22
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 96.16
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 96.1
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 96.1
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 96.09
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 96.09
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.09
3kta_A182 Chromosome segregation protein SMC; structural mai 96.06
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 96.05
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.02
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 96.01
3bos_A242 Putative DNA replication factor; P-loop containing 95.99
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.98
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.98
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 95.98
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 95.94
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.94
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.93
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.84
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.83
2xxa_A433 Signal recognition particle protein; protein trans 95.83
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.82
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.82
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.8
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.78
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.77
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.76
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.75
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 95.75
4aby_A415 DNA repair protein RECN; hydrolase, double strand 95.69
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.67
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 95.65
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 95.62
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 95.62
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.62
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.61
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 95.59
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.58
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.56
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 95.54
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.54
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.52
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 95.49
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 95.49
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 95.48
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 95.48
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.46
2xkx_A721 Disks large homolog 4; structural protein, scaffol 95.45
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.45
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.4
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 95.39
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 95.39
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 95.38
2oap_1511 GSPE-2, type II secretion system protein; hexameri 95.38
1tue_A212 Replication protein E1; helicase, replication, E1E 95.32
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.3
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.29
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.29
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.29
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 95.27
3ice_A422 Transcription termination factor RHO; transcriptio 95.27
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 95.25
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.24
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.23
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 95.23
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.21
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 95.18
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.17
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.17
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 95.16
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 95.15
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 95.15
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.14
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 95.07
1nrj_B218 SR-beta, signal recognition particle receptor beta 95.06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.04
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 95.03
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 95.02
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.01
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.0
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 94.98
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 94.98
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 94.96
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 94.93
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 94.93
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 94.92
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 94.92
2wji_A165 Ferrous iron transport protein B homolog; membrane 94.89
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 94.88
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 94.88
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.88
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.83
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.81
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 94.81
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 94.79
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 94.78
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.77
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.77
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 94.76
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 94.76
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.73
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.72
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.72
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.71
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.71
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 94.7
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.69
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.66
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 94.66
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 94.65
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 94.63
3co5_A143 Putative two-component system transcriptional RES 94.63
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 94.62
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 94.6
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 94.58
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 94.58
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 94.56
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 94.55
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.55
3fwy_A314 Light-independent protochlorophyllide reductase I 94.53
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.52
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.5
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 94.48
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 94.47
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 94.46
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 94.45
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 94.43
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 94.43
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 94.43
2ged_A193 SR-beta, signal recognition particle receptor beta 94.43
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.42
3end_A307 Light-independent protochlorophyllide reductase ir 94.42
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.41
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 94.4
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.39
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.37
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 94.37
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 94.36
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.32
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.32
3pvs_A447 Replication-associated recombination protein A; ma 94.31
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 94.31
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 94.3
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 94.29
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 94.29
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 94.28
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 94.27
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 94.25
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 94.24
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 94.23
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.22
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 94.22
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 94.19
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 94.18
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.18
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 94.16
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 94.16
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.15
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 94.14
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.12
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.11
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 94.1
3lxw_A247 GTPase IMAP family member 1; immunity, structural 94.1
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.09
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 94.08
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 94.04
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 94.03
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 94.02
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 94.02
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.99
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 93.98
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 93.98
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 93.98
2z43_A324 DNA repair and recombination protein RADA; archaea 93.97
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 93.97
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.95
3lxx_A239 GTPase IMAP family member 4; structural genomics c 93.94
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 93.93
2r44_A331 Uncharacterized protein; putative ATPase, structur 93.92
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 93.92
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.91
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 93.9
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 93.89
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 93.89
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 93.88
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 93.87
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 93.87
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 93.87
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.87
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 93.86
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.86
1u94_A356 RECA protein, recombinase A; homologous recombinat 93.86
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.86
2qgz_A308 Helicase loader, putative primosome component; str 93.86
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 93.84
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 93.82
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 93.76
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.72
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 93.72
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 93.71
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 93.71
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
Probab=100.00  E-value=1e-63  Score=461.78  Aligned_cols=208  Identities=30%  Similarity=0.532  Sum_probs=200.0

Q ss_pred             ccceeeccccceeeeeeeeeecCCCCchhhHHHHHHHHHHHHHHHHCCCCCeeeeecCCCCceeeeeEec-ceeeEEEee
Q 035513          241 YSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFC-RRLCGISII  319 (473)
Q Consensus       241 ~~~v~v~~~~~~~~~~~t~lRd~~t~~~~fr~~~~~l~~~l~~ea~~~l~~~~~~v~tp~~~~~~g~~~~-~~~~~v~il  319 (473)
                      ..++|+++| |+++|++|+|||++|++.+||++++||+++|+|||+++||+++++|+||+| .+.|.++. +++|+||||
T Consensus         8 ~~~v~v~~h-p~i~~~lt~lRd~~t~~~~Fr~~~~rl~~lL~yEa~~~lp~~~~~V~TP~g-~~~g~~~~~~~i~~V~Il   85 (217)
T 3dmp_A            8 FPNLFILDH-PLIQHKLTHMRDKDTSTRTFRELLREITLLMGYEITRNLPITTKRVETPLV-EIDAPVIAGKKLAIVPVL   85 (217)
T ss_dssp             CTTEEEECC-HHHHHHHHHHHCTTSCHHHHHHHHHHHHHHHHHHHTTTCCEEEEEEECSSC-EEEEEEECGGGEEEEEEE
T ss_pred             CCCeEecCC-HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHhcCCceeEEEECCCe-EEEEEEecCCcEEEEEec
Confidence            468999876 799999999999999999999999999999999999999999999999999 68999986 899999999


Q ss_pred             ccCchhHHHHHhhcCCceeeEEEEEEcCCCCceEEeecCCCCCCCcEEEEEcccccccHHHHHHHHHHHhcCCCCCcEEE
Q 035513          320 RSGESMENALRACCKGIKIGKILIHREGNSGRQLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIF  399 (473)
Q Consensus       320 raG~~~~~~~~~~~p~a~~g~i~~~r~~~~~~~~~~~~lP~~~~~~~v~l~dp~~aTG~t~~~~~~~L~~~g~~~~~i~~  399 (473)
                      |+|++|++++++++|++++|+|+++||+.|.+..||.++| +++++.|||+|||+|||+|+++|++.|+++|+++++|++
T Consensus        86 RaG~~m~~~l~~~ip~a~vg~i~~~Rd~~t~p~~~~~~lP-~i~~~~VilvD~~laTG~T~~~ai~~L~~~G~pe~~I~~  164 (217)
T 3dmp_A           86 RAGVGMSDGLLELIPSARVGHIGVYRADDHRPVEYLVRLP-DLEDRIFILCDPMVATGYSAAHAIDVLKRRGVPGERLMF  164 (217)
T ss_dssp             TTTHHHHHHHHHHCTTSEECEEECSCCCSSSCCCSEEECC-CCTTCEEEEECSEESSSHHHHHHHHHHHTTTCCGGGEEE
T ss_pred             ccchHHHHHHHHhCcCCceeEEEEEECCCCCcEEEeecCC-CCCCCEEEEEcCcccccHHHHHHHHHHHHcCCCcCeEEE
Confidence            9999999999999999999999999999986688999999 999999999999999999999999999999998899999


Q ss_pred             EEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCcceecCCCchhhhccCCC
Q 035513          400 LNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGTD  451 (473)
Q Consensus       400 ~~~~~~~~g~~~~~~~~p~v~i~~~~id~~l~~~~~i~PGlGd~gdr~fg~~  451 (473)
                      +|++|+|+|++++.++||+|+||||+||++|||+|||+|||||||||||||+
T Consensus       165 ~~~vaa~egl~~l~~~~P~v~i~ta~iD~~Lne~~yIvPGlGDaGDR~fgt~  216 (217)
T 3dmp_A          165 LALVAAPEGVQVFQDAHPDVKLYVASLDSHLDDHAYIVPGLGDAGDRLFGTK  216 (217)
T ss_dssp             ECSEECHHHHHHHHHHCTTCEEEESEECCEECTTSCEESSCSCHHHHHHC--
T ss_pred             EEEEeCHHHHHHHHHHCCCCEEEEEEecCCcCCCCCccCCCCCHHHhhcCCC
Confidence            9999999999999999999999999999999999999999999999999996
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d1bd3a_224 c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondi 2e-70
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 2e-61
d1i5ea_208 c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldoly 2e-59
d1v9sa1208 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus the 4e-57
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 2e-55
d1o5oa_210 c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga marit 3e-55
d1xtta1215 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus 3e-51
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 1e-43
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 4e-28
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 2e-18
d2vp4a1197 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fr 2e-14
d1jjva_205 c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus in 2e-11
d1uf9a_191 c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermo 2e-11
d1vhta_208 c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia co 2e-10
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 2e-10
d1p6xa_333 c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus 1e-04
d1e2ka_329 c.37.1.1 (A:) Thymidine kinase {Herpes simplex vir 1e-04
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 2e-04
d1deka_241 c.37.1.1 (A:) Deoxynucleoside monophosphate kinase 5e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 8e-04
d1wd5a_208 c.61.1.1 (A:) Putative phosphoribosyltransferase T 0.001
d1vmaa2213 c.37.1.10 (A:82-294) GTPase domain of the signal r 0.001
d1j8yf2211 c.37.1.10 (F:87-297) GTPase domain of the signal s 0.001
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 0.002
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 0.004
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Uracil PRTase, Upp
species: Toxoplasma gondii [TaxId: 5811]

 Score =  220 bits (563), Expect = 2e-70
 Identities = 108/217 (49%), Positives = 154/217 (70%), Gaps = 1/217 (0%)

Query: 235 HDLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEK 294
            D+   + NV ++  T Q+R M T+IRD  T   +FVFYADRLIRL++E  L  LPF +K
Sbjct: 7   QDIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKK 66

Query: 295 QIITPTGSVYTGVVFCRRLCGISIIRSGESMENALRACCKGIKIGKILIHREGNSGR-QL 353
           ++ TP    Y GV F  ++CG+SI+R+GESME+ LRA C+G++IGKILI R+  +   +L
Sbjct: 67  EVTTPLDVSYHGVSFYSKICGVSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKL 126

Query: 354 IYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPESNIIFLNLIAAPQGIHAIC 413
           IY+KLPADI  R V+LLDP+ A+  S  KAI ++L  GV E  IIF+N++AAPQGI  + 
Sbjct: 127 IYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKEERIIFVNILAAPQGIERVF 186

Query: 414 KRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGT 450
           K +PK+++VT+ +D  ++    ++PG+G+FGDRYFGT
Sbjct: 187 KEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT 223
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Length = 208 Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Length = 210 Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Length = 215 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 197 Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Length = 205 Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Length = 191 Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Length = 208 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Length = 333 Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Length = 329 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Length = 241 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Length = 213 Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 100.0
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 100.0
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 100.0
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 100.0
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 100.0
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.96
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.95
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.92
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.74
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.7
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.64
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.62
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.61
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 99.35
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.34
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.33
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 99.26
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.25
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 99.25
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 99.24
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 99.22
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 99.21
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.21
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.2
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 99.19
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.18
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 99.12
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.12
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.11
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.11
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 99.09
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.08
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.08
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.06
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 99.0
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.99
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.95
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.94
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 98.94
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.93
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.89
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 98.87
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 98.86
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.85
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 98.83
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.82
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 98.81
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.8
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.8
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 98.76
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 98.75
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.75
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.75
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 98.73
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.72
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 98.71
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.71
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.71
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.71
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 98.7
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.7
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 98.7
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 98.7
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.69
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.63
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 98.61
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.61
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.58
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 98.56
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.56
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.56
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 98.56
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.56
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 98.55
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 98.55
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.54
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.53
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 98.53
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 98.53
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.51
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 98.49
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.47
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 98.44
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 98.43
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.42
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 98.4
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 98.4
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.38
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 98.33
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 98.23
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 98.23
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 98.22
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 98.21
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 98.12
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 98.12
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 98.1
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 98.09
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.07
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 97.98
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 97.82
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.82
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 97.76
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.73
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 97.67
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.6
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 97.57
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.56
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 97.55
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 97.54
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.48
d1vmaa2213 GTPase domain of the signal recognition particle r 97.46
d2qy9a2211 GTPase domain of the signal recognition particle r 97.42
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.38
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.35
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 97.28
d1okkd2207 GTPase domain of the signal recognition particle r 97.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.15
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.06
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 97.06
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.01
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 97.01
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 96.76
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.75
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 96.68
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.68
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.65
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.51
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.5
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.45
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.42
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 96.39
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.35
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.33
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.16
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.14
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 96.07
d1svma_362 Papillomavirus large T antigen helicase domain {Si 96.03
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 96.01
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.94
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.94
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.82
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.76
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.69
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.63
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 95.57
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.53
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.5
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.47
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.45
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.39
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 95.36
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.29
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.04
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 94.96
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.9
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.9
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.88
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 94.85
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.83
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.76
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.72
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.58
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.57
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.55
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.53
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 94.52
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.49
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.48
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.43
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.36
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 94.32
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.3
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 94.3
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 94.28
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 94.18
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.14
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.14
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.08
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 94.05
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 94.01
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.0
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.98
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 93.98
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.97
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.91
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.88
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.88
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.82
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.8
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.78
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 93.77
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.64
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.61
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.53
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.49
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.49
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 93.48
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.47
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 93.42
d2fh5b1207 Signal recognition particle receptor beta-subunit 93.31
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.22
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.21
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.18
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.15
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.14
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 93.07
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.02
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.99
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.97
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.97
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.96
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.95
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 92.9
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.9
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.82
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 92.81
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.8
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.8
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.72
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.71
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.71
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.71
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.63
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.55
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.53
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.52
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.5
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.44
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.26
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.23
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.19
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.08
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.01
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 91.93
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.86
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.8
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.77
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.75
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.72
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 91.72
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.67
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.67
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 91.57
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.52
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.5
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 91.37
d1tuea_205 Replication protein E1 helicase domain {Human papi 91.26
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 91.05
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 91.02
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.02
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 90.94
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.87
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.81
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.61
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.33
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 90.33
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.2
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 90.2
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.92
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.87
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 89.79
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 89.51
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.25
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 89.22
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.21
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 89.09
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 88.95
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 88.4
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 88.39
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 88.24
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 88.21
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 88.16
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 88.08
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 88.03
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 88.0
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.87
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 87.67
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 87.48
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 87.42
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 87.34
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.26
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.13
d1xpua3289 Transcription termination factor Rho, ATPase domai 86.06
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.04
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 84.8
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 84.69
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 83.87
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 83.63
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 83.5
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 82.95
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 82.92
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 82.21
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 81.9
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 80.9
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 80.58
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 80.55
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 80.11
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Uracil PRTase, Upp
species: Toxoplasma gondii [TaxId: 5811]

Probab=100.00  E-value=3.8e-69  Score=498.11  Aligned_cols=215  Identities=50%  Similarity=0.939  Sum_probs=208.2

Q ss_pred             cccccccceeeccccceeeeeeeeeecCCCCchhhHHHHHHHHHHHHHHHHCCCCCeeeeecCCCCceeeeeEecceeeE
Q 035513          236 DLCKIYSNVDVIVSTFQIRGMHTLIRDVTTTTHDFVFYADRLIRLVVEHGLGHLPFTEKQIITPTGSVYTGVVFCRRLCG  315 (473)
Q Consensus       236 ~l~~~~~~v~v~~~~~~~~~~~t~lRd~~t~~~~fr~~~~~l~~~l~~ea~~~l~~~~~~v~tp~~~~~~g~~~~~~~~~  315 (473)
                      ++...++|+++++++|++++++|+|||++|++.+||++++||+++|+|||++++|+++++|+||+|.++.|..+.+++|+
T Consensus         8 ~~~~r~pnv~vl~~~p~i~~~lTiLRd~~T~~~~Fr~~~~ri~~lL~yEa~~~l~~~~~~V~TPlg~~~~~~~~~~~v~~   87 (224)
T d1bd3a_           8 DIITRFPNVVLMKQTAQLRAMMTIIRDKETPKEEFVFYADRLIRLLIEEALNELPFQKKEVTTPLDVSYHGVSFYSKICG   87 (224)
T ss_dssp             HHHHHCTTEEECCCCHHHHHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHTTSCBCCEEEECTTSCEEEECCBCCCEEE
T ss_pred             HHHhhCCCeEEeCCCHHHHHHHHHhHCCCCChHHHHHHHHHHHHHHHHHHHhccCceEEEEECCCcccccceecCCceEE
Confidence            34456789999999999999999999999999999999999999999999999999999999999988888888899999


Q ss_pred             EEeeccCchhHHHHHhhcCCceeeEEEEEEcCCCCc-eEEeecCCCCCCCcEEEEEcccccccHHHHHHHHHHHhcCCCC
Q 035513          316 ISIIRSGESMENALRACCKGIKIGKILIHREGNSGR-QLIYQKLPADISSRHVLLLDPILASGNSAVKAISLILSKGVPE  394 (473)
Q Consensus       316 v~ilraG~~~~~~~~~~~p~a~~g~i~~~r~~~~~~-~~~~~~lP~~~~~~~v~l~dp~~aTG~t~~~~~~~L~~~g~~~  394 (473)
                      |||||||++|++|+++++|+|++|||+++||+.|.+ ..||.++|++++++.|||+|||+|||+|+++|++.|+++|+++
T Consensus        88 V~ILRAGl~m~~g~~~~~p~a~~g~i~~~Rde~t~~p~~~y~klP~~i~~~~vil~DPmLATG~S~~~ai~~L~~~g~~~  167 (224)
T d1bd3a_          88 VSIVRAGESMESGLRAVCRGVRIGKILIQRDETTAEPKLIYEKLPADIRERWVMLLDPMCATAGSVCKAIEVLLRLGVKE  167 (224)
T ss_dssp             EEEETGGGGGHHHHHHHSTTCCEEEEEEEECTTTCCEEEEEEECCTTGGGSEEEEECSEESSCHHHHHHHHHHHHTTCCG
T ss_pred             EeeecccchhhhhHHhhCCCccceeeeeccccCCCCceeeHhhCCCccccceEEEeChHHhcchHHHHHHHHHHHcCCCc
Confidence            999999999999999999999999999999999875 8999999999999999999999999999999999999999999


Q ss_pred             CcEEEEEEEeCHHHHHHHHHhCCCcEEEEEeecCCCCCCcceecCCCchhhhccCC
Q 035513          395 SNIIFLNLIAAPQGIHAICKRFPKIKIVTSEIDSSIDEHACVIPGMGEFGDRYFGT  450 (473)
Q Consensus       395 ~~i~~~~~~~~~~g~~~~~~~~p~v~i~~~~id~~l~~~~~i~PGlGd~gdr~fg~  450 (473)
                      ++|+++|++|||+|++++.++||+++||||+||++||++|||+|||||||||||||
T Consensus       168 ~~I~~v~~iaa~~Gi~~l~~~~P~v~i~ta~ID~~Ln~~~yIvPGlGDaGDR~fGT  223 (224)
T d1bd3a_         168 ERIIFVNILAAPQGIERVFKEYPKVRMVTAAVDICLNSRYYIVPGIGDFGDRYFGT  223 (224)
T ss_dssp             GGEEEEEEEECHHHHHHHHHHCTTCEEEEEEECSEECTTSCEESCCSCHHHHHHTC
T ss_pred             ceEEEEEEEecHHHHHHHHHHCcCCEEEEEEECcccCCCCccCCCCCcHHHhhcCC
Confidence            99999999999999999999999999999999999999999999999999999998
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure