Citrus Sinensis ID: 036732

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MWNFASTCLAGNVGLKNDSLKASEAASECSDDDVSSVVSREESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMNGDRVKSHSGFCEDRQPASSSSGSSTFGNQLNRGNHRRGQHHHHYHHHPEPAGSNRDHLHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccccc
cccHHHHHHHccccccccccccccccccccccccccccccccccccccEcccccccccccEEEccccHHHHHHHHHHHHHHcccccccccccEEEEccccccEEEEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccc
mwnfastclagnvglkndslkaseaasecsdddvssvvsreeslecpicwesfnmvenvpyVLWCGHTLCKNCILGLQWAvvkfptlpvqlplfiscpwcnllSFRVVYkgnlkfprkNYFLLWMVESmngdrvkshsgfcedrqpassssgsstfgnqlnrgnhrrgqhhhhyhhhpepagsnrdhlhatnyLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFaypsldwl
mwnfastclagnvglKNDSLKASEAasecsdddvssvvsrEESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMNGDRVKSHSGFCEDRqpassssgsstfGNQLNRGNHRRGQHHHHYHHHPEPAGSNRDHLHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
MWNFASTCLAGNVGLKNDSLKaseaasecsdddvssvvsreesLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMNGDRVKSHSGFCEDRQPAssssgssTFGNQLNRGNHRRGQhhhhyhhhPEPAGSNRDHLHATNYLTVERIHSSLRKSLIFFVHLTAKFPlvvifllivvYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
******TCLAGN*******************************LECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESM**********************************************************LHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDW*
********************************************ECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLW******************************************************************TNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
MWNFASTCLAGNVGLKNDS************************LECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMNGDR***********************GNQLNRG********************NRDHLHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
******************************************SLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMN********************************************************HLHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiii
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWNFASTCLAGNVGLKNDSLKASEAASECSDDDVSSVVSREESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMNGDRVKSHSGFCEDRQPASSSSGSSTFGNQLNRGNHRRGQHHHHYHHHPEPAGSNRDHLHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILALYILVTILFALPSFLILYFAYPSLDWL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query266 2.2.26 [Sep-21-2011]
Q13049 653 E3 ubiquitin-protein liga yes no 0.199 0.081 0.349 6e-05
Q8CH72 655 E3 ubiquitin-protein liga yes no 0.199 0.080 0.349 7e-05
Q9H0X6261 RING finger protein 208 O no no 0.195 0.199 0.383 0.0003
Q8K0W3265 RING finger protein 208 O no no 0.240 0.241 0.347 0.0003
Q9FY48 1625 E3 ubiquitin-protein liga no no 0.278 0.045 0.302 0.0008
>sp|Q13049|TRI32_HUMAN E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens GN=TRIM32 PE=1 SV=2 Back     alignment and function desciption
 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 10/63 (15%)

Query: 42  ESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCN 101
           E LECPIC ESF   +  P +L CGHT+C+ C+  L  + +            + CP+C+
Sbjct: 16  EVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSIN----------GVRCPFCS 65

Query: 102 LLS 104
            ++
Sbjct: 66  KIT 68
Has an E3 ubiquitin ligase activity. Ubiquitinates DTNBP1 (dysbindin) and promotes its degradation. May play a significant role in mediating the biological activity of the HIV-1 Tat protein in vivo. Binds specifically to the activation domain of HIV-1 Tat and can also interact with the HIV-2 and EIAV Tat proteins in vivo.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q8CH72|TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus GN=Trim32 PE=1 SV=2 Back     alignment and function description
>sp|Q9H0X6|RN208_HUMAN RING finger protein 208 OS=Homo sapiens GN=RNF208 PE=1 SV=2 Back     alignment and function description
>sp|Q8K0W3|RN208_MOUSE RING finger protein 208 OS=Mus musculus GN=Rnf208 PE=2 SV=2 Back     alignment and function description
>sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
224141043267 predicted protein [Populus trichocarpa] 0.981 0.977 0.785 1e-113
225457307268 PREDICTED: uncharacterized protein LOC10 0.981 0.973 0.749 1e-110
359806827264 uncharacterized protein LOC100809368 [Gl 0.969 0.977 0.763 1e-110
356573143264 PREDICTED: uncharacterized protein LOC10 0.969 0.977 0.759 1e-109
357496653266 CCP [Medicago truncatula] gi|217074134|g 0.977 0.977 0.736 1e-106
225452936269 PREDICTED: uncharacterized protein LOC10 0.984 0.973 0.749 1e-106
388503120266 unknown [Lotus japonicus] 0.977 0.977 0.725 1e-105
356526471267 PREDICTED: uncharacterized protein LOC10 0.977 0.973 0.745 1e-103
449446247265 PREDICTED: uncharacterized protein LOC10 0.973 0.977 0.729 1e-103
255570218264 ubiquitin-protein ligase, putative [Rici 0.969 0.977 0.740 1e-103
>gi|224141043|ref|XP_002323884.1| predicted protein [Populus trichocarpa] gi|118481933|gb|ABK92900.1| unknown [Populus trichocarpa] gi|222866886|gb|EEF04017.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/266 (78%), Positives = 231/266 (86%), Gaps = 5/266 (1%)

Query: 1   MWNFASTCLAGNVGLKNDSLKASEAASECSDDDVSSVVSREESLECPICWESFNMVENVP 60
           MWNFAS CLAG+V L N+SLK ++  SE SDD+ SSVVSREE LECPICWESFN+VENVP
Sbjct: 1   MWNFASKCLAGSVSL-NNSLKPAQVPSEYSDDEASSVVSREEGLECPICWESFNIVENVP 59

Query: 61  YVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNY 120
           YVLWCGHTLCKNCILGLQWAVVKFPTLP+QLPLFISCPWCNLLSFR+VY+GNLKFPRKNY
Sbjct: 60  YVLWCGHTLCKNCILGLQWAVVKFPTLPIQLPLFISCPWCNLLSFRLVYRGNLKFPRKNY 119

Query: 121 FLLWMVESMNGDRVKSHSGFCEDRQPASSSSGSSTFGNQLNRGNHRRGQHHHHYHHHPEP 180
           FLLWMVES NGDR KSH  FCED+QP  SS  +   GNQ +RGN RRGQ    Y HH EP
Sbjct: 120 FLLWMVESKNGDREKSHGTFCEDQQPHWSSDSNLALGNQASRGNIRRGQ----YVHHAEP 175

Query: 181 AGSNRDHLHATNYLTVERIHSSLRKSLIFFVHLTAKFPLVVIFLLIVVYAIPASAAILAL 240
           + +N DH H  +YL V RIHSSL+KSL+FFVHLTAKFPLV+IFLLI++YAIPASAAILAL
Sbjct: 176 SEANHDHNHVNSYLNVRRIHSSLQKSLVFFVHLTAKFPLVIIFLLIILYAIPASAAILAL 235

Query: 241 YILVTILFALPSFLILYFAYPSLDWL 266
           YIL+T+LFALPSFLILYFAYPSLDWL
Sbjct: 236 YILITVLFALPSFLILYFAYPSLDWL 261

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225457307|ref|XP_002284521.1| PREDICTED: uncharacterized protein LOC100241642 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359806827|ref|NP_001241055.1| uncharacterized protein LOC100809368 [Glycine max] gi|255644418|gb|ACU22714.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356573143|ref|XP_003554723.1| PREDICTED: uncharacterized protein LOC100815196 [Glycine max] Back     alignment and taxonomy information
>gi|357496653|ref|XP_003618615.1| CCP [Medicago truncatula] gi|217074134|gb|ACJ85427.1| unknown [Medicago truncatula] gi|355493630|gb|AES74833.1| CCP [Medicago truncatula] gi|388508162|gb|AFK42147.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225452936|ref|XP_002284184.1| PREDICTED: uncharacterized protein LOC100262874 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388503120|gb|AFK39626.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356526471|ref|XP_003531841.1| PREDICTED: uncharacterized protein LOC100811549 isoform 1 [Glycine max] gi|356526473|ref|XP_003531842.1| PREDICTED: uncharacterized protein LOC100811549 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449446247|ref|XP_004140883.1| PREDICTED: uncharacterized protein LOC101203968 isoform 1 [Cucumis sativus] gi|449446249|ref|XP_004140884.1| PREDICTED: uncharacterized protein LOC101203968 isoform 2 [Cucumis sativus] gi|449499448|ref|XP_004160820.1| PREDICTED: uncharacterized LOC101203968 isoform 1 [Cucumis sativus] gi|449499451|ref|XP_004160821.1| PREDICTED: uncharacterized LOC101203968 isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570218|ref|XP_002526069.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223534566|gb|EEF36263.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query266
TAIR|locus:2091301263 AT3G29270 [Arabidopsis thalian 0.657 0.665 0.540 1.1e-74
TAIR|locus:2007101270 AT1G69330 [Arabidopsis thalian 0.966 0.951 0.463 5.1e-58
TAIR|locus:2019080261 AT1G74370 [Arabidopsis thalian 0.947 0.965 0.427 8.9e-54
UNIPROTKB|C9IZE0114 TRIM59 "Tripartite motif-conta 0.285 0.666 0.341 4.6e-05
UNIPROTKB|C9J9F0111 TRIM59 "Tripartite motif-conta 0.285 0.684 0.341 4.6e-05
UNIPROTKB|C9JNB968 TRIM59 "Tripartite motif-conta 0.191 0.75 0.413 7.8e-05
WB|WBGene00021763305 Y51F10.2 [Caenorhabditis elega 0.304 0.265 0.322 0.0001
UNIPROTKB|C9IZ3082 RNF182 "E3 ubiquitin-protein l 0.187 0.609 0.333 0.00022
UNIPROTKB|Q5JVY0173 TRIM32 "E3 ubiquitin-protein l 0.116 0.179 0.548 0.00053
TAIR|locus:4515102561 811 AT1G21651 [Arabidopsis thalian 0.278 0.091 0.348 0.00059
TAIR|locus:2091301 AT3G29270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 517 (187.1 bits), Expect = 1.1e-74, Sum P(2) = 1.1e-74
 Identities = 101/187 (54%), Positives = 116/187 (62%)

Query:     1 MWNFASTCLAGNVGLKNDSLKXXXXXXXXXXXXXXXXXXXXXXLECPICWESFNMVENVP 60
             MWN AS+ L GN+G KND  +                      LECPICWESFN+VENVP
Sbjct:     9 MWNLASSYLTGNIGPKNDIRRPVHAHAECSDDDVSSVGSKDEGLECPICWESFNIVENVP 68

Query:    61 YVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNY 120
             YVLWCGHT+CKNCILGLQWA+VK PT PVQLPLFISCPWCNLLSFR+V++G L+FP KNY
Sbjct:    69 YVLWCGHTMCKNCILGLQWAIVKLPTHPVQLPLFISCPWCNLLSFRLVFRGTLRFPHKNY 128

Query:   121 FLLWMVESMNGDRVKSHSGFCEDRQPAXXXXXXXTFGNQLNRGNHRRGQXXXXXXXXPEP 180
             F+LWMVE MNG+R  S  G   D           T    L+  +HR           PEP
Sbjct:   129 FVLWMVERMNGERRNSPGGAQTD---GNNDHTRETPSPCLHNRHHR---------SQPEP 176

Query:   181 AGSNRDH 187
             + S  DH
Sbjct:   177 SRSVNDH 183
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:2007101 AT1G69330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019080 AT1G74370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|C9IZE0 TRIM59 "Tripartite motif-containing protein 59" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J9F0 TRIM59 "Tripartite motif-containing protein 59" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JNB9 TRIM59 "Tripartite motif-containing protein 59" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00021763 Y51F10.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|C9IZ30 RNF182 "E3 ubiquitin-protein ligase RNF182" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JVY0 TRIM32 "E3 ubiquitin-protein ligase TRIM32" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:4515102561 AT1G21651 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 1e-07
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 0.003
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 0.004
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information 
 Score = 46.9 bits (112), Expect = 1e-07
 Identities = 12/37 (32%), Positives = 15/37 (40%)

Query: 41 EESLECPICWESFNMVENVPYVLWCGHTLCKNCILGL 77
               CPI  E     EN P +L CGH   +  +  L
Sbjct: 8  HSIFVCPISKEVMTDEENPPVMLPCGHVYSRKALEKL 44

This zinc-finger is the dimerisation motif for LisH proteins, and is also a typical RING-type of plant ubiquitin ligases. Length = 55
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 266
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.26
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.06
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.04
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.03
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.99
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.97
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.88
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.81
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.8
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.8
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.8
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.76
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.75
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.74
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.74
PF1463444 zf-RING_5: zinc-RING finger domain 98.74
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.71
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.7
PHA02929238 N1R/p28-like protein; Provisional 98.63
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.47
PHA02926242 zinc finger-like protein; Provisional 98.47
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.36
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.3
KOG4367 699 consensus Predicted Zn-finger protein [Function un 98.12
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.02
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.96
KOG2660 331 consensus Locus-specific chromosome binding protei 97.91
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.89
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.87
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 97.78
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.77
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.73
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.72
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 97.67
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.51
COG5222427 Uncharacterized conserved protein, contains RING Z 97.43
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.42
COG5152259 Uncharacterized conserved protein, contains RING a 97.38
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.28
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.14
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.1
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.07
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.92
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.89
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.82
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.74
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 96.66
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.6
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.49
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.48
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 96.48
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.44
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.78
KOG149384 consensus Anaphase-promoting complex (APC), subuni 95.78
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.59
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.34
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 95.2
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.14
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.74
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.42
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.36
COG52191525 Uncharacterized conserved protein, contains RING Z 94.21
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.2
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.2
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 94.12
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 93.93
PF04641260 Rtf2: Rtf2 RING-finger 93.71
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 93.7
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.62
KOG1941518 consensus Acetylcholine receptor-associated protei 93.59
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.4
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.16
KOG3039303 consensus Uncharacterized conserved protein [Funct 92.91
COG5109396 Uncharacterized conserved protein, contains RING Z 92.84
KOG3002299 consensus Zn finger protein [General function pred 92.73
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 92.67
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 92.67
KOG4739233 consensus Uncharacterized protein involved in syna 91.66
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.3
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 90.6
PHA03096284 p28-like protein; Provisional 88.58
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 87.65
KOG1940276 consensus Zn-finger protein [General function pred 86.49
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 85.66
KOG2932389 consensus E3 ubiquitin ligase involved in ubiquiti 85.19
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 84.99
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 84.95
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 84.93
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 84.76
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 82.17
KOG3039303 consensus Uncharacterized conserved protein [Funct 80.69
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information 
Probab=99.26  E-value=2.4e-12  Score=84.97  Aligned_cols=42  Identities=43%  Similarity=1.069  Sum_probs=31.7

Q ss_pred             ccccccccccCCCCcEEecCCChhhHHHHHHhhhhhccCCCCCCCCCCcccCccc
Q 036732           46 CPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWC  100 (266)
Q Consensus        46 CpICl~~f~~~~~~P~~L~CgHtFC~~CL~~l~~~~~~~~~~~~~~~~~~~CP~C  100 (266)
                      ||||+++|.    +|++|+|||+||+.||.++ |+..+...        +.||.|
T Consensus         1 CpiC~~~~~----~Pv~l~CGH~FC~~Cl~~~-~~~~~~~~--------~~CP~C   42 (42)
T PF15227_consen    1 CPICLDLFK----DPVSLPCGHSFCRSCLERL-WKEPSGSG--------FSCPEC   42 (42)
T ss_dssp             ETTTTSB-S----SEEE-SSSSEEEHHHHHHH-HCCSSSST-----------SSS
T ss_pred             CCccchhhC----CccccCCcCHHHHHHHHHH-HHccCCcC--------CCCcCC
Confidence            899999999    9999999999999999998 76554321        479987

>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2ct2_A88 Solution Structure Of The Ring Domain Of The Tripar 2e-05
>pdb|2CT2|A Chain A, Solution Structure Of The Ring Domain Of The Tripartite Motif Protein 32 Length = 88 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 10/61 (16%)
Query: 44  LECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLL 103
           LECPIC ESF   +  P +L CGHT+C+ C+  L  + +            + CP+C+ +
Sbjct: 16  LECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSIN----------GVRCPFCSKI 65
Query: 104 S 104
           +
Sbjct: 66  T 66

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query266
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-20
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 4e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 7e-07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-06
1z6u_A150 NP95-like ring finger protein isoform B; structura 4e-06
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 5e-06
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-06
2ecw_A85 Tripartite motif-containing protein 30; metal bind 7e-06
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 6e-05
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 8e-05
2ysj_A63 Tripartite motif-containing protein 31; ring-type 1e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 3e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 3e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 3e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 4e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 4e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 6e-04
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
 Score = 82.8 bits (205), Expect = 1e-20
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 14/99 (14%)

Query: 30  SDDDVSSVVSREESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPV 89
           S     ++ +  E LECPIC ESF   +  P +L CGHT+C+ C+  L  + +       
Sbjct: 2   SSGSSGNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSIN------ 55

Query: 90  QLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVES 128
                + CP+C+    ++    +L     N  +L    S
Sbjct: 56  ----GVRCPFCS----KITRITSLTQLTDNLTVLKSGPS 86
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.49
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.45
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.45
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.44
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.41
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.38
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.38
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.35
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.32
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.32
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.3
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.3
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.3
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.29
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.28
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.28
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.27
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.27
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.25
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.24
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.24
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.24
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.23
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.23
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.2
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.18
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.18
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.17
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.17
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.14
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.12
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.1
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.1
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.03
2ect_A78 Ring finger protein 126; metal binding protein, st 99.03
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.02
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.01
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.0
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.0
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.0
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.0
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.98
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.93
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.93
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.92
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.91
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.91
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.91
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.83
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.71
2ea5_A68 Cell growth regulator with ring finger domain prot 98.66
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.66
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.65
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.62
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.61
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.61
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.6
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.6
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.49
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.42
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.19
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.13
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.07
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.39
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.37
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.02
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.86
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.35
3nw0_A238 Non-structural maintenance of chromosomes element 93.3
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 93.06
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 89.21
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 81.9
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
Probab=99.49  E-value=2.9e-14  Score=107.35  Aligned_cols=75  Identities=23%  Similarity=0.395  Sum_probs=61.1

Q ss_pred             ccCCCcccccccccccccCCCCcEEec-CCChhhHHHHHHhhhhhccCCCCCCCCCCcccCcccccccccceecCCCCCC
Q 036732           38 VSREESLECPICWESFNMVENVPYVLW-CGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFP  116 (266)
Q Consensus        38 ~~lee~l~CpICl~~f~~~~~~P~~L~-CgHtFC~~CL~~l~~~~~~~~~~~~~~~~~~~CP~CR~~~~~~~~~~~~~~~  116 (266)
                      ..+++.++|+||++.+.    +|++++ |||+||..||..+ |...+.          ..||.||..+..      ...+
T Consensus         8 ~~~~~~~~C~IC~~~~~----~p~~~~~CgH~fC~~Ci~~~-~~~~~~----------~~CP~Cr~~~~~------~~~~   66 (92)
T 3ztg_A            8 DPIPDELLCLICKDIMT----DAVVIPCCGNSYCDECIRTA-LLESDE----------HTCPTCHQNDVS------PDAL   66 (92)
T ss_dssp             CCCCTTTEETTTTEECS----SCEECTTTCCEECHHHHHHH-HHHCTT----------CCCTTTCCSSCC------TTSC
T ss_pred             ccCCcCCCCCCCChhhc----CceECCCCCCHHHHHHHHHH-HHhcCC----------CcCcCCCCcCCC------cccc
Confidence            45678999999999999    999999 9999999999996 543321          269999977421      3578


Q ss_pred             cchHHHHHHHHHHhccc
Q 036732          117 RKNYFLLWMVESMNGDR  133 (266)
Q Consensus       117 ~~N~~l~~~ve~~~~~~  133 (266)
                      ..|..+.++++.++...
T Consensus        67 ~~n~~l~~~i~~~~~~~   83 (92)
T 3ztg_A           67 IANKFLRQAVNNFKNET   83 (92)
T ss_dssp             EECHHHHHHHHHHHHHH
T ss_pred             CcCHHHHHHHHHHHHHH
Confidence            89999999999988754
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 266
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 2e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-04
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-04
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 7e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 7e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.002
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.002
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 48.5 bits (115), Expect = 2e-08
 Identities = 28/119 (23%), Positives = 45/119 (37%), Gaps = 26/119 (21%)

Query: 27  SECSDDDVSSVVSR-EESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFP 85
           S    ++V +V++  ++ LECPIC E        P    C H  CK C+  L+    K  
Sbjct: 4   SALRVEEVQNVINAMQKILECPICLELIKE----PVSTKCDHIFCKFCM--LKLLNQKKG 57

Query: 86  TLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKNYFLLWMVESMNGDRVKSHSGFCEDR 144
                      CP C       + K +L   +++     +VE +    +K    F  D 
Sbjct: 58  P--------SQCPLCK----NDITKRSL---QESTRFSQLVEEL----LKIICAFQLDT 97
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query266
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.46
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.44
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.43
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.33
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.32
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.26
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.11
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.06
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.05
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.0
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.96
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.94
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.52
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.34
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.24
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.02
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.46  E-value=2.5e-14  Score=104.09  Aligned_cols=70  Identities=14%  Similarity=0.016  Sum_probs=58.3

Q ss_pred             CCCcccccccccccccCCCCcEEecCCChhhHHHHHHhhhhhccCCCCCCCCCCcccCcccccccccceecCCCCCCcch
Q 036732           40 REESLECPICWESFNMVENVPYVLWCGHTLCKNCILGLQWAVVKFPTLPVQLPLFISCPWCNLLSFRVVYKGNLKFPRKN  119 (266)
Q Consensus        40 lee~l~CpICl~~f~~~~~~P~~L~CgHtFC~~CL~~l~~~~~~~~~~~~~~~~~~~CP~CR~~~~~~~~~~~~~~~~~N  119 (266)
                      ..+.+.||||+++|.    +|++++|||+||+.||.++ +...+.           .||.||..+.       ..++.+|
T Consensus         4 iP~~l~CpIc~~l~~----dPv~~~cGhtfc~~ci~~~-l~~~~~-----------~cP~c~~~l~-------~~~l~pN   60 (80)
T d2c2la2           4 IPDYLCGKISFELMR----EPCITPSGITYDRKDIEEH-LQRVGH-----------FNPVTRSPLT-------QEQLIPN   60 (80)
T ss_dssp             CCSTTBCTTTCSBCS----SEEECSSCCEEETTHHHHH-HHHTCS-----------SCTTTCCCCC-------GGGCEEC
T ss_pred             CCccccCcCcCchhh----hhcccCCcCeecHHHHHHH-HhcCCc-----------cCCCcccccc-------ccccccH
Confidence            358999999999999    9999999999999999995 333321           5999998765       3578899


Q ss_pred             HHHHHHHHHHhcc
Q 036732          120 YFLLWMVESMNGD  132 (266)
Q Consensus       120 ~~l~~~ve~~~~~  132 (266)
                      ..++++++.+...
T Consensus        61 ~~L~~~I~~~l~~   73 (80)
T d2c2la2          61 LAMKEVIDAFISE   73 (80)
T ss_dssp             HHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999988754
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure