Citrus Sinensis ID: 036777
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| 297801734 | 511 | tRNA synthetase class I (C) family prote | 0.833 | 0.107 | 0.690 | 1e-17 | |
| 9758060 | 500 | cysteine-tRNA ligase [Arabidopsis thalia | 0.833 | 0.11 | 0.690 | 1e-17 | |
| 15241557 | 511 | cysteinyl-tRNA synthetase [Arabidopsis t | 0.833 | 0.107 | 0.690 | 1e-17 | |
| 359475690 | 513 | PREDICTED: cysteinyl-tRNA synthetase-lik | 0.833 | 0.107 | 0.709 | 2e-16 | |
| 359475775 | 106 | PREDICTED: LOW QUALITY PROTEIN: cysteiny | 0.833 | 0.518 | 0.709 | 3e-16 | |
| 388517933 | 96 | unknown [Lotus japonicus] | 0.863 | 0.593 | 0.666 | 3e-16 | |
| 297816954 | 485 | predicted protein [Arabidopsis lyrata su | 0.803 | 0.109 | 0.698 | 4e-16 | |
| 356536300 | 548 | PREDICTED: cysteinyl-tRNA synthetase-lik | 0.727 | 0.087 | 0.812 | 6e-16 | |
| 359496172 | 513 | PREDICTED: cysteinyl-tRNA synthetase-lik | 0.833 | 0.107 | 0.690 | 9e-16 | |
| 356575566 | 553 | PREDICTED: cysteinyl-tRNA synthetase-lik | 0.848 | 0.101 | 0.696 | 1e-15 |
| >gi|297801734|ref|XP_002868751.1| tRNA synthetase class I (C) family protein [Arabidopsis lyrata subsp. lyrata] gi|297314587|gb|EFH45010.1| tRNA synthetase class I (C) family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 94.0 bits (232), Expect = 1e-17, Method: Composition-based stats.
Identities = 38/55 (69%), Positives = 48/55 (87%)
Query: 11 APKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
A KM+L +YN+MTQQKE+ PI PGK+G+YVCG+TAYD SH+GHARAA+SF +LY
Sbjct: 3 AEKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLY 57
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|9758060|dbj|BAB08639.1| cysteine-tRNA ligase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15241557|ref|NP_198699.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|192807340|gb|ACF06122.1| At5g38830 [Arabidopsis thaliana] gi|332006981|gb|AED94364.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359475690|ref|XP_003631732.1| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|296087508|emb|CBI34097.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359475775|ref|XP_002265714.2| PREDICTED: LOW QUALITY PROTEIN: cysteinyl-tRNA synthetase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388517933|gb|AFK47028.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|297816954|ref|XP_002876360.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322198|gb|EFH52619.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356536300|ref|XP_003536677.1| PREDICTED: cysteinyl-tRNA synthetase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359496172|ref|XP_002262997.2| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|297735988|emb|CBI23962.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356575566|ref|XP_003555910.1| PREDICTED: cysteinyl-tRNA synthetase-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 66 | ||||||
| TAIR|locus:2152237 | 511 | AT5G38830 "AT5G38830" [Arabido | 0.833 | 0.107 | 0.690 | 1.4e-17 | |
| TAIR|locus:2078406 | 489 | AT3G56300 "AT3G56300" [Arabido | 0.803 | 0.108 | 0.660 | 8.8e-16 | |
| UNIPROTKB|Q9KQZ9 | 459 | cysS "Cysteine--tRNA ligase" [ | 0.742 | 0.106 | 0.673 | 6.6e-13 | |
| TIGR_CMR|VC_1848 | 459 | VC_1848 "cysteinyl-tRNA synthe | 0.742 | 0.106 | 0.673 | 6.6e-13 | |
| TAIR|locus:2042521 | 563 | SYCO ARATH "cysteinyl t-RNA sy | 0.757 | 0.088 | 0.64 | 7.6e-13 | |
| TIGR_CMR|SO_1791 | 459 | SO_1791 "cysteinyl-tRNA synthe | 0.696 | 0.100 | 0.695 | 1.4e-12 | |
| UNIPROTKB|Q0IZQ2 | 569 | Os09g0556500 "Os09g0556500 pro | 0.772 | 0.089 | 0.615 | 5.6e-12 | |
| TIGR_CMR|CPS_3792 | 469 | CPS_3792 "cysteinyl-tRNA synth | 0.696 | 0.098 | 0.652 | 1.8e-11 | |
| UNIPROTKB|P21888 | 461 | cysS [Escherichia coli K-12 (t | 0.742 | 0.106 | 0.551 | 1.3e-10 | |
| TIGR_CMR|CBU_1487 | 460 | CBU_1487 "cysteinyl-tRNA synth | 0.727 | 0.104 | 0.562 | 5.6e-10 |
| TAIR|locus:2152237 AT5G38830 "AT5G38830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 222 (83.2 bits), Expect = 1.4e-17, P = 1.4e-17
Identities = 38/55 (69%), Positives = 48/55 (87%)
Query: 11 APKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
A KM+L +YN+MTQQKE+ PI PGK+G+YVCG+TAYD SH+GHARAA+SF +LY
Sbjct: 3 AEKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLY 57
|
|
| TAIR|locus:2078406 AT3G56300 "AT3G56300" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQZ9 cysS "Cysteine--tRNA ligase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1848 VC_1848 "cysteinyl-tRNA synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042521 SYCO ARATH "cysteinyl t-RNA synthetase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1791 SO_1791 "cysteinyl-tRNA synthetase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0IZQ2 Os09g0556500 "Os09g0556500 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_3792 CPS_3792 "cysteinyl-tRNA synthetase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21888 cysS [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1487 CBU_1487 "cysteinyl-tRNA synthetase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.7__3525__AT5G38830.1 | annotation not avaliable (511 aa) | ||||||||||
(Arabidopsis lyrata) | |||||||||||
| fgenesh2_kg.8__2416__AT5G64050.1 | • | • | 0.892 | ||||||||
| fgenesh2_kg.6__3223__AT4G04350.1 | • | 0.785 | |||||||||
| fgenesh1_pm.C_scaffold_2000068 | • | • | 0.747 | ||||||||
| scaffold_602894.1 | • | • | 0.722 | ||||||||
| Al_scaffold_0005_156 | • | • | 0.702 | ||||||||
| fgenesh2_kg.6__2713__AT5G27470.1 | • | • | 0.697 | ||||||||
| fgenesh1_pm.C_scaffold_1002832 | • | • | 0.689 | ||||||||
| Al_scaffold_0004_707 | • | 0.680 | |||||||||
| fgenesh2_kg.8__1136__AT5G52520.1 | • | 0.670 | |||||||||
| fgenesh2_kg.3__208__AT3G02660.1 | • | • | 0.667 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| PRK00260 | 463 | PRK00260, cysS, cysteinyl-tRNA synthetase; Validat | 1e-26 | |
| PLN02946 | 557 | PLN02946, PLN02946, cysteine-tRNA ligase | 3e-24 | |
| COG0215 | 464 | COG0215, CysS, Cysteinyl-tRNA synthetase [Translat | 5e-22 | |
| cd00672 | 213 | cd00672, CysRS_core, catalytic core domain of cyst | 4e-21 | |
| TIGR00435 | 464 | TIGR00435, cysS, cysteinyl-tRNA synthetase | 6e-21 | |
| PTZ00399 | 651 | PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro | 2e-15 | |
| pfam01406 | 301 | pfam01406, tRNA-synt_1e, tRNA synthetases class I | 6e-15 | |
| PRK14535 | 699 | PRK14535, cysS, cysteinyl-tRNA synthetase; Provisi | 1e-14 | |
| PRK14536 | 490 | PRK14536, cysS, cysteinyl-tRNA synthetase; Provisi | 4e-12 | |
| TIGR03447 | 411 | TIGR03447, mycothiol_MshC, cysteine--1-D-myo-inosi | 1e-09 | |
| PRK12418 | 384 | PRK12418, PRK12418, cysteinyl-tRNA synthetase; Pro | 3e-08 |
| >gnl|CDD|234705 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
Score = 99.4 bits (249), Expect = 1e-26
Identities = 30/52 (57%), Positives = 39/52 (75%)
Query: 14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
M L IYN++T+QKE F P+ PGKV MYVCG T YD +H+GHAR+ + F +L
Sbjct: 1 MMLKIYNTLTRQKEEFKPLEPGKVKMYVCGPTVYDYAHIGHARSFVVFDVLR 52
|
Length = 463 |
| >gnl|CDD|178532 PLN02946, PLN02946, cysteine-tRNA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|223293 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|232974 TIGR00435, cysS, cysteinyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216482 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173001 PRK14535, cysS, cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184731 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132488 TIGR03447, mycothiol_MshC, cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase | Back alignment and domain information |
|---|
| >gnl|CDD|183518 PRK12418, PRK12418, cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| KOG2007 | 586 | consensus Cysteinyl-tRNA synthetase [Translation, | 99.95 | |
| COG0215 | 464 | CysS Cysteinyl-tRNA synthetase [Translation, ribos | 99.94 | |
| PTZ00399 | 651 | cysteinyl-tRNA-synthetase; Provisional | 99.93 | |
| PLN02946 | 557 | cysteine-tRNA ligase | 99.93 | |
| PRK14536 | 490 | cysS cysteinyl-tRNA synthetase; Provisional | 99.92 | |
| PRK14535 | 699 | cysS cysteinyl-tRNA synthetase; Provisional | 99.91 | |
| PRK14534 | 481 | cysS cysteinyl-tRNA synthetase; Provisional | 99.91 | |
| TIGR03447 | 411 | mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- | 99.9 | |
| TIGR00435 | 465 | cysS cysteinyl-tRNA synthetase. This model finds t | 99.87 | |
| PRK00260 | 463 | cysS cysteinyl-tRNA synthetase; Validated | 99.87 | |
| cd00672 | 213 | CysRS_core catalytic core domain of cysteinyl tRNA | 99.83 | |
| PF01406 | 300 | tRNA-synt_1e: tRNA synthetases class I (C) catalyt | 99.77 | |
| PRK12418 | 384 | cysteinyl-tRNA synthetase; Provisional | 99.63 | |
| cd00802 | 143 | class_I_aaRS_core catalytic core domain of class I | 98.38 | |
| PRK01611 | 507 | argS arginyl-tRNA synthetase; Reviewed | 98.23 | |
| PRK11893 | 511 | methionyl-tRNA synthetase; Reviewed | 98.09 | |
| TIGR00456 | 566 | argS arginyl-tRNA synthetase. This model recognize | 98.05 | |
| cd00671 | 212 | ArgRS_core catalytic core domain of arginyl-tRNA s | 97.76 | |
| cd09287 | 240 | GluRS_non_core catalytic core domain of non-discri | 97.58 | |
| cd00668 | 312 | Ile_Leu_Val_MetRS_core catalytic core domain of is | 97.55 | |
| PRK12268 | 556 | methionyl-tRNA synthetase; Reviewed | 97.53 | |
| cd00818 | 338 | IleRS_core catalytic core domain of isoleucyl-tRNA | 97.5 | |
| cd00814 | 319 | MetRS_core catalytic core domain of methioninyl-tR | 97.45 | |
| TIGR00398 | 530 | metG methionyl-tRNA synthetase. The methionyl-tRNA | 97.41 | |
| PRK04156 | 567 | gltX glutamyl-tRNA synthetase; Provisional | 97.22 | |
| PRK12267 | 648 | methionyl-tRNA synthetase; Reviewed | 97.06 | |
| PRK00133 | 673 | metG methionyl-tRNA synthetase; Reviewed | 96.85 | |
| cd00812 | 314 | LeuRS_core catalytic core domain of leucyl-tRNA sy | 96.83 | |
| cd00674 | 353 | LysRS_core_class_I catalytic core domain of class | 96.82 | |
| cd00817 | 382 | ValRS_core catalytic core domain of valyl-tRNA syn | 96.77 | |
| PLN02224 | 616 | methionine-tRNA ligase | 96.24 | |
| PRK00390 | 805 | leuS leucyl-tRNA synthetase; Validated | 96.16 | |
| PRK00750 | 510 | lysK lysyl-tRNA synthetase; Reviewed | 96.07 | |
| TIGR00396 | 842 | leuS_bact leucyl-tRNA synthetase, eubacterial and | 95.62 | |
| PRK13208 | 800 | valS valyl-tRNA synthetase; Reviewed | 94.35 | |
| COG0143 | 558 | MetG Methionyl-tRNA synthetase [Translation, ribos | 93.51 | |
| PF09334 | 391 | tRNA-synt_1g: tRNA synthetases class I (M); InterP | 92.48 | |
| PLN02610 | 801 | probable methionyl-tRNA synthetase | 90.3 | |
| TIGR00395 | 938 | leuS_arch leucyl-tRNA synthetase, archaeal and cyt | 89.76 | |
| PLN02563 | 963 | aminoacyl-tRNA ligase | 89.28 | |
| TIGR00422 | 861 | valS valyl-tRNA synthetase. The valyl-tRNA synthet | 88.33 | |
| TIGR00463 | 560 | gltX_arch glutamyl-tRNA synthetase, archaeal and e | 88.08 | |
| TIGR00467 | 515 | lysS_arch lysyl-tRNA synthetase, archaeal and spir | 87.75 | |
| PLN02943 | 958 | aminoacyl-tRNA ligase | 86.85 | |
| PTZ00419 | 995 | valyl-tRNA synthetase-like protein; Provisional | 86.4 | |
| TIGR00392 | 861 | ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA | 86.39 | |
| PLN02381 | 1066 | valyl-tRNA synthetase | 86.39 | |
| PRK14900 | 1052 | valS valyl-tRNA synthetase; Provisional | 85.71 | |
| COG0495 | 814 | LeuS Leucyl-tRNA synthetase [Translation, ribosoma | 85.39 | |
| PRK05729 | 874 | valS valyl-tRNA synthetase; Reviewed | 84.56 | |
| PLN02959 | 1084 | aminoacyl-tRNA ligase | 84.19 | |
| PLN02882 | 1159 | aminoacyl-tRNA ligase | 83.51 | |
| PRK05743 | 912 | ileS isoleucyl-tRNA synthetase; Reviewed | 83.25 | |
| KOG2804 | 348 | consensus Phosphorylcholine transferase/cholinepho | 82.1 | |
| PRK06039 | 975 | ileS isoleucyl-tRNA synthetase; Reviewed | 82.01 | |
| PTZ00427 | 1205 | isoleucine-tRNA ligase, putative; Provisional | 81.97 | |
| PRK13804 | 961 | ileS isoleucyl-tRNA synthetase; Provisional | 81.89 | |
| PLN02843 | 974 | isoleucyl-tRNA synthetase | 80.91 |
| >KOG2007 consensus Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=99.95 E-value=1.6e-29 Score=194.54 Aligned_cols=63 Identities=46% Similarity=0.716 Sum_probs=60.4
Q ss_pred cccccc-cCCCcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777 4 SKETTA-AAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS 66 (66)
Q Consensus 4 ~~~~~~-~~~~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R 66 (66)
.+|..| +|.+++|+||||+||+||+|.|.++++|+||+|||||||.+||||||+||.||||+|
T Consensus 22 ~~w~~p~~~~~~~L~lYNslTr~Ke~fip~~~~~v~wY~CGpTvYD~SHmGHArsYVsfDIlrR 85 (586)
T KOG2007|consen 22 PHWDQPNAGQPTELKLYNSLTRQKEVFIPNNGNKVTWYICGPTVYDSSHMGHARSYVSFDILRR 85 (586)
T ss_pred cccCCCCCCCCCeEEEeeccccccceeeeCCCCeEEEEEecCcccchhhhhhhhhhhhHHHHHH
Confidence 578888 888899999999999999999999999999999999999999999999999999997
|
|
| >COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00399 cysteinyl-tRNA-synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02946 cysteine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK14536 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14535 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14534 cysS cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase | Back alignment and domain information |
|---|
| >TIGR00435 cysS cysteinyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK00260 cysS cysteinyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase | Back alignment and domain information |
|---|
| >PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK12418 cysteinyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK01611 argS arginyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK11893 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00456 argS arginyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase | Back alignment and domain information |
|---|
| >cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases | Back alignment and domain information |
|---|
| >PRK12268 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases | Back alignment and domain information |
|---|
| >TIGR00398 metG methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK04156 gltX glutamyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12267 methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK00133 metG methionyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases | Back alignment and domain information |
|---|
| >cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase | Back alignment and domain information |
|---|
| >cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases | Back alignment and domain information |
|---|
| >PLN02224 methionine-tRNA ligase | Back alignment and domain information |
|---|
| >PRK00390 leuS leucyl-tRNA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK00750 lysK lysyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family | Back alignment and domain information |
|---|
| >PRK13208 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PLN02610 probable methionyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family | Back alignment and domain information |
|---|
| >PLN02563 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >TIGR00422 valS valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family | Back alignment and domain information |
|---|
| >TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete | Back alignment and domain information |
|---|
| >PLN02943 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PTZ00419 valyl-tRNA synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00392 ileS isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PLN02381 valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >PRK14900 valS valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05729 valS valyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PLN02959 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PLN02882 aminoacyl-tRNA ligase | Back alignment and domain information |
|---|
| >PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00427 isoleucine-tRNA ligase, putative; Provisional | Back alignment and domain information |
|---|
| >PRK13804 ileS isoleucyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02843 isoleucyl-tRNA synthetase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 66 | ||||
| 1li5_A | 461 | Crystal Structure Of Cysteinyl-Trna Synthetase Leng | 1e-12 | ||
| 3tqo_A | 462 | Structure Of The Cysteinyl-Trna Synthetase (Cyss) F | 2e-11 | ||
| 3c8z_A | 414 | The 1.6 A Crystal Structure Of Mshc: The Rate Limit | 2e-05 |
| >pdb|1LI5|A Chain A, Crystal Structure Of Cysteinyl-Trna Synthetase Length = 461 | Back alignment and structure |
|
| >pdb|3TQO|A Chain A, Structure Of The Cysteinyl-Trna Synthetase (Cyss) From Coxiella Burnetii Length = 462 | Back alignment and structure |
| >pdb|3C8Z|A Chain A, The 1.6 A Crystal Structure Of Mshc: The Rate Limiting Enzyme In The Mycothiol Biosynthetic Pathway Length = 414 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 66 | |||
| 3tqo_A | 462 | Cysteinyl-tRNA synthetase; protein synthesis, liga | 4e-28 | |
| 1li5_A | 461 | Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys | 1e-26 | |
| 3sp1_A | 501 | Cysteinyl-tRNA synthetase; structural genomics, se | 2e-26 | |
| 3c8z_A | 414 | Cysteinyl-tRNA synthetase; cysteine ligase, rossma | 2e-22 |
| >3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Length = 462 | Back alignment and structure |
|---|
Score = 102 bits (257), Expect = 4e-28
Identities = 27/52 (51%), Positives = 38/52 (73%)
Query: 14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
M + I+NS+T+QKE+F PI GKV +YVCG+T YD H+GH R+ I F ++
Sbjct: 3 MSVKIFNSLTKQKEIFKPIESGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVV 54
|
| >1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Length = 461 | Back alignment and structure |
|---|
| >3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Length = 501 | Back alignment and structure |
|---|
| >3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Length = 414 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| 3tqo_A | 462 | Cysteinyl-tRNA synthetase; protein synthesis, liga | 99.89 | |
| 3sp1_A | 501 | Cysteinyl-tRNA synthetase; structural genomics, se | 99.87 | |
| 1li5_A | 461 | Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys | 99.86 | |
| 3c8z_A | 414 | Cysteinyl-tRNA synthetase; cysteine ligase, rossma | 99.8 | |
| 3h99_A | 560 | Methionyl-tRNA synthetase; rossmann fold, aminoacy | 98.65 | |
| 4dlp_A | 536 | Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA | 98.59 | |
| 1f7u_A | 607 | Arginyl-tRNA synthetase; RNA-protein complex, amin | 98.36 | |
| 2d5b_A | 500 | Methionyl-tRNA synthetase; rossmann fold, class 1A | 98.34 | |
| 2csx_A | 497 | Methionyl-tRNA synthetase; ligase, riken structura | 98.33 | |
| 2zue_A | 629 | Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase | 98.26 | |
| 1iq0_A | 592 | Arginyl-tRNA synthetase; riken structural genomics | 98.23 | |
| 1irx_A | 523 | Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin | 98.21 | |
| 3kfl_A | 564 | Methionyl-tRNA synthetase; parasite, aminoacyl-tRN | 98.15 | |
| 2x1l_A | 524 | Methionyl-tRNA synthetase; nucleotide-binding, pro | 97.73 | |
| 2v0c_A | 878 | Aminoacyl-tRNA synthetase; ligase, nucleotide-bind | 96.97 | |
| 3u1f_A | 542 | Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta | 96.83 | |
| 1rqg_A | 722 | Methionyl-tRNA synthetase; translation, dimerizati | 96.63 | |
| 2hz7_A | 851 | Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c | 96.49 | |
| 4arc_A | 880 | Leucine--tRNA ligase; ligase-RNA complex, nucleoti | 96.48 | |
| 1qtq_A | 553 | GLNRS, protein (glutaminyl-tRNA synthetase); gluta | 95.25 | |
| 3aii_A | 553 | Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta | 94.59 | |
| 1nzj_A | 298 | Hypothetical protein YADB; Zn cluster, glutamyl T- | 92.01 | |
| 1wkb_A | 810 | Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e | 91.25 | |
| 1gax_A | 862 | Valrs, valyl-tRNA synthetase; protein-RNA complex, | 90.85 | |
| 2o5r_A | 481 | Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g | 90.79 | |
| 2cfo_A | 492 | Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s | 90.38 | |
| 1ile_A | 821 | Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s | 90.14 | |
| 4g6z_A | 490 | Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, | 85.53 | |
| 1ffy_A | 917 | Isoleucyl-tRNA synthetase; protein-RNA complex, me | 84.97 | |
| 1wz2_A | 967 | Leucyl-tRNA synthetase; ligase, riken structural g | 84.08 |
| >3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
Probab=99.89 E-value=4.7e-25 Score=165.32 Aligned_cols=54 Identities=50% Similarity=0.916 Sum_probs=52.1
Q ss_pred CcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777 13 KMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS 66 (66)
Q Consensus 13 ~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R 66 (66)
.|.|+||||+||+||+|+|.++++|+||+||||||+.+||||+|++|++|+|+|
T Consensus 2 ~m~l~~yntlt~~ke~f~p~~~~~v~~YvcGPtvy~~~HIGHaR~~v~~Dvl~R 55 (462)
T 3tqo_A 2 AMSVKIFNSLTKQKEIFKPIESGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVVR 55 (462)
T ss_dssp CCCCEEEETTTTEEEECCCSSTTEEEEEECCCBTTSCCBHHHHHHHHHHHHHHH
T ss_pred CceEEEEEcCCCceeccccCCCCeEEEEeCCCcCCCCCchhhhHHHHHHHHHHH
Confidence 378999999999999999999999999999999999999999999999999987
|
| >3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B | Back alignment and structure |
|---|
| >3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A | Back alignment and structure |
|---|
| >4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* | Back alignment and structure |
|---|
| >2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A | Back alignment and structure |
|---|
| >2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* | Back alignment and structure |
|---|
| >2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A | Back alignment and structure |
|---|
| >1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 | Back alignment and structure |
|---|
| >1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 | Back alignment and structure |
|---|
| >3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* | Back alignment and structure |
|---|
| >2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* | Back alignment and structure |
|---|
| >3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* | Back alignment and structure |
|---|
| >1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 | Back alignment and structure |
|---|
| >2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* | Back alignment and structure |
|---|
| >1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A | Back alignment and structure |
|---|
| >3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* | Back alignment and structure |
|---|
| >1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A | Back alignment and structure |
|---|
| >2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} | Back alignment and structure |
|---|
| >1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* | Back alignment and structure |
|---|
| >4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* | Back alignment and structure |
|---|
| >1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 66 | ||||
| d1li5a2 | 315 | c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysR | 1e-21 | |
| d1irxa2 | 317 | c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase { | 1e-06 |
| >d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Length = 315 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Cysteinyl-tRNA synthetase (CysRS) species: Escherichia coli [TaxId: 562]
Score = 83.1 bits (204), Expect = 1e-21
Identities = 27/50 (54%), Positives = 38/50 (76%)
Query: 16 LIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
L I+N++T+QKE F PI G+VGMYVCG+T YDL H+GH R ++F ++
Sbjct: 2 LKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVA 51
|
| >d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 317 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 66 | |||
| d1li5a2 | 315 | Cysteinyl-tRNA synthetase (CysRS) {Escherichia col | 99.85 | |
| d1irxa2 | 317 | Class I lysyl-tRNA synthetase {Archaeon Pyrococcus | 98.19 | |
| d2d5ba2 | 348 | Methionyl-tRNA synthetase (MetRS) {Thermus thermop | 98.07 | |
| d1ivsa4 | 425 | Valyl-tRNA synthetase (ValRS) {Thermus thermophilu | 97.85 | |
| d1ilea3 | 452 | Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop | 97.81 | |
| d1pfva2 | 350 | Methionyl-tRNA synthetase (MetRS) {Escherichia col | 97.66 | |
| d1rqga2 | 361 | Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys | 97.22 | |
| d1ffya3 | 450 | Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus | 95.71 | |
| d1h3na3 | 494 | Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil | 92.95 | |
| d1f7ua2 | 348 | Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa | 88.98 | |
| d1iq0a2 | 370 | Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi | 88.02 | |
| d1j09a2 | 305 | Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph | 84.74 |
| >d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Adenine nucleotide alpha hydrolase-like superfamily: Nucleotidylyl transferase family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain domain: Cysteinyl-tRNA synthetase (CysRS) species: Escherichia coli [TaxId: 562]
Probab=99.85 E-value=1.6e-23 Score=143.31 Aligned_cols=51 Identities=53% Similarity=1.021 Sum_probs=49.7
Q ss_pred eEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777 16 LIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS 66 (66)
Q Consensus 16 l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R 66 (66)
|+||||+||++++|++.+|++++||||||||++.+||||+|.+|..|+|.|
T Consensus 2 ~~~~~~~~~~~~~f~~~~~~~~~~yv~Gptv~g~~HIGH~R~av~gD~laR 52 (315)
T d1li5a2 2 LKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVAR 52 (315)
T ss_dssp CEEEETTTTEEEECCCSSTTEEEEEECCCBSSSCCBHHHHHHHHHHHHHHH
T ss_pred ceEEeCCCCceeeeecCCCCeEEEEecCCcCCCCcccchhHHHHHHHHHHH
Confidence 789999999999999999999999999999999999999999999999876
|
| >d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|