Citrus Sinensis ID: 036777


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
METSKETTAAAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
ccccccccccccccEEEEEEccccccccEEEccccEEEEEEEccEEcccccccccccEEEEEEEEc
cccccccccccccccEEEEEccccccccccccccccEEEEEEccEEEEEEEcccccEEEEEEEEEc
metskettaaapkMDLIIYNSMTqqkelftpivpgkvgmyVCGVTAYDLSHLGHARAAISFYILYS
metskettaaapkmDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
METSKETTAAAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
**************DLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY*
****************IIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
*********AAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
************KMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METSKETTAAAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query66 2.2.26 [Sep-21-2011]
A1VDQ5 485 Cysteine--tRNA ligase OS= yes no 0.712 0.096 0.702 1e-15
Q72BQ5 485 Cysteine--tRNA ligase OS= yes no 0.712 0.096 0.702 1e-15
Q3A8C9 481 Cysteine--tRNA ligase OS= yes no 0.787 0.108 0.634 2e-14
Q6LT67 464 Cysteine--tRNA ligase 1 O yes no 0.772 0.109 0.625 3e-14
Q0HTK4 461 Cysteine--tRNA ligase OS= yes no 0.696 0.099 0.695 4e-14
Q0HH98 461 Cysteine--tRNA ligase OS= yes no 0.696 0.099 0.695 4e-14
A0KYM2 461 Cysteine--tRNA ligase OS= yes no 0.696 0.099 0.695 4e-14
C3LNF1 459 Cysteine--tRNA ligase OS= yes no 0.742 0.106 0.673 6e-14
Q9KQZ9 459 Cysteine--tRNA ligase OS= yes no 0.742 0.106 0.673 6e-14
A5F763 459 Cysteine--tRNA ligase OS= yes no 0.742 0.106 0.673 6e-14
>sp|A1VDQ5|SYC_DESVV Cysteine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=cysS PE=3 SV=1 Back     alignment and function desciption
 Score = 81.6 bits (200), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 42/47 (89%)

Query: 18 IYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYIL 64
          IYNS++++KELFTP VPGKV MYVCG+TAYDL H+GHAR+A+ F +L
Sbjct: 3  IYNSLSRRKELFTPAVPGKVNMYVCGITAYDLCHIGHARSAVVFDVL 49





Desulfovibrio vulgaris subsp. vulgaris (strain DP4) (taxid: 391774)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 6
>sp|Q72BQ5|SYC_DESVH Cysteine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|Q3A8C9|SYC_PELCD Cysteine--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|Q6LT67|SYC1_PHOPR Cysteine--tRNA ligase 1 OS=Photobacterium profundum GN=cysS1 PE=3 SV=1 Back     alignment and function description
>sp|Q0HTK4|SYC_SHESR Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|Q0HH98|SYC_SHESM Cysteine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|A0KYM2|SYC_SHESA Cysteine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|C3LNF1|SYC_VIBCM Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|Q9KQZ9|SYC_VIBCH Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysS PE=3 SV=1 Back     alignment and function description
>sp|A5F763|SYC_VIBC3 Cysteine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395) GN=cysS PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
297801734 511 tRNA synthetase class I (C) family prote 0.833 0.107 0.690 1e-17
9758060 500 cysteine-tRNA ligase [Arabidopsis thalia 0.833 0.11 0.690 1e-17
15241557 511 cysteinyl-tRNA synthetase [Arabidopsis t 0.833 0.107 0.690 1e-17
359475690 513 PREDICTED: cysteinyl-tRNA synthetase-lik 0.833 0.107 0.709 2e-16
359475775106 PREDICTED: LOW QUALITY PROTEIN: cysteiny 0.833 0.518 0.709 3e-16
38851793396 unknown [Lotus japonicus] 0.863 0.593 0.666 3e-16
297816954 485 predicted protein [Arabidopsis lyrata su 0.803 0.109 0.698 4e-16
356536300 548 PREDICTED: cysteinyl-tRNA synthetase-lik 0.727 0.087 0.812 6e-16
359496172 513 PREDICTED: cysteinyl-tRNA synthetase-lik 0.833 0.107 0.690 9e-16
356575566 553 PREDICTED: cysteinyl-tRNA synthetase-lik 0.848 0.101 0.696 1e-15
>gi|297801734|ref|XP_002868751.1| tRNA synthetase class I (C) family protein [Arabidopsis lyrata subsp. lyrata] gi|297314587|gb|EFH45010.1| tRNA synthetase class I (C) family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score = 94.0 bits (232), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 48/55 (87%)

Query: 11 APKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
          A KM+L +YN+MTQQKE+  PI PGK+G+YVCG+TAYD SH+GHARAA+SF +LY
Sbjct: 3  AEKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLY 57




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|9758060|dbj|BAB08639.1| cysteine-tRNA ligase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15241557|ref|NP_198699.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|192807340|gb|ACF06122.1| At5g38830 [Arabidopsis thaliana] gi|332006981|gb|AED94364.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|359475690|ref|XP_003631732.1| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|296087508|emb|CBI34097.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475775|ref|XP_002265714.2| PREDICTED: LOW QUALITY PROTEIN: cysteinyl-tRNA synthetase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|388517933|gb|AFK47028.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297816954|ref|XP_002876360.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297322198|gb|EFH52619.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356536300|ref|XP_003536677.1| PREDICTED: cysteinyl-tRNA synthetase-like [Glycine max] Back     alignment and taxonomy information
>gi|359496172|ref|XP_002262997.2| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|297735988|emb|CBI23962.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356575566|ref|XP_003555910.1| PREDICTED: cysteinyl-tRNA synthetase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
TAIR|locus:2152237 511 AT5G38830 "AT5G38830" [Arabido 0.833 0.107 0.690 1.4e-17
TAIR|locus:2078406 489 AT3G56300 "AT3G56300" [Arabido 0.803 0.108 0.660 8.8e-16
UNIPROTKB|Q9KQZ9 459 cysS "Cysteine--tRNA ligase" [ 0.742 0.106 0.673 6.6e-13
TIGR_CMR|VC_1848 459 VC_1848 "cysteinyl-tRNA synthe 0.742 0.106 0.673 6.6e-13
TAIR|locus:2042521 563 SYCO ARATH "cysteinyl t-RNA sy 0.757 0.088 0.64 7.6e-13
TIGR_CMR|SO_1791 459 SO_1791 "cysteinyl-tRNA synthe 0.696 0.100 0.695 1.4e-12
UNIPROTKB|Q0IZQ2 569 Os09g0556500 "Os09g0556500 pro 0.772 0.089 0.615 5.6e-12
TIGR_CMR|CPS_3792 469 CPS_3792 "cysteinyl-tRNA synth 0.696 0.098 0.652 1.8e-11
UNIPROTKB|P21888 461 cysS [Escherichia coli K-12 (t 0.742 0.106 0.551 1.3e-10
TIGR_CMR|CBU_1487 460 CBU_1487 "cysteinyl-tRNA synth 0.727 0.104 0.562 5.6e-10
TAIR|locus:2152237 AT5G38830 "AT5G38830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 222 (83.2 bits), Expect = 1.4e-17, P = 1.4e-17
 Identities = 38/55 (69%), Positives = 48/55 (87%)

Query:    11 APKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
             A KM+L +YN+MTQQKE+  PI PGK+G+YVCG+TAYD SH+GHARAA+SF +LY
Sbjct:     3 AEKMELKLYNTMTQQKEVLIPITPGKIGLYVCGITAYDFSHIGHARAAVSFDVLY 57




GO:0004817 "cysteine-tRNA ligase activity" evidence=IEA;ISS;IBA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005739 "mitochondrion" evidence=IBA
GO:0005829 "cytosol" evidence=IDA;IBA
GO:0006423 "cysteinyl-tRNA aminoacylation" evidence=IEA;ISS;IBA
GO:0009507 "chloroplast" evidence=IBA
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2078406 AT3G56300 "AT3G56300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQZ9 cysS "Cysteine--tRNA ligase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1848 VC_1848 "cysteinyl-tRNA synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TAIR|locus:2042521 SYCO ARATH "cysteinyl t-RNA synthetase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1791 SO_1791 "cysteinyl-tRNA synthetase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IZQ2 Os09g0556500 "Os09g0556500 protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3792 CPS_3792 "cysteinyl-tRNA synthetase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P21888 cysS [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1487 CBU_1487 "cysteinyl-tRNA synthetase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q72BQ5SYC_DESVH6, ., 1, ., 1, ., 1, 60.70210.71210.0969yesno
A1VDQ5SYC_DESVV6, ., 1, ., 1, ., 1, 60.70210.71210.0969yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.7__3525__AT5G38830.1
annotation not avaliable (511 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.8__2416__AT5G64050.1
annotation not avaliable (570 aa)
      0.892
fgenesh2_kg.6__3223__AT4G04350.1
At4g04350-like protein (972 aa)
       0.785
fgenesh1_pm.C_scaffold_2000068
annotation not avaliable (231 aa)
      0.747
scaffold_602894.1
annotation not avaliable (434 aa)
      0.722
Al_scaffold_0005_156
annotation not avaliable (300 aa)
      0.702
fgenesh2_kg.6__2713__AT5G27470.1
annotation not avaliable (451 aa)
      0.697
fgenesh1_pm.C_scaffold_1002832
annotation not avaliable (441 aa)
      0.689
Al_scaffold_0004_707
annotation not avaliable (411 aa)
       0.680
fgenesh2_kg.8__1136__AT5G52520.1
annotation not avaliable (542 aa)
       0.670
fgenesh2_kg.3__208__AT3G02660.1
annotation not avaliable (511 aa)
      0.667

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
PRK00260 463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validat 1e-26
PLN02946 557 PLN02946, PLN02946, cysteine-tRNA ligase 3e-24
COG0215 464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translat 5e-22
cd00672 213 cd00672, CysRS_core, catalytic core domain of cyst 4e-21
TIGR00435 464 TIGR00435, cysS, cysteinyl-tRNA synthetase 6e-21
PTZ00399 651 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Pro 2e-15
pfam01406 301 pfam01406, tRNA-synt_1e, tRNA synthetases class I 6e-15
PRK14535 699 PRK14535, cysS, cysteinyl-tRNA synthetase; Provisi 1e-14
PRK14536 490 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisi 4e-12
TIGR03447 411 TIGR03447, mycothiol_MshC, cysteine--1-D-myo-inosi 1e-09
PRK12418 384 PRK12418, PRK12418, cysteinyl-tRNA synthetase; Pro 3e-08
>gnl|CDD|234705 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
 Score = 99.4 bits (249), Expect = 1e-26
 Identities = 30/52 (57%), Positives = 39/52 (75%)

Query: 14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
          M L IYN++T+QKE F P+ PGKV MYVCG T YD +H+GHAR+ + F +L 
Sbjct: 1  MMLKIYNTLTRQKEEFKPLEPGKVKMYVCGPTVYDYAHIGHARSFVVFDVLR 52


Length = 463

>gnl|CDD|178532 PLN02946, PLN02946, cysteine-tRNA ligase Back     alignment and domain information
>gnl|CDD|223293 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|232974 TIGR00435, cysS, cysteinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|240402 PTZ00399, PTZ00399, cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>gnl|CDD|216482 pfam01406, tRNA-synt_1e, tRNA synthetases class I (C) catalytic domain Back     alignment and domain information
>gnl|CDD|173001 PRK14535, cysS, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|184731 PRK14536, cysS, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|132488 TIGR03447, mycothiol_MshC, cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>gnl|CDD|183518 PRK12418, PRK12418, cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
KOG2007 586 consensus Cysteinyl-tRNA synthetase [Translation, 99.95
COG0215 464 CysS Cysteinyl-tRNA synthetase [Translation, ribos 99.94
PTZ00399 651 cysteinyl-tRNA-synthetase; Provisional 99.93
PLN02946 557 cysteine-tRNA ligase 99.93
PRK14536 490 cysS cysteinyl-tRNA synthetase; Provisional 99.92
PRK14535 699 cysS cysteinyl-tRNA synthetase; Provisional 99.91
PRK14534 481 cysS cysteinyl-tRNA synthetase; Provisional 99.91
TIGR03447 411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino- 99.9
TIGR00435 465 cysS cysteinyl-tRNA synthetase. This model finds t 99.87
PRK00260 463 cysS cysteinyl-tRNA synthetase; Validated 99.87
cd00672 213 CysRS_core catalytic core domain of cysteinyl tRNA 99.83
PF01406 300 tRNA-synt_1e: tRNA synthetases class I (C) catalyt 99.77
PRK12418 384 cysteinyl-tRNA synthetase; Provisional 99.63
cd00802 143 class_I_aaRS_core catalytic core domain of class I 98.38
PRK01611 507 argS arginyl-tRNA synthetase; Reviewed 98.23
PRK11893 511 methionyl-tRNA synthetase; Reviewed 98.09
TIGR00456 566 argS arginyl-tRNA synthetase. This model recognize 98.05
cd00671 212 ArgRS_core catalytic core domain of arginyl-tRNA s 97.76
cd09287 240 GluRS_non_core catalytic core domain of non-discri 97.58
cd00668 312 Ile_Leu_Val_MetRS_core catalytic core domain of is 97.55
PRK12268 556 methionyl-tRNA synthetase; Reviewed 97.53
cd00818 338 IleRS_core catalytic core domain of isoleucyl-tRNA 97.5
cd00814 319 MetRS_core catalytic core domain of methioninyl-tR 97.45
TIGR00398 530 metG methionyl-tRNA synthetase. The methionyl-tRNA 97.41
PRK04156 567 gltX glutamyl-tRNA synthetase; Provisional 97.22
PRK12267 648 methionyl-tRNA synthetase; Reviewed 97.06
PRK00133 673 metG methionyl-tRNA synthetase; Reviewed 96.85
cd00812 314 LeuRS_core catalytic core domain of leucyl-tRNA sy 96.83
cd00674 353 LysRS_core_class_I catalytic core domain of class 96.82
cd00817 382 ValRS_core catalytic core domain of valyl-tRNA syn 96.77
PLN02224 616 methionine-tRNA ligase 96.24
PRK00390 805 leuS leucyl-tRNA synthetase; Validated 96.16
PRK00750 510 lysK lysyl-tRNA synthetase; Reviewed 96.07
TIGR00396 842 leuS_bact leucyl-tRNA synthetase, eubacterial and 95.62
PRK13208 800 valS valyl-tRNA synthetase; Reviewed 94.35
COG0143 558 MetG Methionyl-tRNA synthetase [Translation, ribos 93.51
PF09334 391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 92.48
PLN02610 801 probable methionyl-tRNA synthetase 90.3
TIGR00395 938 leuS_arch leucyl-tRNA synthetase, archaeal and cyt 89.76
PLN02563 963 aminoacyl-tRNA ligase 89.28
TIGR00422 861 valS valyl-tRNA synthetase. The valyl-tRNA synthet 88.33
TIGR00463 560 gltX_arch glutamyl-tRNA synthetase, archaeal and e 88.08
TIGR00467 515 lysS_arch lysyl-tRNA synthetase, archaeal and spir 87.75
PLN02943 958 aminoacyl-tRNA ligase 86.85
PTZ00419 995 valyl-tRNA synthetase-like protein; Provisional 86.4
TIGR00392 861 ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA 86.39
PLN02381 1066 valyl-tRNA synthetase 86.39
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 85.71
COG0495 814 LeuS Leucyl-tRNA synthetase [Translation, ribosoma 85.39
PRK05729 874 valS valyl-tRNA synthetase; Reviewed 84.56
PLN02959 1084 aminoacyl-tRNA ligase 84.19
PLN02882 1159 aminoacyl-tRNA ligase 83.51
PRK05743 912 ileS isoleucyl-tRNA synthetase; Reviewed 83.25
KOG2804 348 consensus Phosphorylcholine transferase/cholinepho 82.1
PRK06039 975 ileS isoleucyl-tRNA synthetase; Reviewed 82.01
PTZ00427 1205 isoleucine-tRNA ligase, putative; Provisional 81.97
PRK13804 961 ileS isoleucyl-tRNA synthetase; Provisional 81.89
PLN02843 974 isoleucyl-tRNA synthetase 80.91
>KOG2007 consensus Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
Probab=99.95  E-value=1.6e-29  Score=194.54  Aligned_cols=63  Identities=46%  Similarity=0.716  Sum_probs=60.4

Q ss_pred             cccccc-cCCCcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777            4 SKETTA-AAPKMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus         4 ~~~~~~-~~~~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .+|..| +|.+++|+||||+||+||+|.|.++++|+||+|||||||.+||||||+||.||||+|
T Consensus        22 ~~w~~p~~~~~~~L~lYNslTr~Ke~fip~~~~~v~wY~CGpTvYD~SHmGHArsYVsfDIlrR   85 (586)
T KOG2007|consen   22 PHWDQPNAGQPTELKLYNSLTRQKEVFIPNNGNKVTWYICGPTVYDSSHMGHARSYVSFDILRR   85 (586)
T ss_pred             cccCCCCCCCCCeEEEeeccccccceeeeCCCCeEEEEEecCcccchhhhhhhhhhhhHHHHHH
Confidence            578888 888899999999999999999999999999999999999999999999999999997



>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00399 cysteinyl-tRNA-synthetase; Provisional Back     alignment and domain information
>PLN02946 cysteine-tRNA ligase Back     alignment and domain information
>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase Back     alignment and domain information
>TIGR00435 cysS cysteinyl-tRNA synthetase Back     alignment and domain information
>PRK00260 cysS cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12418 cysteinyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase Back     alignment and domain information
>PRK01611 argS arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00456 argS arginyl-tRNA synthetase Back     alignment and domain information
>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases Back     alignment and domain information
>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>TIGR00398 metG methionyl-tRNA synthetase Back     alignment and domain information
>PRK04156 gltX glutamyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>PLN02224 methionine-tRNA ligase Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PLN02610 probable methionyl-tRNA synthetase Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>PLN02563 aminoacyl-tRNA ligase Back     alignment and domain information
>TIGR00422 valS valyl-tRNA synthetase Back     alignment and domain information
>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family Back     alignment and domain information
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete Back     alignment and domain information
>PLN02943 aminoacyl-tRNA ligase Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PLN02959 aminoacyl-tRNA ligase Back     alignment and domain information
>PLN02882 aminoacyl-tRNA ligase Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG2804 consensus Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PTZ00427 isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02843 isoleucyl-tRNA synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
1li5_A 461 Crystal Structure Of Cysteinyl-Trna Synthetase Leng 1e-12
3tqo_A 462 Structure Of The Cysteinyl-Trna Synthetase (Cyss) F 2e-11
3c8z_A 414 The 1.6 A Crystal Structure Of Mshc: The Rate Limit 2e-05
>pdb|1LI5|A Chain A, Crystal Structure Of Cysteinyl-Trna Synthetase Length = 461 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 1e-12, Method: Composition-based stats. Identities = 27/49 (55%), Positives = 38/49 (77%) Query: 16 LIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYIL 64 L I+N++T+QKE F PI G+VGMYVCG+T YDL H+GH R ++F ++ Sbjct: 2 LKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVV 50
>pdb|3TQO|A Chain A, Structure Of The Cysteinyl-Trna Synthetase (Cyss) From Coxiella Burnetii Length = 462 Back     alignment and structure
>pdb|3C8Z|A Chain A, The 1.6 A Crystal Structure Of Mshc: The Rate Limiting Enzyme In The Mycothiol Biosynthetic Pathway Length = 414 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
3tqo_A 462 Cysteinyl-tRNA synthetase; protein synthesis, liga 4e-28
1li5_A 461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 1e-26
3sp1_A 501 Cysteinyl-tRNA synthetase; structural genomics, se 2e-26
3c8z_A 414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 2e-22
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Length = 462 Back     alignment and structure
 Score =  102 bits (257), Expect = 4e-28
 Identities = 27/52 (51%), Positives = 38/52 (73%)

Query: 14 MDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
          M + I+NS+T+QKE+F PI  GKV +YVCG+T YD  H+GH R+ I F ++ 
Sbjct: 3  MSVKIFNSLTKQKEIFKPIESGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVV 54


>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Length = 461 Back     alignment and structure
>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Length = 501 Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Length = 414 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
3tqo_A 462 Cysteinyl-tRNA synthetase; protein synthesis, liga 99.89
3sp1_A 501 Cysteinyl-tRNA synthetase; structural genomics, se 99.87
1li5_A 461 Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys 99.86
3c8z_A 414 Cysteinyl-tRNA synthetase; cysteine ligase, rossma 99.8
3h99_A 560 Methionyl-tRNA synthetase; rossmann fold, aminoacy 98.65
4dlp_A 536 Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA 98.59
1f7u_A 607 Arginyl-tRNA synthetase; RNA-protein complex, amin 98.36
2d5b_A 500 Methionyl-tRNA synthetase; rossmann fold, class 1A 98.34
2csx_A 497 Methionyl-tRNA synthetase; ligase, riken structura 98.33
2zue_A 629 Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase 98.26
1iq0_A 592 Arginyl-tRNA synthetase; riken structural genomics 98.23
1irx_A 523 Lysyl-tRNA synthetase; beta sandwitch, zinc-bindin 98.21
3kfl_A 564 Methionyl-tRNA synthetase; parasite, aminoacyl-tRN 98.15
2x1l_A 524 Methionyl-tRNA synthetase; nucleotide-binding, pro 97.73
2v0c_A 878 Aminoacyl-tRNA synthetase; ligase, nucleotide-bind 96.97
3u1f_A 542 Methionyl-tRNA synthetase; aminoacyl-tRNA syntheta 96.83
1rqg_A 722 Methionyl-tRNA synthetase; translation, dimerizati 96.63
2hz7_A 851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c 96.49
4arc_A 880 Leucine--tRNA ligase; ligase-RNA complex, nucleoti 96.48
1qtq_A 553 GLNRS, protein (glutaminyl-tRNA synthetase); gluta 95.25
3aii_A 553 Glutamyl-tRNA synthetase; amino-acyl tRNA syntheta 94.59
1nzj_A 298 Hypothetical protein YADB; Zn cluster, glutamyl T- 92.01
1wkb_A 810 Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, e 91.25
1gax_A 862 Valrs, valyl-tRNA synthetase; protein-RNA complex, 90.85
2o5r_A 481 Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, g 90.79
2cfo_A 492 Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA s 90.38
1ile_A 821 Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA s 90.14
4g6z_A 490 Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, 85.53
1ffy_A 917 Isoleucyl-tRNA synthetase; protein-RNA complex, me 84.97
1wz2_A 967 Leucyl-tRNA synthetase; ligase, riken structural g 84.08
>3tqo_A Cysteinyl-tRNA synthetase; protein synthesis, ligase; 2.30A {Coxiella burnetii} Back     alignment and structure
Probab=99.89  E-value=4.7e-25  Score=165.32  Aligned_cols=54  Identities=50%  Similarity=0.916  Sum_probs=52.1

Q ss_pred             CcceEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           13 KMDLIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        13 ~~~l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      .|.|+||||+||+||+|+|.++++|+||+||||||+.+||||+|++|++|+|+|
T Consensus         2 ~m~l~~yntlt~~ke~f~p~~~~~v~~YvcGPtvy~~~HIGHaR~~v~~Dvl~R   55 (462)
T 3tqo_A            2 AMSVKIFNSLTKQKEIFKPIESGKVKLYVCGMTVYDYMHIGHGRSWIIFDMVVR   55 (462)
T ss_dssp             CCCCEEEETTTTEEEECCCSSTTEEEEEECCCBTTSCCBHHHHHHHHHHHHHHH
T ss_pred             CceEEEEEcCCCceeccccCCCCeEEEEeCCCcCCCCCchhhhHHHHHHHHHHH
Confidence            378999999999999999999999999999999999999999999999999987



>3sp1_A Cysteinyl-tRNA synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, LYME disease; HET: AMP; 2.55A {Borrelia burgdorferi} Back     alignment and structure
>1li5_A Cysrs, cysteinyl-tRNA synthetase, transfer RNA-Cys; cysteine, E.coli, ligase; 2.30A {Escherichia coli} SCOP: a.27.1.1 c.26.1.1 PDB: 1li7_A 1u0b_B Back     alignment and structure
>3c8z_A Cysteinyl-tRNA synthetase; cysteine ligase, rossmann fold, Cys-SA inhibitor, zinc binding, ATP-binding, aminoacyl-tRNA synthetase; HET: 5CA 1PE EPE; 1.60A {Mycobacterium smegmatis} Back     alignment and structure
>3h99_A Methionyl-tRNA synthetase; rossmann fold, aminoacyl-tRNA synthetase, ATP-binding, ligas binding, nucleotide-binding, protein biosynthesis; HET: CIT; 1.40A {Escherichia coli} PDB: 3h97_A* 3h9b_A* 1f4l_A 3h9c_A* 1pfv_A* 1pfu_A 1p7p_A* 1pfw_A* 1pfy_A* 1pg0_A* 1pg2_A* 1qqt_A 1mea_A 1med_A Back     alignment and structure
>4dlp_A Aminoacyl-tRNA synthetase, class I:aminoacyl-tRNA synthetase, class IA:methionyl-tRNA...; structural genomics; 2.65A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>1f7u_A Arginyl-tRNA synthetase; RNA-protein complex, aminoacylation; HET: PSU 1MG 2MG H2U M2G 5MC 5MU 1MA ARG; 2.20A {Saccharomyces cerevisiae} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 PDB: 1bs2_A* 1f7v_A* Back     alignment and structure
>2d5b_A Methionyl-tRNA synthetase; rossmann fold, class 1A AARS, isomerase, structural genomics, NPPSFA; 1.80A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 PDB: 1woy_A 1a8h_A 2d54_A Back     alignment and structure
>2csx_A Methionyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase/RNA complex; 2.70A {Aquifex aeolicus} PDB: 2ct8_A* Back     alignment and structure
>2zue_A Arginyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding, protein biosynthesis, ligase/RNA complex; HET: ANP; 2.00A {Pyrococcus horikoshii} PDB: 2zuf_A Back     alignment and structure
>1iq0_A Arginyl-tRNA synthetase; riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; 2.30A {Thermus thermophilus} SCOP: a.27.1.1 c.26.1.1 d.67.2.1 Back     alignment and structure
>1irx_A Lysyl-tRNA synthetase; beta sandwitch, zinc-binding structure, rossmann fold, alpha-helix CAGE; 2.60A {Pyrococcus horikoshii} SCOP: a.97.1.2 c.26.1.1 Back     alignment and structure
>3kfl_A Methionyl-tRNA synthetase; parasite, aminoacyl-tRNA synthetase, tRNA ligase metrs, methionine, translation, ATP-binding; HET: ME8; 2.00A {Leishmania major} Back     alignment and structure
>2x1l_A Methionyl-tRNA synthetase; nucleotide-binding, protein biosynthesis, ligase, aminoacyl- synthetase; HET: ADN CXS; 2.30A {Mycobacterium smegmatis} PDB: 2x1m_A* Back     alignment and structure
>2v0c_A Aminoacyl-tRNA synthetase; ligase, nucleotide-binding, protein biosynthesis; HET: LMS ANZ; 1.85A {Thermus thermophilus} PDB: 1h3n_A* 1obc_A* 1obh_A* 2bte_A* 2byt_A 2v0g_A* Back     alignment and structure
>3u1f_A Methionyl-tRNA synthetase; aminoacyl-tRNA synthetase, AARS, metrs, parasite, protein-IN complex, rossmann-fold, translation; HET: 392; 2.20A {Trypanosoma brucei} PDB: 3u1e_A* 3u1g_A* 3u20_A* 4eg1_A 4eg3_A* 4eg6_A* 4eg8_A* 4eg5_A* 3tun_A* 3u1z_A* 4eg4_A* 4eg7_A* 4ega_A* Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure
>4arc_A Leucine--tRNA ligase; ligase-RNA complex, nucleotide-binding, protein biosynthesis I aminoacyl-tRNA synthetase, ATP-binding; 2.00A {Escherichia coli} PDB: 4aq7_A 4ari_A* 4as1_A* Back     alignment and structure
>1qtq_A GLNRS, protein (glutaminyl-tRNA synthetase); glutamine, trnaGln, E. coli, complex, ligase/RNA complex; HET: QSI; 2.25A {Escherichia coli} SCOP: b.53.1.2 c.26.1.1 PDB: 1gsg_P* 1gts_A* 1gtr_A* 1zjw_A* 1o0b_A* 1o0c_A* 1qru_A* 1qrs_A* 1qrt_A* 1euy_A* 1euq_A* 1exd_A* 2rd2_A* 2re8_A* 1nyl_A Back     alignment and structure
>3aii_A Glutamyl-tRNA synthetase; amino-acyl tRNA synthetase, ligase; 1.65A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>1nzj_A Hypothetical protein YADB; Zn cluster, glutamyl T-RNA synthetase, structural genomics, unknown function; 1.50A {Escherichia coli} SCOP: c.26.1.1 PDB: 2zlz_A* 4a91_A* Back     alignment and structure
>1wkb_A Leucyl-tRNA synthetase; leucine, aminoacyl-tRNA, editing, amino acid, aminoacylation, trnaLeu, structural genomics; 2.05A {Pyrococcus horikoshii} Back     alignment and structure
>1gax_A Valrs, valyl-tRNA synthetase; protein-RNA complex, rossmann fold, coiled coil, riken structural genomics/proteomics initiative, RSGI; HET: VAA; 2.90A {Thermus thermophilus} SCOP: a.2.7.3 a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1ivs_A* 1iyw_A Back     alignment and structure
>2o5r_A Glutamyl-tRNA synthetase 1; TM1351, EC 6.1.1.17, glutamate-T ligase 1, glurs 1, structural genomics, joint center for ST genomics, JCSG; 2.34A {Thermotoga maritima} Back     alignment and structure
>2cfo_A Glutamyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetase, ATP-binding, nucleotide-B; HET: GLU; 2.45A {Synechococcus elongatus} Back     alignment and structure
>1ile_A Ilers, isoleucyl-tRNA synthetase; aminoacyl-tRNA synthetase, riken structural genomics/proteom initiative, RSGI, structural genomics; 2.50A {Thermus thermophilus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1jzq_A* 1jzs_A* Back     alignment and structure
>4g6z_A Glutamate-tRNA ligase; aminoacyl-tRNA synthetase, AARS, class 1B AARS, ATP-dependen charging, protein synthesis, structural genomics; HET: GLU; 2.05A {Burkholderia thailandensis} Back     alignment and structure
>1ffy_A Isoleucyl-tRNA synthetase; protein-RNA complex, metal IONS, editing tRNA synthetase, double-sieve, ligase/RNA, mupiroci; HET: MRC; 2.20A {Staphylococcus aureus} SCOP: a.27.1.1 b.51.1.1 c.26.1.1 PDB: 1qu2_A* 1qu3_A* Back     alignment and structure
>1wz2_A Leucyl-tRNA synthetase; ligase, riken structural genomics/proteomics initiativ structural genomics, ligase-RNA complex; 3.21A {Pyrococcus horikoshii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 66
d1li5a2 315 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysR 1e-21
d1irxa2 317 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase { 1e-06
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Cysteinyl-tRNA synthetase (CysRS)
species: Escherichia coli [TaxId: 562]
 Score = 83.1 bits (204), Expect = 1e-21
 Identities = 27/50 (54%), Positives = 38/50 (76%)

Query: 16 LIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILY 65
          L I+N++T+QKE F PI  G+VGMYVCG+T YDL H+GH R  ++F ++ 
Sbjct: 2  LKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVA 51


>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 317 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
d1li5a2 315 Cysteinyl-tRNA synthetase (CysRS) {Escherichia col 99.85
d1irxa2 317 Class I lysyl-tRNA synthetase {Archaeon Pyrococcus 98.19
d2d5ba2 348 Methionyl-tRNA synthetase (MetRS) {Thermus thermop 98.07
d1ivsa4 425 Valyl-tRNA synthetase (ValRS) {Thermus thermophilu 97.85
d1ilea3 452 Isoleucyl-tRNA synthetase (IleRS) {Thermus thermop 97.81
d1pfva2 350 Methionyl-tRNA synthetase (MetRS) {Escherichia col 97.66
d1rqga2 361 Methionyl-tRNA synthetase (MetRS) {Pyrococcus abys 97.22
d1ffya3 450 Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus 95.71
d1h3na3 494 Leucyl-tRNA synthetase (LeuRS) {Thermus thermophil 92.95
d1f7ua2 348 Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Sa 88.98
d1iq0a2 370 Arginyl-tRNA synthetase (ArgRS) {Thermus thermophi 88.02
d1j09a2 305 Glutamyl-tRNA synthetase (GluRS) {Thermus thermoph 84.74
>d1li5a2 c.26.1.1 (A:1-315) Cysteinyl-tRNA synthetase (CysRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Class I aminoacyl-tRNA synthetases (RS), catalytic domain
domain: Cysteinyl-tRNA synthetase (CysRS)
species: Escherichia coli [TaxId: 562]
Probab=99.85  E-value=1.6e-23  Score=143.31  Aligned_cols=51  Identities=53%  Similarity=1.021  Sum_probs=49.7

Q ss_pred             eEEEeCCCCceEEeeecCCCeeeeEEeCCccCCCCCCCccceEEEEEeeeC
Q 036777           16 LIIYNSMTQQKELFTPIVPGKVGMYVCGVTAYDLSHLGHARAAISFYILYS   66 (66)
Q Consensus        16 l~lyntltr~ke~f~p~~~~~v~~Y~CGPTvYd~~HiGhaR~~V~~Dvl~R   66 (66)
                      |+||||+||++++|++.+|++++||||||||++.+||||+|.+|..|+|.|
T Consensus         2 ~~~~~~~~~~~~~f~~~~~~~~~~yv~Gptv~g~~HIGH~R~av~gD~laR   52 (315)
T d1li5a2           2 LKIFNTLTRQKEEFKPIHAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVAR   52 (315)
T ss_dssp             CEEEETTTTEEEECCCSSTTEEEEEECCCBSSSCCBHHHHHHHHHHHHHHH
T ss_pred             ceEEeCCCCceeeeecCCCCeEEEEecCCcCCCCcccchhHHHHHHHHHHH
Confidence            789999999999999999999999999999999999999999999999876



>d1irxa2 c.26.1.1 (A:3-319) Class I lysyl-tRNA synthetase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2d5ba2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ivsa4 c.26.1.1 (A:1-189,A:343-578) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ilea3 c.26.1.1 (A:1-197,A:387-641) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga2 c.26.1.1 (A:1-138,A:174-396) Methionyl-tRNA synthetase (MetRS) {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ffya3 c.26.1.1 (A:1-200,A:395-644) Isoleucyl-tRNA synthetase (IleRS) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h3na3 c.26.1.1 (A:1-225,A:418-686) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f7ua2 c.26.1.1 (A:136-483) Arginyl-tRNA synthetase (ArgRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iq0a2 c.26.1.1 (A:97-466) Arginyl-tRNA synthetase (ArgRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure