Citrus Sinensis ID: 037509

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MLIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGSERFRNDIFILIRHFSLVG
ccEEcccccEEEEEcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccHHHHHHHccccc
cEEEEccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccccEEEEEEEEccc
mliqlshhnvellefplpgkEECFKLLKLYLDKYTADDTLMEAAAKIEGIsagyesencvihpslSYVIVDYKVSKHQQRRKLAAigggserfrNDIFILIRHFSLVG
MLIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAaigggserfrndIFILIRHFSLVG
MLIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGSERFRNDIFILIRHFSLVG
******HHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGSERFRNDIFILIRHFSL**
*******HNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSK*****************RNDIFILIRHFSLVG
MLIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGSERFRNDIFILIRHFSLVG
MLIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGSERFRNDIFILIRHFSLVG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTADDTLMEAAAKIEGISAGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGSERFRNDIFILIRHFSLVG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
356543350 617 PREDICTED: ATPase family AAA domain-cont 0.694 0.121 0.486 3e-17
356540916 620 PREDICTED: ATPase family AAA domain-cont 0.694 0.120 0.478 4e-16
449468269 638 PREDICTED: ATPase family AAA domain-cont 0.731 0.123 0.453 6e-16
225454791 631 PREDICTED: ATPase family AAA domain-cont 0.740 0.126 0.45 1e-15
147794810 626 hypothetical protein VITISV_015517 [Viti 0.740 0.127 0.45 1e-15
255544708 685 Proteasome-activating nucleotidase, puta 0.870 0.137 0.404 2e-14
357495863 430 ATPase family AAA domain-containing prot 0.694 0.174 0.438 1e-13
357495829 647 ATPase family AAA domain-containing prot 0.694 0.115 0.438 1e-13
357474281 613 ATPase family AAA domain-containing prot 0.685 0.120 0.421 5e-13
224061575 651 predicted protein [Populus trichocarpa] 0.694 0.115 0.426 8e-13
>gi|356543350|ref|XP_003540124.1| PREDICTED: ATPase family AAA domain-containing protein 3-B-like [Glycine max] Back     alignment and taxonomy information
 Score = 92.4 bits (228), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 56/115 (48%), Positives = 63/115 (54%), Gaps = 40/115 (34%)

Query: 11  ELLEFPLPGKEECFKLLKLYLDKYTA---------------------------DDTLMEA 43
           E+LEFPLPG+EE FKLLKLYLDKY A                           DD + EA
Sbjct: 497 EVLEFPLPGEEERFKLLKLYLDKYIAQAGSGKSGFVKDLFKEKPQQIEIKGLTDDIIKEA 556

Query: 44  AAKIEGIS-------------AGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAA 85
           AAK EG S             A Y SENCV+ PSL   +VDYKV++HQQRRKLAA
Sbjct: 557 AAKTEGFSGREIAKLMASVQAAVYGSENCVLDPSLFREVVDYKVAEHQQRRKLAA 611

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356540916|ref|XP_003538930.1| PREDICTED: ATPase family AAA domain-containing protein 3-B-like [Glycine max] Back     alignment and taxonomy information
>gi|449468269|ref|XP_004151844.1| PREDICTED: ATPase family AAA domain-containing protein 3-like [Cucumis sativus] gi|449517959|ref|XP_004166011.1| PREDICTED: ATPase family AAA domain-containing protein 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225454791|ref|XP_002274077.1| PREDICTED: ATPase family AAA domain-containing protein 3-B [Vitis vinifera] gi|297737323|emb|CBI26524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147794810|emb|CAN78021.1| hypothetical protein VITISV_015517 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255544708|ref|XP_002513415.1| Proteasome-activating nucleotidase, putative [Ricinus communis] gi|223547323|gb|EEF48818.1| Proteasome-activating nucleotidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357495863|ref|XP_003618220.1| ATPase family AAA domain-containing protein [Medicago truncatula] gi|355493235|gb|AES74438.1| ATPase family AAA domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357495829|ref|XP_003618203.1| ATPase family AAA domain-containing protein [Medicago truncatula] gi|355493218|gb|AES74421.1| ATPase family AAA domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357474281|ref|XP_003607425.1| ATPase family AAA domain-containing protein [Medicago truncatula] gi|355508480|gb|AES89622.1| ATPase family AAA domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224061575|ref|XP_002300548.1| predicted protein [Populus trichocarpa] gi|222847806|gb|EEE85353.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
TAIR|locus:2097690628 AT3G03060 [Arabidopsis thalian 0.638 0.109 0.404 1.1e-05
TAIR|locus:2148206644 AT5G16930 [Arabidopsis thalian 0.694 0.116 0.355 1.5e-05
TAIR|locus:2062170636 AT2G18330 [Arabidopsis thalian 0.731 0.124 0.345 5e-05
TAIR|locus:2097690 AT3G03060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 113 (44.8 bits), Expect = 1.1e-05, P = 1.1e-05
 Identities = 34/84 (40%), Positives = 46/84 (54%)

Query:    18 PGK-EECFKLLKLYLD-KYTADDTLMEAAAKIEGIS-------------AGYESENCVIH 62
             PG  +  FK  +  ++ K   ++ L EAAAK EG S             A Y SE+CV+ 
Sbjct:   542 PGLFDRLFKKEQQKIEIKGVTEELLKEAAAKTEGFSGREIAKLMASVQAAVYGSEDCVLD 601

Query:    63 PSLSYVIVDYKVSKHQQRRKLAAI 86
               L   +VDYKV++HQQRRKLA +
Sbjct:   602 SMLFREVVDYKVAEHQQRRKLAGV 625
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005618 "cell wall" evidence=IDA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
TAIR|locus:2148206 AT5G16930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062170 AT2G18330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.94
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.14
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 98.95
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 98.86
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 98.8
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 98.71
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 98.7
CHL00195489 ycf46 Ycf46; Provisional 98.67
PRK03992389 proteasome-activating nucleotidase; Provisional 98.63
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 98.62
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 98.57
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 98.49
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 98.48
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 98.48
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 98.47
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 98.41
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.36
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 98.28
CHL00176 638 ftsH cell division protein; Validated 98.19
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 98.18
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 98.01
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 97.89
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 97.85
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 97.7
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 97.63
CHL00206 2281 ycf2 Ycf2; Provisional 97.6
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 97.45
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 97.44
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.32
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 97.32
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.29
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 97.26
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.84
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 96.7
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 96.5
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 96.44
KOG0736 953 consensus Peroxisome assembly factor 2 containing 96.35
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 95.61
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.44
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.4
CHL00195 489 ycf46 Ycf46; Provisional 94.14
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.67
CHL00181287 cbbX CbbX; Provisional 93.08
TIGR00362405 DnaA chromosomal replication initiator protein Dna 92.85
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 91.77
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.56
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.11
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 91.0
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 90.86
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 90.64
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 89.6
PRK00149450 dnaA chromosomal replication initiation protein; R 88.55
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 88.47
KOG0736953 consensus Peroxisome assembly factor 2 containing 87.58
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 86.72
PRK10865 857 protein disaggregation chaperone; Provisional 84.74
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 84.12
PRK12402337 replication factor C small subunit 2; Reviewed 81.29
TIGR02928365 orc1/cdc6 family replication initiation protein. M 81.27
PRK14088440 dnaA chromosomal replication initiation protein; P 81.07
PHA02544316 44 clamp loader, small subunit; Provisional 80.56
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.94  E-value=5.4e-27  Score=198.25  Aligned_cols=88  Identities=49%  Similarity=0.684  Sum_probs=82.3

Q ss_pred             hhhhhhccceEEecCCCCHHHHHHHHHHHHhhhch-----------------------------hhhHHHHHHHccCcc-
Q 037509            2 LIQLSHHNVELLEFPLPGKEECFKLLKLYLDKYTA-----------------------------DDTLMEAAAKIEGIS-   51 (108)
Q Consensus         2 ~~AV~~RfDe~Ief~LPd~eeR~~ILklyl~k~~~-----------------------------d~~l~elA~~TEGfS-   51 (108)
                      -|||+||||++|+||||++|||.+||++||+||+.                             +..|+|.|++||||| 
T Consensus       499 DsAV~DRide~veFpLPGeEERfkll~lYlnkyi~~~~~~~~~~~~~~lfkk~sQ~i~l~~~~t~~~~~EaAkkTeGfSG  578 (630)
T KOG0742|consen  499 DSAVNDRIDEVVEFPLPGEEERFKLLNLYLNKYILKPATSGKPGKWSHLFKKESQRIKLAGFDTGRKCSEAAKKTEGFSG  578 (630)
T ss_pred             hHHHHhhhhheeecCCCChHHHHHHHHHHHHHHhcCcCCCCCCchhhHHHhhhhheeeeccchHHHHHHHHHHhccCCcH
Confidence            48999999999999999999999999999999975                             678999999999999 


Q ss_pred             ------------eEEecCCcccCHHHHHHHHHHHHHhhHHHHHHHhhcCCC
Q 037509           52 ------------AGYESENCVIHPSLSYVIVDYKVSKHQQRRKLAAIGGGS   90 (108)
Q Consensus        52 ------------aay~s~d~vLt~~~~~~~v~~~v~eh~qk~~~~~~~~~~   90 (108)
                                  +||||+|||||+++|+++|+++|.||+||+ |+..++..
T Consensus       579 REiakLva~vQAavYgsedcvLd~~lf~e~v~ykv~eHqqr~-~La~e~~~  628 (630)
T KOG0742|consen  579 REIAKLVASVQAAVYGSEDCVLDEALFDERVDYKVQEHQQRM-WLAAEGSG  628 (630)
T ss_pred             HHHHHHHHHHHHHHhcccchhhHHHHHHHHHHHHHHHHHHHH-HHhhcccc
Confidence                        799999999999999999999999999999 77766643

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 99.04
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 99.02
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.95
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.95
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.9
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.86
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.83
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 98.59
2krk_A86 26S protease regulatory subunit 8; structural geno 98.53
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.4
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.38
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.37
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.37
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.35
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.31
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.28
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 98.24
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.24
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.21
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 98.19
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 98.19
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.16
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 98.1
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 98.09
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 98.08
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 98.07
2r62_A268 Cell division protease FTSH homolog; ATPase domain 97.96
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.96
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.89
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.59
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.36
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 97.35
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 96.76
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.35
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.05
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.94
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.8
3bos_A242 Putative DNA replication factor; P-loop containing 95.79
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.63
2r44_A331 Uncharacterized protein; putative ATPase, structur 95.53
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.88
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.81
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.44
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.24
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.21
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.03
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 92.71
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.56
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 92.28
2v1u_A387 Cell division control protein 6 homolog; DNA repli 92.16
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 92.15
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.86
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 90.26
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 90.11
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 89.69
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 89.28
3pvs_A 447 Replication-associated recombination protein A; ma 89.23
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 88.69
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 88.07
2chq_A319 Replication factor C small subunit; DNA-binding pr 87.17
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 86.99
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 85.19
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 84.82
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 84.34
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 84.23
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 83.92
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 81.76
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 81.18
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.04  E-value=2.3e-10  Score=94.23  Aligned_cols=74  Identities=20%  Similarity=0.193  Sum_probs=61.2

Q ss_pred             hhhhh--ccceEEecCCCCHHHHHHHHHHHHhhhch--hhhHHHHHHHccCcc----------e---EEecCCcccCHHH
Q 037509            3 IQLSH--HNVELLEFPLPGKEECFKLLKLYLDKYTA--DDTLMEAAAKIEGIS----------A---GYESENCVIHPSL   65 (108)
Q Consensus         3 ~AV~~--RfDe~Ief~LPd~eeR~~ILklyl~k~~~--d~~l~elA~~TEGfS----------a---ay~s~d~vLt~~~   65 (108)
                      .|++|  |||+.|+||+|+.++|.+||+.|++++..  +.+++++|++|+|||          |   |.-.+...+|.+.
T Consensus       302 pAllRpGRfD~~I~i~lPd~~~R~~Il~~~~~~~~l~~dvdl~~lA~~t~G~SGADi~~l~~eA~~~Air~~~~~vt~~D  381 (405)
T 4b4t_J          302 PALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQED  381 (405)
T ss_dssp             HHHHSTTSSCCEEECCCCCHHHHHHHHHHHHTTSBCCSSCCHHHHHHHCCSCCHHHHHHHHHHHHHHHHHTTCSBCCHHH
T ss_pred             HhHcCCCcCceEEEcCCcCHHHHHHHHHHHhcCCCCCccCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHcCCCCcCHHH
Confidence            57887  99999999999999999999999998755  678999999999999          2   2222345789999


Q ss_pred             HHHHHHHHHHh
Q 037509           66 SYVIVDYKVSK   76 (108)
Q Consensus        66 ~~~~v~~~v~e   76 (108)
                      |...++..+.+
T Consensus       382 f~~Al~~v~~~  392 (405)
T 4b4t_J          382 FELAVGKVMNK  392 (405)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHhCc
Confidence            98888766543
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.92
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.82
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.77
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.58
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 96.33
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.93
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.52
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.46
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 93.28
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.83
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 91.41
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.39
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 89.75
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 88.68
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.73
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 86.97
d1svma_362 Papillomavirus large T antigen helicase domain {Si 84.35
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 80.74
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.92  E-value=2.1e-10  Score=85.21  Aligned_cols=51  Identities=14%  Similarity=0.189  Sum_probs=45.7

Q ss_pred             hhhhh--ccceEEecCCCCHHHHHHHHHHHHhhhch--hhhHHHHHHHccCcceE
Q 037509            3 IQLSH--HNVELLEFPLPGKEECFKLLKLYLDKYTA--DDTLMEAAAKIEGISAG   53 (108)
Q Consensus         3 ~AV~~--RfDe~Ief~LPd~eeR~~ILklyl~k~~~--d~~l~elA~~TEGfSaa   53 (108)
                      .|++|  |||..|+|++|+.++|..|++.|+++...  +.+++.||++|+|||+|
T Consensus       155 ~al~r~gRfd~~i~~~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~a  209 (258)
T d1e32a2         155 PALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGA  209 (258)
T ss_dssp             GGGTSTTSSCEEEECCCCCHHHHHHHHHHTTTTSCBCTTCCHHHHHHHCTTCCHH
T ss_pred             hhhhhcccccceeECCCCCHHHHHHHhhhhccCcccccccchhhhhhcccCCCHH
Confidence            57777  99999999999999999999999998754  67899999999999744
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure