Citrus Sinensis ID: 037531

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYVSNIA
ccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHHHHHHHccccccccc
cccccccccccccccccHHHccEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHccccEEEEEcEcHHHHcccHHHHHHHHHHHHcccccccc
hhkiqgigigfvpsvldvsILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPssgerylsseMFDAERQAAENMAYVSNIA
hhkiqgigigfvpsvldvSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYVSNIA
HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGaaaaaaikiakraENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYVSNIA
***IQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSS***************************
HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMA******
HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYVSNIA
**KIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAY*S***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYVSNIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
Q00834325 Cysteine synthase OS=Spin N/A no 0.924 0.301 0.724 4e-32
O23733322 Cysteine synthase OS=Bras N/A no 0.943 0.310 0.7 4e-32
O81154325 Cysteine synthase OS=Sola N/A no 0.933 0.304 0.727 5e-32
O23735324 Cysteine synthase OS=Bras N/A no 0.943 0.308 0.67 7e-31
P47998322 Cysteine synthase OS=Arab no no 0.943 0.310 0.69 9e-31
P80608325 Cysteine synthase OS=Zea N/A no 0.924 0.301 0.693 1e-30
Q43317325 Cysteine synthase OS=Citr N/A no 0.943 0.307 0.7 3e-30
O81155386 Cysteine synthase, chloro N/A no 0.924 0.253 0.622 5e-30
P32260383 Cysteine synthase, chloro N/A no 0.924 0.255 0.673 1e-29
Q9XEA8325 Cysteine synthase OS=Oryz yes no 0.943 0.307 0.69 2e-29
>sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function desciption
 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/98 (72%), Positives = 86/98 (87%)

Query: 2   HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKI 61
           HKIQG+G GF+P VLDV+I+DEVV+++S E+I+ AKLL  KEGLLVGISSGAAAAAAIK+
Sbjct: 224 HKIQGLGAGFIPGVLDVNIIDEVVQISSEESIEMAKLLALKEGLLVGISSGAAAAAAIKV 283

Query: 62  AKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENM 99
           AKR ENAGKLIV +FPS GERYLSS +FD+ R+ AE+M
Sbjct: 284 AKRPENAGKLIVAVFPSFGERYLSSVLFDSVRKEAESM 321

Spinacia oleracea (taxid: 3562)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 4EC: 7
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|O81154|CYSK_SOLTU Cysteine synthase OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|P47998|CYSK1_ARATH Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2 Back     alignment and function description
>sp|P80608|CYSK_MAIZE Cysteine synthase OS=Zea mays PE=1 SV=2 Back     alignment and function description
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function description
>sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 Back     alignment and function description
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
449435764 323 PREDICTED: cysteine synthase-like [Cucum 0.952 0.312 0.693 4e-33
224099811 325 predicted protein [Populus trichocarpa] 0.943 0.307 0.75 2e-32
224130748 331 predicted protein [Populus trichocarpa] 0.943 0.302 0.76 6e-32
224082838 256 predicted protein [Populus trichocarpa] 0.943 0.390 0.76 7e-32
449517449 324 PREDICTED: cysteine synthase-like [Cucum 0.952 0.311 0.702 8e-32
224130758 320 predicted protein [Populus trichocarpa] 0.943 0.312 0.75 1e-31
357441515 308 Cysteine synthase [Medicago truncatula] 0.943 0.324 0.68 1e-31
388508804 323 unknown [Medicago truncatula] 0.943 0.309 0.68 1e-31
449517447 323 PREDICTED: LOW QUALITY PROTEIN: cysteine 0.952 0.312 0.712 2e-31
449435762 323 PREDICTED: cysteine synthase-like [Cucum 0.952 0.312 0.712 2e-31
>gi|449435764|ref|XP_004135664.1| PREDICTED: cysteine synthase-like [Cucumis sativus] gi|449518617|ref|XP_004166333.1| PREDICTED: cysteine synthase-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 84/101 (83%)

Query: 2   HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKI 61
           H IQGIG GF+P VLD+ + DE+++V+S EAI+TAKLL  +EGLLVGISSGA AAA IK+
Sbjct: 223 HLIQGIGGGFIPRVLDLKVYDEIIQVSSEEAIETAKLLALREGLLVGISSGAIAAAGIKV 282

Query: 62  AKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYV 102
           AKR E+ GKLIVVIFPS GERYLS+E+FD+ R  AENM YV
Sbjct: 283 AKRRESKGKLIVVIFPSGGERYLSTELFDSIRHEAENMIYV 323

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099811|ref|XP_002311629.1| predicted protein [Populus trichocarpa] gi|222851449|gb|EEE88996.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224130748|ref|XP_002328366.1| predicted protein [Populus trichocarpa] gi|222838081|gb|EEE76446.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224082838|ref|XP_002335446.1| predicted protein [Populus trichocarpa] gi|222834178|gb|EEE72655.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449517449|ref|XP_004165758.1| PREDICTED: cysteine synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224130758|ref|XP_002328369.1| predicted protein [Populus trichocarpa] gi|222838084|gb|EEE76449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357441515|ref|XP_003591035.1| Cysteine synthase [Medicago truncatula] gi|355480083|gb|AES61286.1| Cysteine synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|388508804|gb|AFK42468.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449517447|ref|XP_004165757.1| PREDICTED: LOW QUALITY PROTEIN: cysteine synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435762|ref|XP_004135663.1| PREDICTED: cysteine synthase-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.924 0.302 0.612 4e-26
TAIR|locus:2130419322 OASA1 "O-acetylserine (thiol) 0.943 0.310 0.59 1.1e-25
TAIR|locus:2143754323 DES1 "L-cysteine desulfhydrase 0.924 0.303 0.591 1.8e-25
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.924 0.303 0.591 2.2e-25
TAIR|locus:2080417433 OASC "O-acetylserine (thiol) l 0.924 0.226 0.561 5.6e-24
TAIR|locus:2043964392 OASB "O-acetylserine (thiol) l 0.924 0.25 0.551 6.8e-24
UNIPROTKB|Q1KLZ2376 CAS1 "L-3-cyanoalanine synthas 0.962 0.271 0.5 3.5e-21
UNIPROTKB|Q76MX2351 PCAS-1 "Bifunctional L-3-cyano 0.962 0.290 0.480 2.1e-20
UNIPROTKB|Q43153368 CYSC "Bifunctional L-3-cyanoal 0.924 0.266 0.5 6e-20
TAIR|locus:2082837368 CYSC1 "cysteine synthase C1" [ 0.962 0.277 0.490 1.8e-19
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 295 (108.9 bits), Expect = 4.0e-26, P = 4.0e-26
 Identities = 60/98 (61%), Positives = 71/98 (72%)

Query:     2 HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGXXXXXXXXX 61
             H IQGIG G +P  LD ++LDEV++VTS EAI+TAKLL  KEGLLVGISSG         
Sbjct:   224 HLIQGIGAGLIPDNLDFNVLDEVIQVTSVEAIETAKLLALKEGLLVGISSGAAAAAAIKV 283

Query:    62 XXXXENAGKLIVVIFPSSGERYLSSEMFDAERQAAENM 99
                 ENAGKLIVVIFPS GERYLS+ +F++ R  AEN+
Sbjct:   284 AKRPENAGKLIVVIFPSGGERYLSTSLFESVRHEAENL 321
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;ISS;IDA;IMP
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0019344 "cysteine biosynthetic process" evidence=ISS;RCA;IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009069 "serine family amino acid metabolic process" evidence=RCA
GO:0042545 "cell wall modification" evidence=RCA
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms
TAIR|locus:2082837 CYSC1 "cysteine synthase C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
PLN02565322 PLN02565, PLN02565, cysteine synthase 2e-47
PLN00011323 PLN00011, PLN00011, cysteine synthase 6e-43
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-39
TIGR01139298 TIGR01139, cysK, cysteine synthase A 2e-38
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 1e-34
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 3e-34
PLN02556368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 3e-34
PLN03013429 PLN03013, PLN03013, cysteine synthase 1e-33
PRK10717330 PRK10717, PRK10717, cysteine synthase A; Provision 1e-21
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 2e-19
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 4e-19
TIGR01138290 TIGR01138, cysM, cysteine synthase B 1e-15
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 8e-14
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 5e-12
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 3e-10
PLN02356423 PLN02356, PLN02356, phosphateglycerate kinase 1e-05
cd06446365 cd06446, Trp-synth_B, Tryptophan synthase-beta: Tr 0.001
COG0498411 COG0498, ThrC, Threonine synthase [Amino acid tran 0.001
COG1171347 COG1171, IlvA, Threonine dehydratase [Amino acid t 0.002
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information 
 Score =  153 bits (389), Expect = 2e-47
 Identities = 77/100 (77%), Positives = 89/100 (89%)

Query: 2   HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKI 61
           HKIQGIG GF+P VLDV +LDEVV+V+S+EAI+TAKLL  KEGLLVGISSGAAAAAAIKI
Sbjct: 221 HKIQGIGAGFIPGVLDVDLLDEVVQVSSDEAIETAKLLALKEGLLVGISSGAAAAAAIKI 280

Query: 62  AKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAY 101
           AKR ENAGKLIVVIFPS GERYLSS +F++ ++ AENM +
Sbjct: 281 AKRPENAGKLIVVIFPSFGERYLSSVLFESVKKEAENMVF 320

Length = 322
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information
>gnl|CDD|107207 cd06446, Trp-synth_B, Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
COG0031300 CysK Cysteine synthase [Amino acid transport and m 99.94
KOG1252362 consensus Cystathionine beta-synthase and related 99.91
PLN02565322 cysteine synthase 99.89
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 99.88
PLN02356423 phosphateglycerate kinase 99.88
PRK10717330 cysteine synthase A; Provisional 99.85
KOG1481391 consensus Cysteine synthase [Amino acid transport 99.85
PLN00011323 cysteine synthase 99.84
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 99.83
TIGR01139298 cysK cysteine synthase A. This model distinguishes 99.79
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 99.79
TIGR01136299 cysKM cysteine synthases. This model discriminates 99.79
PLN03013429 cysteine synthase 99.78
PRK11761296 cysM cysteine synthase B; Provisional 99.78
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 99.72
PLN02618410 tryptophan synthase, beta chain 99.59
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 99.58
PRK06721352 threonine synthase; Reviewed 99.51
PRK13802695 bifunctional indole-3-glycerol phosphate synthase/ 99.49
PRK06608338 threonine dehydratase; Provisional 99.49
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 99.48
PRK13028402 tryptophan synthase subunit beta; Provisional 99.47
PRK07334403 threonine dehydratase; Provisional 99.47
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 99.44
PRK12391427 tryptophan synthase subunit beta; Reviewed 99.44
PRK04346397 tryptophan synthase subunit beta; Validated 99.44
PRK06352351 threonine synthase; Validated 99.41
PRK07409353 threonine synthase; Validated 99.4
PRK06815317 hypothetical protein; Provisional 99.39
PLN02569484 threonine synthase 99.36
PRK08197394 threonine synthase; Validated 99.36
PRK13803610 bifunctional phosphoribosylanthranilate isomerase/ 99.34
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 99.34
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 99.32
PRK08329347 threonine synthase; Validated 99.28
TIGR00260328 thrC threonine synthase. Involved in threonine bio 99.27
TIGR02079409 THD1 threonine dehydratase. This model represents 99.25
PRK08638333 threonine dehydratase; Validated 99.25
PRK06110322 hypothetical protein; Provisional 99.23
PRK07048321 serine/threonine dehydratase; Validated 99.23
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 99.23
PRK08246310 threonine dehydratase; Provisional 99.22
PRK06260397 threonine synthase; Validated 99.21
PLN02970328 serine racemase 99.21
PRK07591421 threonine synthase; Validated 99.18
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 99.16
PRK08206399 diaminopropionate ammonia-lyase; Provisional 99.15
PRK06382406 threonine dehydratase; Provisional 99.14
PRK08813349 threonine dehydratase; Provisional 99.13
PRK08639420 threonine dehydratase; Validated 99.12
TIGR03844398 cysteate_syn cysteate synthase. Members of this fa 99.11
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 99.11
PRK08198404 threonine dehydratase; Provisional 99.1
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 99.08
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 99.06
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 99.04
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 99.03
PRK02991441 D-serine dehydratase; Provisional 99.03
PRK07476322 eutB threonine dehydratase; Provisional 99.03
PRK09224 504 threonine dehydratase; Reviewed 99.02
PRK06381319 threonine synthase; Validated 98.99
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 98.98
PRK06450338 threonine synthase; Validated 98.98
PRK08526403 threonine dehydratase; Provisional 98.97
PRK12483 521 threonine dehydratase; Reviewed 98.95
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 98.93
PRK05638442 threonine synthase; Validated 98.93
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 98.91
PRK03910331 D-cysteine desulfhydrase; Validated 98.9
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 98.9
PLN02550 591 threonine dehydratase 98.87
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 98.84
COG0498411 ThrC Threonine synthase [Amino acid transport and 98.78
COG0133396 TrpB Tryptophan synthase beta chain [Amino acid tr 98.76
COG1171347 IlvA Threonine dehydratase [Amino acid transport a 98.66
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 98.66
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 98.61
KOG1395477 consensus Tryptophan synthase beta chain [Amino ac 98.51
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 98.41
PRK09225462 threonine synthase; Validated 98.13
KOG1251323 consensus Serine racemase [Signal transduction mec 98.13
cd01560460 Thr-synth_2 Threonine synthase catalyzes the final 98.11
KOG1250457 consensus Threonine/serine dehydratases [Amino aci 98.09
COG1350432 Predicted alternative tryptophan synthase beta-sub 97.7
COG3048443 DsdA D-serine dehydratase [Amino acid transport an 94.62
KOG2616266 consensus Pyridoxalphosphate-dependent enzyme/pred 84.86
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 82.47
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 81.54
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.94  E-value=7.1e-27  Score=176.37  Aligned_cols=84  Identities=65%  Similarity=0.976  Sum_probs=81.6

Q ss_pred             CCCcccCCCCCCCcCcccCccCeEEEeCHHHHHHHHHHHHHHhCceeeechHHHHHHHHHHHHHhCCCCCEEEEEeCCCC
Q 037531            1 HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSG   80 (106)
Q Consensus         1 ~~~i~GiG~~~~p~~~~~~~vD~~i~V~d~ea~~~~r~l~~~eGi~~G~Ssga~l~aa~~~a~~~~~~~~~Vv~i~~D~g   80 (106)
                      ||.|||||.+|+|.+++.+++|++++|+|+||++++|+|+++||+++|+||||+++||+++++++. ++++||+|+||+|
T Consensus       216 ~~~i~GIG~~~ip~~~~~~~iD~v~~V~d~~A~~~~r~La~~eGilvG~SsGA~~~aa~~~a~~~~-~g~~IVti~pD~G  294 (300)
T COG0031         216 PHKIEGIGAGFVPENLDLDLIDEVIRVSDEEAIATARRLAREEGLLVGISSGAALAAALKLAKELP-AGKTIVTILPDSG  294 (300)
T ss_pred             CcccCCCCCCcCCcccccccCceEEEECHHHHHHHHHHHHHHhCeeecccHHHHHHHHHHHHHhcC-CCCeEEEEECCCc
Confidence            688999999999999999999999999999999999999999999999999999999999999985 6899999999999


Q ss_pred             ccccC
Q 037531           81 ERYLS   85 (106)
Q Consensus        81 ~kY~s   85 (106)
                      +||+|
T Consensus       295 ~RYls  299 (300)
T COG0031         295 ERYLS  299 (300)
T ss_pred             ccccC
Confidence            99998

>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2616 consensus Pyridoxalphosphate-dependent enzyme/predicted threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
1z7y_A322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 1e-27
1z7w_A322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-27
2isq_A320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-27
4aec_A430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 8e-26
3vc3_A344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 3e-22
3vbe_A344 Crystal Structure Of Beta-Cyanoalanine Synthase In 3e-22
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 2e-21
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 5e-21
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 5e-21
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 8e-21
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 4e-19
1d6s_A322 Crystal Structure Of The K41a Mutant Of O-Acetylser 2e-18
1oas_A322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 2e-18
4air_A354 Leishmania Major Cysteine Synthase Length = 354 5e-17
3t4p_A334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 7e-17
3bm5_A338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 9e-15
2pqm_A343 Crystal Structure Of Cysteine Synthase (Oass) From 1e-14
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 8e-14
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 9e-14
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 1e-12
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 3e-11
1jbq_A435 Structure Of Human Cystathionine Beta-Synthase: A U 6e-09
1m54_A363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 7e-09
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 4e-07
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 3e-06
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 3e-06
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 3e-06
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%)
Query: 2   HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGXXXXXXXXX 61
           HKIQGIG GF+PSVL+V ++DEVV+V+S+E+I  A+ L  KEGLLVGISSG         
Sbjct: 221 HKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKL 280
Query: 62  XXXXENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAY 101
               ENAGKL V IFPS GERYLS+ +FDA R+ AE M +
Sbjct: 281 AQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTF 320
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 8e-57
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 8e-56
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 2e-54
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 1e-53
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 7e-53
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 1e-52
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 3e-49
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 4e-49
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 2e-46
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-45
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 7e-42
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 2e-39
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 2e-38
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 2e-38
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
 Score =  176 bits (450), Expect = 8e-57
 Identities = 69/102 (67%), Positives = 85/102 (83%)

Query: 2   HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKI 61
           HKIQGIG GF+PSVL+V ++DEVV+V+S+E+I  A+ L  KEGLLVGISSGAAAAAAIK+
Sbjct: 221 HKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKL 280

Query: 62  AKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAYVS 103
           A+R ENAGKL V IFPS GERYLS+ +FDA R+ AE M + +
Sbjct: 281 AQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA 322
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 99.92
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 99.84
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 99.84
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 99.81
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 99.81
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.81
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 99.81
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 99.81
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 99.78
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 99.78
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 99.77
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 99.77
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 99.76
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 99.72
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 99.48
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 99.46
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 99.46
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 99.45
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, rike 99.36
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxyg 99.33
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynt 99.33
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 99.28
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 99.28
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 99.27
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 99.27
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 99.26
1x1q_A418 Tryptophan synthase beta chain; structural genomic 99.25
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 99.25
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 99.25
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 99.23
1vb3_A428 Threonine synthase; PLP-dependent enzyme, lyase; H 99.23
1e5x_A486 Threonine synthase; threonine biosynthesis, PLP en 99.22
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 99.2
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 99.17
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 99.17
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 99.16
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 99.14
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 99.13
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 98.97
1kl7_A514 Threonine synthase; threonine synthesis, pyridoxal 98.92
4f4f_A468 Threonine synthase; structural genomics, niaid, na 98.42
3v7n_A487 Threonine synthase; ssgcid, structural genomics, s 98.21
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=99.92  E-value=1e-24  Score=165.78  Aligned_cols=102  Identities=52%  Similarity=0.846  Sum_probs=93.7

Q ss_pred             CCCcccCCCCCCCcCcccCccCeEEEeCHHHHHHHHHHHHHHhCceeeechHHHHHHHHHHHHHhCCCCCEEEEEeCCCC
Q 037531            1 HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSG   80 (106)
Q Consensus         1 ~~~i~GiG~~~~p~~~~~~~vD~~i~V~d~ea~~~~r~l~~~eGi~~G~Ssga~l~aa~~~a~~~~~~~~~Vv~i~~D~g   80 (106)
                      +|.++|+|.++.|.+++.+++|+++.|+|+|++++++.|+++||+++|+|||+++++|+++++....++++||+|+||+|
T Consensus       240 ~~~i~g~g~~~~~~~~~~~~~d~~v~v~d~eai~a~~~L~~~eGi~v~~ssga~~~aAl~~a~~~~~~g~~VV~il~d~G  319 (344)
T 3vc3_A          240 PHHITGNGVGFKPDILDLDVMEKVLEVSSEDAVNMARVLALKEGLMVGISSGANTVAALRLAQLPENKGKLIVTVHPSFG  319 (344)
T ss_dssp             CCSCTTSCCSSCCTTCCGGGCSEEEEECHHHHHHHHHHHHHHHCCCBCHHHHHHHHHHHHHHTSGGGTTCEEEEEECBBG
T ss_pred             CeeEecccccccCcccchhhceEEEEECHHHHHHHHHHHHHHCCCEEehhHHHHHHHHHHHhccccCCCCEEEEEECCCc
Confidence            47789999999999999999999999999999999999999999999999999999999998754346899999999999


Q ss_pred             ccccChhhcHHHHHHHhcCccc
Q 037531           81 ERYLSSEMFDAERQAAENMAYV  102 (106)
Q Consensus        81 ~kY~s~~~~~~~~~~~~~~~~~  102 (106)
                      +||+||.+|++|+...+.+.+.
T Consensus       320 ~rYlst~~~~~~~~e~~~~~p~  341 (344)
T 3vc3_A          320 ERYLSSVLFQELRQEAENMQPV  341 (344)
T ss_dssp             GGGTTSTTTHHHHHHHHTCCCB
T ss_pred             hhhccchhhHHHHHHhccCCCC
Confidence            9999999999999888777543
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 106
d1z7wa1320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 2e-35
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 3e-31
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 2e-30
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 3e-28
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 3e-27
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 2e-26
d1jbqa_355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 6e-26
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 4e-25
d1v8za1386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 2e-15
d1ve5a1310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 1e-13
d1qopb_390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 5e-13
d1tdja1331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 2e-12
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 8e-11
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 2e-10
d1v7ca_351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 4e-10
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 2e-09
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 5e-09
d1e5xa_477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 9e-09
d1p5ja_319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 5e-06
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  120 bits (302), Expect = 2e-35
 Identities = 69/100 (69%), Positives = 84/100 (84%)

Query: 2   HKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKI 61
           HKIQGIG GF+PSVL+V ++DEVV+V+S+E+I  A+ L  KEGLLVGISSGAAAAAAIK+
Sbjct: 219 HKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKL 278

Query: 62  AKRAENAGKLIVVIFPSSGERYLSSEMFDAERQAAENMAY 101
           A+R ENAGKL V IFPS GERYLS+ +FDA R+ AE M +
Sbjct: 279 AQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTF 318
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.93
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 99.89
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.87
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.86
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.85
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.82
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.77
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 99.76
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 99.58
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 99.56
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 99.48
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 99.43
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 99.42
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 99.3
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 99.3
d1e5xa_477 Threonine synthase {Mouse-ear cress (Arabidopsis t 99.08
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 98.98
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 98.92
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 98.84
d1kl7a_511 Threonine synthase {Baker's yeast (Saccharomyces c 94.7
d1vb3a1428 Threonine synthase {Escherichia coli [TaxId: 562]} 93.88
d1zuna1 211 Sulfate adenylyltransferase subunit 2, CysD {Pseud 80.99
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.93  E-value=2.3e-26  Score=171.06  Aligned_cols=102  Identities=68%  Similarity=1.011  Sum_probs=95.0

Q ss_pred             CCCcccCCCCCCCcCcccCccCeEEEeCHHHHHHHHHHHHHHhCceeeechHHHHHHHHHHHHHhCCCCCEEEEEeCCCC
Q 037531            1 HHKIQGIGIGFVPSVLDVSILDEVVRVTSNEAIQTAKLLGAKEGLLVGISSGAAAAAAIKIAKRAENAGKLIVVIFPSSG   80 (106)
Q Consensus         1 ~~~i~GiG~~~~p~~~~~~~vD~~i~V~d~ea~~~~r~l~~~eGi~~G~Ssga~l~aa~~~a~~~~~~~~~Vv~i~~D~g   80 (106)
                      ++.++|||.+++|..+..+.+|+++.|+|+|++.++++|+++||+++|+|||++++++++++++...++++||+|+||+|
T Consensus       218 ~~~~~gig~~~~~~~~~~~~id~~~~V~d~e~~~a~~~l~~~eGi~ve~ssga~~aaa~k~a~~~~~~~~~VV~i~~d~G  297 (320)
T d1z7wa1         218 PHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFG  297 (320)
T ss_dssp             CCSCTTSCCSSCCTTCCGGGCSEEEEECHHHHHHHHHHHHHHHSCCBCHHHHHHHHHHHHHHTSGGGTTCEEEEEECBBG
T ss_pred             CceeeeccCCcCcchhhhhhcceeeccCHHHHHHHHHHHHHHCCEEEehHHHHHHHHHHHHHhhccCCCCEEEEEECCCc
Confidence            46789999999999999999999999999999999999999999999999999999999999865457889999999999


Q ss_pred             ccccChhhcHHHHHHHhcCccc
Q 037531           81 ERYLSSEMFDAERQAAENMAYV  102 (106)
Q Consensus        81 ~kY~s~~~~~~~~~~~~~~~~~  102 (106)
                      +||+||.+|++|+...++|.++
T Consensus       298 ~kYlst~~~d~~~~e~~~~~~~  319 (320)
T d1z7wa1         298 ERYLSTVLFDATRKEAEAMTFE  319 (320)
T ss_dssp             GGGTTSGGGHHHHHHHHTCCCC
T ss_pred             hhhcccccCHHHHHHHhcCCCC
Confidence            9999998889999888998764
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure