Citrus Sinensis ID: 038140

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTENQNSGDSISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV
cEEEEcccccHHHHHHHccccccEEEEccEEccccccEEEEEEEcccccccccccccEEEEEEEccccEEEEEEEEccEEEEEEEccccccccHHHHHHccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHccEEEEEEEc
cEEEEccHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEEccccHHcccccccEEEEEEEccccEEEEEEEEccEEEEEEEccccccccccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEc
mqvidfkdpglpqrlsdaqlslpcivkpqvacgtadshsMAIVFGtedfkdlnvpipAVVQEYVNHSSTLFKFYVLGENIFHAvkkstpnsgilmksyernglrpilfdslkslpidtenqnsgdsiscTVDLDLELIKDAAKWLAKTLDLtifgfdvv
mqvidfkdpglpqRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAvkkstpnsgILMKSYERNGLRPILFDSLKSLPIDtenqnsgdsISCTVDLDLELIKDAAKWLAKTldltifgfdvv
MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTENQNSGDSISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV
******************QLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPI*********SISCTVDLDLELIKDAAKWLAKTLDLTIFGFD**
MQ*****DPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMK*YERNGLRP***********************CTVDLDLELIKDAAKWLAKTLDLTIFGFDVV
MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTENQNSGDSISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV
MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNS**********************************SISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTENQNSGDSISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
O80568488 Inositol-tetrakisphosphat yes no 0.962 0.313 0.660 1e-56
Q84Y01342 Inositol-tetrakisphosphat N/A no 0.861 0.400 0.319 7e-12
Q9SBA5319 Inositol-tetrakisphosphat no no 0.811 0.404 0.320 7e-11
Q7ZU91 396 Inositol-tetrakisphosphat yes no 0.861 0.345 0.317 1e-10
Q9SUG3353 Inositol-tetrakisphosphat no no 0.490 0.220 0.375 2e-09
Q5F480 407 Inositol-tetrakisphosphat yes no 0.830 0.324 0.316 2e-09
Q8BYN3 419 Inositol-tetrakisphosphat yes no 0.811 0.307 0.296 8e-09
P0C0T1 419 Inositol-tetrakisphosphat yes no 0.861 0.326 0.306 8e-09
Q13572 414 Inositol-tetrakisphosphat yes no 0.779 0.299 0.3 9e-09
Q9XYQ1319 Inositol-tetrakisphosphat N/A no 0.559 0.278 0.326 2e-08
>sp|O80568|ITPK4_ARATH Inositol-tetrakisphosphate 1-kinase 4 OS=Arabidopsis thaliana GN=ITPK4 PE=2 SV=2 Back     alignment and function desciption
 Score =  218 bits (555), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (78%), Gaps = 6/159 (3%)

Query: 1   MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVV 60
           +++  + +P L Q LS A LSLPCIVKPQVACG AD+HSMAIVF  EDFK+LN P+PA++
Sbjct: 289 LKIDSYDEPDLAQNLSRAGLSLPCIVKPQVACGVADAHSMAIVFRVEDFKNLNTPVPAII 348

Query: 61  QEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTEN 120
           QEYV+HSS +FKFYVLGE IFHAVKKS P+S  L KS E NGL+PILFDSLKSLP+D+ N
Sbjct: 349 QEYVDHSSRIFKFYVLGETIFHAVKKSIPSSSSLRKSAEENGLKPILFDSLKSLPVDSAN 408

Query: 121 QNSGDSISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV 159
           QN         ++DLEL+ +AA WL K LDLTIFGFDVV
Sbjct: 409 QNP------VSEIDLELVTEAATWLRKKLDLTIFGFDVV 441
Kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. Phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. Also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1EC: 5EC: 9
>sp|Q84Y01|ITPK1_MAIZE Inositol-tetrakisphosphate 1-kinase 1 OS=Zea mays GN=ITPK1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SBA5|ITPK1_ARATH Inositol-tetrakisphosphate 1-kinase 1 OS=Arabidopsis thaliana GN=ITPK1 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZU91|ITPK1_DANRE Inositol-tetrakisphosphate 1-kinase OS=Danio rerio GN=itpk1 PE=2 SV=2 Back     alignment and function description
>sp|Q9SUG3|ITPK2_ARATH Inositol-tetrakisphosphate 1-kinase 2 OS=Arabidopsis thaliana GN=ITPK2 PE=2 SV=2 Back     alignment and function description
>sp|Q5F480|ITPK1_CHICK Inositol-tetrakisphosphate 1-kinase OS=Gallus gallus GN=ITPK1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BYN3|ITPK1_MOUSE Inositol-tetrakisphosphate 1-kinase OS=Mus musculus GN=Itpk1 PE=2 SV=1 Back     alignment and function description
>sp|P0C0T1|ITPK1_BOVIN Inositol-tetrakisphosphate 1-kinase OS=Bos taurus GN=ITPK1 PE=1 SV=1 Back     alignment and function description
>sp|Q13572|ITPK1_HUMAN Inositol-tetrakisphosphate 1-kinase OS=Homo sapiens GN=ITPK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9XYQ1|ITPK1_ENTHI Inositol-tetrakisphosphate 1-kinase OS=Entamoeba histolytica GN=ITPK1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
118487198 260 unknown [Populus trichocarpa] 1.0 0.611 0.681 3e-56
224140687 497 predicted protein [Populus trichocarpa] 1.0 0.319 0.681 4e-56
30689569 488 inositol-tetrakisphosphate 1-kinase 4 [A 0.962 0.313 0.660 6e-55
255576442 491 Inositol-tetrakisphosphate 1-kinase, put 0.955 0.309 0.675 3e-54
225434231 371 PREDICTED: inositol-tetrakisphosphate 1- 0.968 0.415 0.654 1e-53
296084369 515 unnamed protein product [Vitis vinifera] 0.968 0.299 0.654 2e-53
147804955 1511 hypothetical protein VITISV_004636 [Viti 0.968 0.101 0.654 2e-53
297828123 490 inositol 1,3,4-trisphosphate 5/6-kinase 0.962 0.312 0.647 2e-49
449438244 502 PREDICTED: inositol-tetrakisphosphate 1- 0.987 0.312 0.598 4e-49
356539848 481 PREDICTED: inositol-tetrakisphosphate 1- 0.955 0.316 0.591 2e-47
>gi|118487198|gb|ABK95427.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 109/160 (68%), Positives = 127/160 (79%), Gaps = 1/160 (0%)

Query: 1   MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVV 60
           ++V  F DP L Q LS+A+LSLP IVKPQVACG AD+HSMAI F  EDFKDLNVP+PA+V
Sbjct: 56  LKVNGFNDPDLAQSLSEAKLSLPSIVKPQVACGVADAHSMAITFRVEDFKDLNVPLPAIV 115

Query: 61  QEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTEN 120
           QEYV+HSST+FK YVLGE +F+AVKKS PN+ +L KS ERN LRP+LFDSLKSLP  T +
Sbjct: 116 QEYVDHSSTIFKIYVLGEQVFYAVKKSIPNADVLTKSSERNELRPLLFDSLKSLPTSTGH 175

Query: 121 QNSGDSISCTVD-LDLELIKDAAKWLAKTLDLTIFGFDVV 159
               DSI   V+  DLEL+ DAA WLA+ LDLTIFGFDVV
Sbjct: 176 STGADSIKTNVNSFDLELVTDAANWLARKLDLTIFGFDVV 215

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224140687|ref|XP_002323710.1| predicted protein [Populus trichocarpa] gi|222866712|gb|EEF03843.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|30689569|ref|NP_850407.1| inositol-tetrakisphosphate 1-kinase 4 [Arabidopsis thaliana] gi|83288252|sp|O80568.2|ITPK4_ARATH RecName: Full=Inositol-tetrakisphosphate 1-kinase 4; AltName: Full=Inositol 1,3,4-trisphosphate 5/6-kinase 4; Short=AtItpk-4; Short=Inositol-triphosphate 5/6-kinase 4; Short=Ins(1,3,4)P(3) 5/6-kinase 4 gi|17979420|gb|AAL49852.1| unknown protein [Arabidopsis thaliana] gi|20465989|gb|AAM20216.1| unknown protein [Arabidopsis thaliana] gi|330255264|gb|AEC10358.1| inositol-tetrakisphosphate 1-kinase 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255576442|ref|XP_002529113.1| Inositol-tetrakisphosphate 1-kinase, putative [Ricinus communis] gi|223531464|gb|EEF33297.1| Inositol-tetrakisphosphate 1-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225434231|ref|XP_002280241.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084369|emb|CBI24757.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804955|emb|CAN75815.1| hypothetical protein VITISV_004636 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297828123|ref|XP_002881944.1| inositol 1,3,4-trisphosphate 5/6-kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297327783|gb|EFH58203.1| inositol 1,3,4-trisphosphate 5/6-kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449438244|ref|XP_004136899.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 4-like [Cucumis sativus] gi|449478827|ref|XP_004155428.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356539848|ref|XP_003538405.1| PREDICTED: inositol-tetrakisphosphate 1-kinase 4-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:2051744488 ITPK4 ""inositol 1,3,4-trispho 0.962 0.313 0.666 3.5e-52
DICTYBASE|DDB_G0269746326 itpk1 "inositol 1,3,4-Tri5Phos 0.886 0.432 0.329 5.3e-14
TAIR|locus:2148990319 ITPK1 "inositol (1,3,4) P3 5/6 0.855 0.426 0.326 4e-13
ZFIN|ZDB-GENE-040426-1953 396 itpk1 "inositol 1,3,4-triphosp 0.861 0.345 0.331 1.2e-11
UNIPROTKB|Q5F480 407 ITPK1 "Inositol-tetrakisphosph 0.817 0.319 0.319 7.7e-11
TAIR|locus:2132487353 AT4G08170 [Arabidopsis thalian 0.943 0.424 0.281 1.2e-10
UNIPROTKB|F1Q0B1262 ITPK1 "Uncharacterized protein 0.830 0.503 0.316 2.8e-10
UNIPROTKB|G3V4M9 295 ITPK1 "Inositol-tetrakisphosph 0.830 0.447 0.316 5.6e-10
UNIPROTKB|P0C0T1 419 ITPK1 "Inositol-tetrakisphosph 0.861 0.326 0.312 6.1e-10
UNIPROTKB|J9NW00 419 ITPK1 "Uncharacterized protein 0.830 0.315 0.316 1e-09
TAIR|locus:2051744 ITPK4 ""inositol 1,3,4-trisphosphate 5/6-kinase 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 541 (195.5 bits), Expect = 3.5e-52, P = 3.5e-52
 Identities = 106/159 (66%), Positives = 127/159 (79%)

Query:     1 MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVV 60
             +++  + +P L Q LS A LSLPCIVKPQVACG AD+HSMAIVF  EDFK+LN P+PA++
Sbjct:   289 LKIDSYDEPDLAQNLSRAGLSLPCIVKPQVACGVADAHSMAIVFRVEDFKNLNTPVPAII 348

Query:    61 QEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTEN 120
             QEYV+HSS +FKFYVLGE IFHAVKKS P+S  L KS E NGL+PILFDSLKSLP+D+ N
Sbjct:   349 QEYVDHSSRIFKFYVLGETIFHAVKKSIPSSSSLRKSAEENGLKPILFDSLKSLPVDSAN 408

Query:   121 QNSGDSISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV 159
             QN    +S   ++DLEL+ +AA WL K LDLTIFGFDVV
Sbjct:   409 QNP---VS---EIDLELVTEAATWLRKKLDLTIFGFDVV 441
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0047325 "inositol tetrakisphosphate 1-kinase activity" evidence=IEA
GO:0052725 "inositol-1,3,4-trisphosphate 6-kinase activity" evidence=IEA
GO:0052726 "inositol-1,3,4-trisphosphate 5-kinase activity" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=IMP
DICTYBASE|DDB_G0269746 itpk1 "inositol 1,3,4-Tri5Phosphate 5/6 Kinase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2148990 ITPK1 "inositol (1,3,4) P3 5/6-kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1953 itpk1 "inositol 1,3,4-triphosphate 5/6 kinase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F480 ITPK1 "Inositol-tetrakisphosphate 1-kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2132487 AT4G08170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q0B1 ITPK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V4M9 ITPK1 "Inositol-tetrakisphosphate 1-kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P0C0T1 ITPK1 "Inositol-tetrakisphosphate 1-kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW00 ITPK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
PLN02941328 PLN02941, PLN02941, inositol-tetrakisphosphate 1-k 3e-21
pfam05770307 pfam05770, Ins134_P3_kin, Inositol 1, 3, 4-trispho 3e-20
>gnl|CDD|215508 PLN02941, PLN02941, inositol-tetrakisphosphate 1-kinase Back     alignment and domain information 
 Score = 87.3 bits (217), Expect = 3e-21
 Identities = 45/161 (27%), Positives = 81/161 (50%), Gaps = 9/161 (5%)

Query: 2   QVIDFKDP-GLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVV 60
           Q++ + D   +P  ++ A L  P + KP VA G+A SH M++ +  E    L  P+  V+
Sbjct: 132 QLVVYDDESSIPDAVALAGLKFPLVAKPLVADGSAKSHKMSLAYDQEGLSKLEPPL--VL 189

Query: 61  QEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPIL-FDSLKSLPIDTE 119
           QE+VNH   LFK YV+G+ +    + S P+    +   E +    +L F  + +     +
Sbjct: 190 QEFVNHGGVLFKVYVVGDYVKCVRRFSLPD----VSEEELSSAEGVLPFPRVSNAAASAD 245

Query: 120 NQNSGDSISCTVDL-DLELIKDAAKWLAKTLDLTIFGFDVV 159
           + ++G       +L     ++D A+ L + L L +F FD++
Sbjct: 246 DADNGGLDPEVAELPPRPFLEDLARELRRRLGLRLFNFDMI 286

Length = 328
>gnl|CDD|114493 pfam05770, Ins134_P3_kin, Inositol 1, 3, 4-trisphosphate 5/6-kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 100.0
PLN02941328 inositol-tetrakisphosphate 1-kinase 100.0
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 99.45
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 98.95
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 98.93
PRK10446300 ribosomal protein S6 modification protein; Provisi 98.83
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 98.82
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 98.7
PRK12458338 glutathione synthetase; Provisional 98.67
PRK14016 727 cyanophycin synthetase; Provisional 98.54
PRK05246316 glutathione synthetase; Provisional 98.45
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 98.33
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 98.32
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 98.25
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 98.23
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 98.19
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 98.03
PRK14569296 D-alanyl-alanine synthetase A; Provisional 98.02
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 97.97
PRK14571299 D-alanyl-alanine synthetase A; Provisional 97.93
PRK06849 389 hypothetical protein; Provisional 97.89
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 97.85
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 97.8
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 97.77
PRK14572347 D-alanyl-alanine synthetase A; Provisional 97.67
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 97.66
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 97.64
PRK14570364 D-alanyl-alanine synthetase A; Provisional 97.6
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 97.54
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 97.37
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 97.11
PRK07206 416 hypothetical protein; Provisional 97.09
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 97.07
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 97.07
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 96.98
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 96.96
PRK02186 887 argininosuccinate lyase; Provisional 96.94
PRK08462 445 biotin carboxylase; Validated 96.9
KOG1057 1018 consensus Arp2/3 complex-interacting protein VIP1/ 96.88
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 96.83
PRK06111 450 acetyl-CoA carboxylase biotin carboxylase subunit; 96.7
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 96.5
PRK05586 447 biotin carboxylase; Validated 96.48
PRK08654 499 pyruvate carboxylase subunit A; Validated 96.32
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 96.17
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 96.09
PRK07178 472 pyruvate carboxylase subunit A; Validated 95.97
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 95.95
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 95.91
PRK12999 1146 pyruvate carboxylase; Reviewed 95.67
PLN02735 1102 carbamoyl-phosphate synthase 95.65
PRK13790 379 phosphoribosylamine--glycine ligase; Provisional 95.63
PRK08591 451 acetyl-CoA carboxylase biotin carboxylase subunit; 95.54
PRK06524 493 biotin carboxylase-like protein; Validated 95.36
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 95.34
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 95.16
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 94.94
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 94.46
PRK00885 420 phosphoribosylamine--glycine ligase; Provisional 94.37
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 93.9
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 93.45
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 93.09
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 92.69
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 92.66
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 92.55
PLN02735 1102 carbamoyl-phosphate synthase 92.26
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 92.2
PLN02948 577 phosphoribosylaminoimidazole carboxylase 92.2
PRK13277366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 92.11
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 92.03
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 91.28
PF02222172 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T 91.05
COG3919 415 Predicted ATP-grasp enzyme [General function predi 90.65
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 90.27
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 89.58
PRK13278358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 89.47
PLN02257 434 phosphoribosylamine--glycine ligase 85.95
PF14305239 ATPgrasp_TupA: TupA-like ATPgrasp 81.3
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information 
Probab=100.00  E-value=5.2e-51  Score=345.20  Aligned_cols=150  Identities=41%  Similarity=0.594  Sum_probs=104.1

Q ss_pred             cccCCCCChhHHHhhcCCCCceEeecccccCCccceeEEEEeCCCcCcCCCCCCceeEeeeecCCCeEEEEEEECCeEEE
Q 038140            3 VIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFH   82 (159)
Q Consensus         3 ~~~~~~~~~~~~l~~~~l~fP~I~Kp~~A~Gs~~sH~M~lv~~~~~L~~l~~p~p~V~QefInH~g~l~KVyViGd~v~~   82 (159)
                      |.+. .+++.+.++++||+||+||||++||||++||+|+|||+++||++|++  |||+||||||||+|||||||||++++
T Consensus       121 i~~~-~~~~~~~l~~agL~fPlI~KPlvA~Gsa~SH~Maivf~~~gL~~L~~--P~VlQeFVNHggvLfKVyVvGd~v~~  197 (307)
T PF05770_consen  121 INSD-AESLPELLKEAGLKFPLICKPLVACGSADSHKMAIVFNEEGLKDLKP--PCVLQEFVNHGGVLFKVYVVGDKVFV  197 (307)
T ss_dssp             ESSS-HCCHHHHHHCTTS-SSEEEEESB-SSTSCCCEEEEE-SGGGGTT--S--SEEEEE----TTEEEEEEEETTEEEE
T ss_pred             EcCC-HHHHHHHHHHCCCcccEEeeehhhcCCccceEEEEEECHHHHhhcCC--CEEEEEeecCCCEEEEEEEecCEEEE
Confidence            4443 78999999999999999999999999999999999999999999986  79999999999999999999999999


Q ss_pred             EEecCCCCCchhhhhhccCCccceEeccCCCCCccccccCCCC-CccccCCCCHHHHHHHHHHHHHHhCCcEeeeeeC
Q 038140           83 AVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTENQNSGD-SISCTVDLDLELIKDAAKWLAKTLDLTIFGFDVV  159 (159)
Q Consensus        83 ~~R~Slpn~~~~~~~~~~~~~~~i~Fds~~~~p~~~~~~~~~~-~~~~~~~~~~~~~~~ia~~Lr~~lGL~LfGfDvI  159 (159)
                      ++||||||++.++.  .. ..+.+.|++.++++.+.. ....+ .....+.++.++++++|++||++|||+|||||||
T Consensus       198 v~R~SLpn~~~~~~--~~-~~~~f~~~~vs~~~~~~~-~~~~d~~~~~~~~p~~~~v~~la~~LR~~lgL~LFgfDvI  271 (307)
T PF05770_consen  198 VKRPSLPNVSSGKL--DR-EEIFFDFHQVSKLESSSD-LSDLDKDPSQVEMPPDELVEKLAKELRRALGLTLFGFDVI  271 (307)
T ss_dssp             EEEE------SSS---TC-GGCCCEGGGTCSTTTSSG-GGSBSS-TTTTTS--HHHHHHHHHHHHHHHT-SEEEEEEE
T ss_pred             EECCCCCCCCcccc--cc-cccceeccccCCccccCc-hhhcccCcccccCCCHHHHHHHHHHHHHHhCcceeeeEEE
Confidence            99999999975322  11 113444555444433332 22222 1234567788999999999999999999999997

Inositol-tetrakisphosphate 1-kinase can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. This enzyme phosphorylates Ins(3,4,5,6)P4 at position 1 to form Ins(1,3,4,5,6)P5. This reaction is thought to have regulatory importance, since Ins(3,4,5,6)P4 is an inhibitor of plasma membrane Ca(2+)-activated Cl(-) channels, while Ins(1,3,4,5,6)P5 is not. It also phosphorylates Ins(1,3,4)P3 on O-5 and O-6 to form Ins(1,3,4,6)P4, an essential molecule in the hexakisphosphate (InsP6) pathway [, , , , ].; GO: 0000287 magnesium ion binding, 0005524 ATP binding, 0047325 inositol tetrakisphosphate 1-kinase activity, 0052725 inositol-1,3,4-trisphosphate 6-kinase activity, 0052726 inositol-1,3,4-trisphosphate 5-kinase activity, 0032957 inositol trisphosphate metabolic process, 0005622 intracellular; PDB: 1Z2P_X 1Z2O_X 1Z2N_X 2Q7D_A 2QB5_B 2ODT_X.
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>KOG1057 consensus Arp2/3 complex-interacting protein VIP1/Asp1, involved in regulation of actin cytoskeleton [Cytoskeleton] Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PF14305 ATPgrasp_TupA: TupA-like ATPgrasp Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
2q7d_A346 Crystal Structure Of Human Inositol 1,3,4-Trisphosp 8e-10
2qb5_A347 Crystal Structure Of Human Inositol 1,3,4-Trisphosp 8e-10
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase Complexed M 2e-09
2odt_X328 Structure Of Human Inositol 1,3,4-Trisphosphate 56- 5e-09
>pdb|2Q7D|A Chain A, Crystal Structure Of Human Inositol 1,3,4-Trisphosphate 56-Kinase (Itpk1) In Complex With Amppnp And Mn2+ Length = 346 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 73/150 (48%), Gaps = 26/150 (17%)
Query: 20  LSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGEN 79
           L+ P I K +VA GT +SH MAIVF  E    +  P   VVQ ++NH++ L+K +V+GE+
Sbjct: 161 LTFPFICKTRVAHGT-NSHEMAIVFNQEGLNAIQPP--CVVQNFINHNAVLYKVFVVGES 217
Query: 80  IFHAVKKSTPNSGILMKSYERNGLRPILFDSLKSLPIDTENQNSGDSISCTVDLDL---- 135
                + S  N        E      I F+S         N +  +S S   +LD     
Sbjct: 218 YTVVQRPSLKNFSAGTSDRE-----SIFFNS--------HNVSKPESSSVLTELDKIEGV 264
Query: 136 ------ELIKDAAKWLAKTLDLTIFGFDVV 159
                 E+I++ ++ L + L +++FG D++
Sbjct: 265 FERPSDEVIRELSRALRQALGVSLFGIDII 294
>pdb|2QB5|A Chain A, Crystal Structure Of Human Inositol 1,3,4-Trisphosphate 56-Kinase (Itpk1) In Complex With Adp And Mn2+ Length = 347 Back     alignment and structure
>pdb|1Z2N|X Chain X, Inositol 1,3,4-trisphosphate 5/6-kinase Complexed Mg2+/adp Length = 324 Back     alignment and structure
>pdb|2ODT|X Chain X, Structure Of Human Inositol 1,3,4-Trisphosphate 56-Kinase Length = 328 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 9e-29
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 3e-27
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Length = 346 Back     alignment and structure
 Score =  107 bits (267), Expect = 9e-29
 Identities = 46/161 (28%), Positives = 77/161 (47%), Gaps = 10/161 (6%)

Query: 1   MQVIDFKDPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVV 60
           M++         + L    L+ P I K +VA GT +SH MAIVF  E    +  P   VV
Sbjct: 142 MELTSLCGDDTMRLLEKNGLTFPFICKTRVAHGT-NSHEMAIVFNQEGLNAIQPPC--VV 198

Query: 61  QEYVNHSSTLFKFYVLGENIFHAVKKSTPNSGILMKSYERNGLRPILFDSLK-SLPIDTE 119
           Q ++NH++ L+K +V+GE+     + S  N      S   +    I F+S   S P  + 
Sbjct: 199 QNFINHNAVLYKVFVVGESYTVVQRPSLKNF-----SAGTSDRESIFFNSHNVSKPESSS 253

Query: 120 NQNSGDSISCTVDL-DLELIKDAAKWLAKTLDLTIFGFDVV 159
                D I    +    E+I++ ++ L + L +++FG D++
Sbjct: 254 VLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDII 294
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Length = 324 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 99.95
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 99.67
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 99.15
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 99.1
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 99.07
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 99.05
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 98.53
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 98.52
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 98.32
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 98.31
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 98.3
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 98.3
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 98.21
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 98.17
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 98.15
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 98.1
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 98.04
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 98.04
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 97.92
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 97.9
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 97.87
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 97.85
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 97.79
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 97.76
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.74
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 97.73
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 97.65
3vot_A 425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 97.64
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 97.59
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.59
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 97.55
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 97.4
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.31
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.23
1vkz_A 412 Phosphoribosylamine--glycine ligase; TM1250, struc 96.99
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 96.98
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 96.92
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syn 96.89
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 96.85
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 96.83
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 96.81
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.79
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 96.73
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 96.72
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 96.71
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 96.55
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 96.55
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 96.52
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 96.5
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 96.48
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 96.37
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 96.35
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 96.31
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 96.27
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 96.16
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 95.99
2xcl_A 422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 95.91
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide r 95.81
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 95.81
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 95.74
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 95.61
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide 95.52
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 95.47
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 95.25
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 95.23
2qk4_A 452 Trifunctional purine biosynthetic protein adenosi; 95.23
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural ge 95.03
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 93.04
1wr2_A238 Hypothetical protein PH1789; structural genomics, 91.96
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 88.08
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 80.68
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
Probab=99.95  E-value=1.8e-27  Score=202.64  Aligned_cols=144  Identities=31%  Similarity=0.477  Sum_probs=112.2

Q ss_pred             CCChhHHHhhcCCCCceEeecccccCCccceeEEEEeCCCcCcCCCCCCceeEeeeecCCCeEEEEEEECCeEEEEEecC
Q 038140            8 DPGLPQRLSDAQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLNVPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKS   87 (159)
Q Consensus         8 ~~~~~~~l~~~~l~fP~I~Kp~~A~Gs~~sH~M~lv~~~~~L~~l~~p~p~V~QefInH~g~l~KVyViGd~v~~~~R~S   87 (159)
                      ..++.+.+...++.||+|+||+.++||. +|.|++|++.++|..+..  |+++||||+|+|+.|||||||+++.+++|+|
T Consensus       149 ~~~~~~~~~~~~lg~P~VvKP~~g~Gs~-s~~v~~v~~~~~l~~~~~--~~lvQefI~~~G~dirv~VvG~~v~~~~r~s  225 (346)
T 2q7d_A          149 GDDTMRLLEKNGLTFPFICKTRVAHGTN-SHEMAIVFNQEGLNAIQP--PCVVQNFINHNAVLYKVFVVGESYTVVQRPS  225 (346)
T ss_dssp             CTTHHHHHHHTTCCSSEEEECSBCSSTT-CCEEEEECSGGGTTC--C--CEEEEECCCCTTEEEEEEEETTEEEEEEEEC
T ss_pred             HHHHHHHHHhcCCCCCEEEEecCCCcce-eeeeEEecCHHHHHhcCC--CEEEEEeeCCCCeEEEEEEECCEEEEEEEec
Confidence            4567777777899999999999999998 999999999999999864  7999999999999999999999999999999


Q ss_pred             CCCCchhhhhhccCCccceEeccCC-CCCccccccCCCCCcc-ccCCCCHHHHHHHHHHHHHHhCCcEeeeeeC
Q 038140           88 TPNSGILMKSYERNGLRPILFDSLK-SLPIDTENQNSGDSIS-CTVDLDLELIKDAAKWLAKTLDLTIFGFDVV  159 (159)
Q Consensus        88 lpn~~~~~~~~~~~~~~~i~Fds~~-~~p~~~~~~~~~~~~~-~~~~~~~~~~~~ia~~Lr~~lGL~LfGfDvI  159 (159)
                      +||+....  +.   .+.++|++++ +.+.++......+..+ ....++.+.++++|.++++.||+++||||+|
T Consensus       226 l~~~~~~~--~~---~~~~~f~s~~~~~~g~~~~~~~~~~~~~~~~~~~~~el~~lA~~a~~alGl~~~gvDii  294 (346)
T 2q7d_A          226 LKNFSAGT--SD---RESIFFNSHNVSKPESSSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDII  294 (346)
T ss_dssp             CCCCC------C---CCCEEEEGGGTSSTTCCCGGGCCSCCCSCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEE
T ss_pred             CCCcCcCc--cc---cccccccceeeccCCccccccccccccccccCCChHHHHHHHHHHHHHhCCceEeeEEE
Confidence            99975321  12   2789999964 3333333222211111 1234557899999999999999999999986
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 98.75
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 98.61
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 98.49
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 98.08
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 97.71
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 97.38
d1a9xa6 259 Carbamoyl phosphate synthetase (CPS), large subuni 96.73
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 96.52
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 96.21
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 95.97
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 95.64
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 95.61
d1a9xa5275 Carbamoyl phosphate synthetase (CPS), large subuni 94.65
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 93.23
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 92.81
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 90.76
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: Synapsin C-terminal domain
domain: Synapsin II
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=98.75  E-value=5.4e-09  Score=79.71  Aligned_cols=69  Identities=17%  Similarity=0.227  Sum_probs=54.3

Q ss_pred             cCCCCceEeecccccCCccceeEEEEeCCCcCcCCC-----CCCceeEeeeecCCCeEEEEEEECCeEEEEEecCCCC
Q 038140           18 AQLSLPCIVKPQVACGTADSHSMAIVFGTEDFKDLN-----VPIPAVVQEYVNHSSTLFKFYVLGENIFHAVKKSTPN   90 (159)
Q Consensus        18 ~~l~fP~I~Kp~~A~Gs~~sH~M~lv~~~~~L~~l~-----~p~p~V~QefInH~g~l~KVyViGd~v~~~~R~Slpn   90 (159)
                      ....||+|+||..++   .|..+.++-++++|....     ...++++||||+ ++..++|+|+|+.+....|.+.++
T Consensus        47 ~~~~~PvVvKP~~g~---~g~Gv~~v~~~~~l~~~~~~~~~~~~~~~vqe~I~-~~~dirv~vig~~~~~~~~~~~~~  120 (206)
T d1i7na2          47 TLPTFPVVVKIGHAH---SGMGKVKVENHYDFQDIASVVALTQTYATAEPFID-AKYDIRVQKIGNNYKAYMRTSISG  120 (206)
T ss_dssp             SCCCSSEEEEESSCS---TTTTEEEECSHHHHHHHHHHHHHHTCCEEEEECCC-EEEEEEEEEETTEEEEEEEESSCT
T ss_pred             hhcCCceEEecCCCC---CCCCeEEEeecchhhhHHHHHhhccCeEEEEEeec-ccceEEEEEEecceeEEEeecccc
Confidence            457899999997766   477899999998886631     123689999996 457999999999998888776443
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure