Citrus Sinensis ID: 039387

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MPPTAANKKRIVMKRKRKSLPWGEGALNSYAGASLSLDSPDLKDNGSLDKRQYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQVRHKESSQSFFEKDDVECLAEKQTVSKRNTFGDNEECSTKDVDDGQGIKTSIKVHEPRICRGRHSNKEAMTESKDVDSKKSIRVQDSSTATNAVHHEPTTSTSRLLSLPLALIGNPVNEQGAAGKQLAENAEISMPHTDKDTTDKLLILRDVMLESMKSHDKLLQASKSAPIQNRTMVWAVSWFQLL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHcccccccccccEEEEEEEEcc
ccHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccccccccccccccHHHHHHHEccccEEEEcccccccEEEEcccccccccccccEcccccccccccccEcEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEccccHHHccccccHHHHHHccccccccEEEccccccccccccccccccccccccccHHHcccccccccccEEEEccccEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHcHHHHHHHHHHHHc
MPPTAANKKRIVMKRkrkslpwgegalnsyagaslsldspdlkdngsldkrqytigedghyYECLiccnggellccdtcpntyhlqcltppledvppgswkcpscseledlekpiSHLWKSSFKKSILASKLVMQVRhkessqsffekDDVECLAEKQtvskrntfgdneecstkdvddgqgiktsikvhepricrgrhsnkeamteskdvdskksirvqdsstatnavhhepttstsrllslplalignpvneqgaagKQLAEnaeismphtdkdttdKLLILRDVMLESMKSHDKLLQasksapiqnrtMVWAVSWFQLL
mpptaankkrivmkrkrkslpwgegALNSYAGASLSLDSPDLKDNGSLDKRQYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLtppledvppgSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQVRHKessqsffekddvECLAEKqtvskrntfgdneecstkdvddgqgiktsikvhepricrgrhsnkeamteskdvdskksirvqdsstatnavhhepttstSRLLSLPLALIGNPVNEQGAAGKQLAEnaeismphtdkdttdKLLILRDVMLESMKSHDKLLqasksapiqnrtmVWAVSWFQLL
MPPTAANKKRIVMKRKRKSLPWGEGALNSYAGASLSLDSPDLKDNGSLDKRQYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQVRHKESSQSFFEKDDVECLAEKQTVSKRNTFGDNEECSTKDVDDGQGIKTSIKVHEPRICRGRHSNKEAMTESKDVDSKKSIRVQDSSTATNAVHHEPttstsrllslplalIGNPVNEQGAAGKQLAENAEISMPHTDKDTTDKLLILRDVMLESMKSHDKLLQASKSAPIQNRTMVWAVSWFQLL
***************************************************QYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQ************************************************************************************************************PLALI********************************LLILRDVML*****************IQNRTMVWAVSWFQ**
************************************************************YYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSE********************LASKLVMQVRHKESSQSFFEKD*********************************************************************************************************************************************************************AVSWFQLL
***********VMKRKRKSLPWGEGALNSYAGASLSLDSPDLKDNGSLDKRQYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQ*************DDVECLAEKQTVSKRNTFGDNEECSTKDVDDGQGIKTSIKVHEPRICRGRHS***************************************LLSLPLALIGNPVNEQGAAGKQLAENAEISMPHTDKDTTDKLLILRDVMLESMKSHDKLLQASKSAPIQNRTMVWAVSWFQLL
******N*************PWGEGA******************************EDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQVRHKESSQSFFEKDDVECLAEKQTVSKRNTFGDNEECSTKDVD*****KTSIKVHEPRICRGRHSNKEAMTESKDVDSKKSIRV*******************RLLSLPLALIGNPVNEQGAAGKQLAENAEISMPHTDKDTTDKLLILRDVMLESMKSHDKLLQASKSAPIQNRTMVWAVSWFQLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPTAANKKRIVMKRKRKSLPWGEGALNSYAGASLSLDSPDLKDNGSLDKRQYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKPISHLWKSSFKKSILASKLVMQVRHKESSQSFFEKDDVECLAEKQTVSKRNTFGDNEECSTKDVDDGQGIKTSIKVHEPRICRGRHSNKEAMTESKDVDSKKSIRVQDSSTATNAVHHEPTTSTSRLLSLPLALIGNPVNEQGAAGKQLAENAEISMPHTDKDTTDKLLILRDVMLESMKSHDKLLQASKSAPIQNRTMVWAVSWFQLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query322 2.2.26 [Sep-21-2011]
Q6PDQ2 1915 Chromodomain-helicase-DNA yes no 0.155 0.026 0.588 1e-14
Q14839 1912 Chromodomain-helicase-DNA yes no 0.155 0.026 0.588 1e-14
O97159 1982 Chromodomain-helicase-DNA yes no 0.136 0.022 0.574 2e-13
Q8TDI0 1954 Chromodomain-helicase-DNA no no 0.127 0.020 0.574 3e-13
Q12873 2000 Chromodomain-helicase-DNA no no 0.152 0.024 0.551 6e-13
O16102 892 Chromodomain-helicase-DNA no no 0.267 0.096 0.414 7e-13
O43918545 Autoimmune regulator OS=H no no 0.133 0.078 0.581 6e-12
Q9Z0E3552 Autoimmune regulator OS=M no no 0.133 0.077 0.558 3e-11
Q6ZPK0659 PHD finger protein 21A OS no no 0.270 0.132 0.358 3e-10
Q96BD5680 PHD finger protein 21A OS no no 0.270 0.127 0.358 4e-10
>sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 Back     alignment and function desciption
 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 1/51 (1%)

Query: 57  EDGHYYE-CLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCS 106
           ED H+ E C +C +GGELLCCDTCP++YH+ CL PPL ++P G W CP C+
Sbjct: 437 EDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT 487
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 Back     alignment and function description
>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=2 SV=1 Back     alignment and function description
>sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 Back     alignment and function description
>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 Back     alignment and function description
>sp|O43918|AIRE_HUMAN Autoimmune regulator OS=Homo sapiens GN=AIRE PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0E3|AIRE_MOUSE Autoimmune regulator OS=Mus musculus GN=Aire PE=1 SV=1 Back     alignment and function description
>sp|Q6ZPK0|PF21A_MOUSE PHD finger protein 21A OS=Mus musculus GN=Phf21a PE=1 SV=2 Back     alignment and function description
>sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens GN=PHF21A PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
255544538 602 conserved hypothetical protein [Ricinus 0.670 0.358 0.353 2e-27
359472760 2355 PREDICTED: uncharacterized protein LOC10 0.332 0.045 0.465 4e-22
356510796 2325 PREDICTED: uncharacterized protein LOC10 0.319 0.044 0.464 2e-21
334188199 2223 chromatin remodeling 4 protein [Arabidop 0.344 0.049 0.398 1e-19
297737996 1638 unnamed protein product [Vitis vinifera] 0.291 0.057 0.475 2e-19
255565329 2257 chromodomain helicase DNA binding protei 0.322 0.046 0.436 3e-19
357476459 1406 Chromodomain-helicase-DNA-binding protei 0.195 0.044 0.619 4e-19
224125208 2332 chromatin remodeling complex subunit [Po 0.313 0.043 0.453 4e-19
224109066 549 predicted protein [Populus trichocarpa] 0.698 0.409 0.311 5e-19
2660669 2228 human Mi-2 autoantigen-like protein [Ara 0.329 0.047 0.398 5e-19
>gi|255544538|ref|XP_002513330.1| conserved hypothetical protein [Ricinus communis] gi|223547238|gb|EEF48733.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  129 bits (325), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 125/260 (48%), Gaps = 44/260 (16%)

Query: 47  SLDKRQYTIGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCS 106
           S D     IG+DGHYYEC+IC NGG+LLCCDTCP TYHLQCLTPPLE VP G+W+C +C 
Sbjct: 47  SFDLPPRRIGDDGHYYECVICDNGGDLLCCDTCPGTYHLQCLTPPLELVPSGNWQCENCC 106

Query: 107 ELEDLEKPISHLWKSSFKKSIL---ASKLVMQVRHKESSQSFFE---------KDDVECL 154
           +  DL  P+ +L     K++     A+  V   +  E+S +  E         K DVE  
Sbjct: 107 QAADLLTPLKYL--EGLKRNASNENATNHVGDQKETETSTAVNEIKVYRRRVRKKDVEL- 163

Query: 155 AEKQTVSKRNTFGDNEECSTKDVDDGQGIKTSIKVHEPRICRGRHSNKEA--MTESKDVD 212
            E     K     D+ E + +D  D   I TS  +  P   +   S ++A  + E+ D+ 
Sbjct: 164 -EDNHPRKLTRVNDSSEIANEDQKDIPAIDTS-GLFNPSSIKSDQSAEQADEILENDDLS 221

Query: 213 SKKSIRVQDSSTATNAVHHEPTTSTSRLLSLPLALIGNPVNEQGAAGKQLAENAEISMPH 272
           + +S++ ++S+                           PV EQG      A N  +    
Sbjct: 222 ASRSLQPKESNQK-------------------------PVEEQGGETVYRAGNINVCTNS 256

Query: 273 TDKDTTDKLLILRDVMLESM 292
              D  DKL ILRDVM ESM
Sbjct: 257 PKTDQYDKLWILRDVMQESM 276

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359472760|ref|XP_003631193.1| PREDICTED: uncharacterized protein LOC100247555 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510796|ref|XP_003524120.1| PREDICTED: uncharacterized protein LOC100793933 [Glycine max] Back     alignment and taxonomy information
>gi|334188199|ref|NP_199293.3| chromatin remodeling 4 protein [Arabidopsis thaliana] gi|332007781|gb|AED95164.1| chromatin remodeling 4 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297737996|emb|CBI27197.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565329|ref|XP_002523656.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] gi|223537108|gb|EEF38742.1| chromodomain helicase DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357476459|ref|XP_003608515.1| Chromodomain-helicase-DNA-binding protein, partial [Medicago truncatula] gi|355509570|gb|AES90712.1| Chromodomain-helicase-DNA-binding protein, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|224125208|ref|XP_002329920.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222871157|gb|EEF08288.1| chromatin remodeling complex subunit [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224109066|ref|XP_002315069.1| predicted protein [Populus trichocarpa] gi|222864109|gb|EEF01240.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|2660669|gb|AAC79140.1| human Mi-2 autoantigen-like protein [Arabidopsis thaliana] gi|9758384|dbj|BAB08833.1| helicase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
ZFIN|ZDB-GENE-030131-4532 1953 chd4b "chromodomain helicase D 0.214 0.035 0.507 2.2e-15
UNIPROTKB|F1RIM3 1723 CHD5 "Uncharacterized protein" 0.239 0.044 0.423 4.9e-14
UNIPROTKB|C9JFR1244 AIRE "Autoimmune regulator" [H 0.133 0.176 0.581 7e-14
UNIPROTKB|Q8TDI0 1954 CHD5 "Chromodomain-helicase-DN 0.239 0.039 0.423 1.3e-13
UNIPROTKB|E2R1M3 1812 CHD5 "Uncharacterized protein" 0.239 0.042 0.423 1.8e-13
FB|FBgn0023395 892 Chd3 "Chd3" [Drosophila melano 0.444 0.160 0.329 2.4e-13
UNIPROTKB|F1MFF9 1852 Bt.62145 "Uncharacterized prot 0.239 0.041 0.435 8.1e-13
UNIPROTKB|J9NRN3 1195 CHD5 "Uncharacterized protein" 0.239 0.064 0.423 8.3e-13
UNIPROTKB|F2Z2R5 1225 CHD5 "Chromodomain-helicase-DN 0.239 0.062 0.423 8.6e-13
UNIPROTKB|F5GWX5 1905 CHD4 "Chromodomain-helicase-DN 0.155 0.026 0.588 8.7e-13
ZFIN|ZDB-GENE-030131-4532 chd4b "chromodomain helicase DNA binding protein 4b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 207 (77.9 bits), Expect = 2.2e-15, Sum P(2) = 2.2e-15
 Identities = 36/71 (50%), Positives = 45/71 (63%)

Query:    36 SLDSPDLKDNGSLDKRQYTIGEDGHYYE-CLICCNGGELLCCDTCPNTYHLQCLTPPLED 94
             S +  +  D+G  D       ED H+ E C +C +GGELLCCDTCP++YHL CL PPL D
Sbjct:   432 SSEGEEENDDGRRDDGDVE-EEDDHHMEFCRVCKDGGELLCCDTCPSSYHLHCLNPPLPD 490

Query:    95 VPPGSWKCPSC 105
             +P G W CP C
Sbjct:   491 IPNGEWICPRC 501
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016818 "hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|F1RIM3 CHD5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|C9JFR1 AIRE "Autoimmune regulator" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TDI0 CHD5 "Chromodomain-helicase-DNA-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1M3 CHD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0023395 Chd3 "Chd3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFF9 Bt.62145 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NRN3 CHD5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z2R5 CHD5 "Chromodomain-helicase-DNA-binding protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GWX5 CHD4 "Chromodomain-helicase-DNA-binding protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CHR4
CHR4 (CHROMATIN REMODELING 4); ATP binding / DNA binding / chromatin binding / helicase/ nucleic acid binding / protein binding / zinc ion binding; CHROMATIN REMODELING 4 (CHR4); FUNCTIONS IN- in 7 functions; INVOLVED IN- chromatin assembly or disassembly, regulation of transcription; LOCATED IN- chromatin, nucleus; EXPRESSED IN- 24 plant structures; EXPRESSED DURING- 11 growth stages; CONTAINS InterPro DOMAIN/s- Zinc finger, PHD-type (InterPro-IPR001965), Chromo domain (InterPro-IPR000953), SNF2-related (InterPro-IPR000330), Zinc finger, RING/FYVE/PHD-type (InterPro-IPR013083), Chromo [...] (2242 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT5G05180
unknown protein; unknown protein; INVOLVED IN- biological_process unknown; EXPRESSED IN- 20 pla [...] (432 aa)
      • 0.885
AT4G07330
transposable element gene; CACTA-like transposase family (Tnp2/En/Spm), has a 2.6e-13 P-value b [...] (430 aa)
      • 0.865
AT4G30840
WD-40 repeat protein family; WD-40 repeat protein family; FUNCTIONS IN- molecular_function unkn [...] (361 aa)
    •   0.819
TPR2
TPR2 (TOPLESS-RELATED 2); TOPLESS-RELATED 2 (TPR2); INVOLVED IN- primary shoot apical meristem [...] (1131 aa)
   ••   0.787
PI
PI (PISTILLATA); DNA binding / transcription factor; Floral homeotic gene encoding a MADS domai [...] (208 aa)
    •   0.631
AG
AG (AGAMOUS); DNA binding / transcription factor; Floral homeotic gene encoding a MADS domain t [...] (252 aa)
    •   0.631
AP3
AP3 (APETALA 3); DNA binding / transcription factor; Floral homeotic gene encoding a MADS domai [...] (232 aa)
    •   0.631
AP1
AP1 (APETALA1); DNA binding / protein binding / protein heterodimerization/ transcription activ [...] (256 aa)
    •   0.631
SEP3
SEP3 (SEPALLATA3); DNA binding / protein binding / transcription factor; Member of the MADs box [...] (251 aa)
    •   0.631
AT3G19120
unknown protein; unknown protein; LOCATED IN- chloroplast; EXPRESSED IN- 16 plant structures; E [...] (446 aa)
      • 0.623

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
pfam0062851 pfam00628, PHD, PHD-finger 3e-11
smart0024947 smart00249, PHD, PHD zinc finger 2e-10
cd11726127 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-tha 8e-08
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 2e-04
cd11672120 cd11672, ADDz, ADDz for ATRX, Dnmt3 and Dnmt3l PHD 3e-04
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 57.5 bits (139), Expect = 3e-11
 Identities = 23/49 (46%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 64  CLIC---CNGGELLCCDTCPNTYHLQCLTPPLED--VPPGSWKCPSCSE 107
           C +C    + GELL CD C   +HL CL PPLE   +P G W CP C  
Sbjct: 2   CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECKP 50

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|213034 cd11726, ADDz_ATRX, ADDz domain of ATRX (alpha-thalassemia/mental retardation, X-linked) Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|213032 cd11672, ADDz, ADDz for ATRX, Dnmt3 and Dnmt3l PHD-like zinc finger domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 322
KOG4299613 consensus PHD Zn-finger protein [General function 99.11
KOG1244336 consensus Predicted transcription factor Requiem/N 99.11
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.7
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.56
KOG0383 696 consensus Predicted helicase [General function pre 98.55
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.5
KOG1973274 consensus Chromatin remodeling protein, contains P 98.5
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 98.48
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 98.21
KOG1512381 consensus PHD Zn-finger protein [General function 98.2
KOG0957707 consensus PHD finger protein [General function pre 97.77
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 97.73
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.68
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.63
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.24
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.23
KOG0954 893 consensus PHD finger protein [General function pre 97.02
KOG0956 900 consensus PHD finger protein AF10 [General functio 96.64
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.63
COG5141 669 PHD zinc finger-containing protein [General functi 96.62
KOG4299 613 consensus PHD Zn-finger protein [General function 95.59
KOG1246 904 consensus DNA-binding protein jumonji/RBP2/SMCY, c 91.3
KOG0383696 consensus Predicted helicase [General function pre 89.72
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 89.14
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 88.11
KOG0957 707 consensus PHD finger protein [General function pre 86.61
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 82.56
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 82.34
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=99.11  E-value=1.9e-11  Score=125.68  Aligned_cols=97  Identities=29%  Similarity=0.600  Sum_probs=67.2

Q ss_pred             cccccccccCCce---eecccCCCcccccccCCC--CCCCCCCCccCccCccccCCCCccchhh-----hhhhhhhH--H
Q 039387           61 YYECLICCNGGEL---LCCDTCPNTYHLQCLTPP--LEDVPPGSWKCPSCSELEDLEKPISHLW-----KSSFKKSI--L  128 (322)
Q Consensus        61 ~~~C~vC~~gG~L---l~CD~C~~~fH~~CL~PP--L~~~P~g~W~Cp~C~~~~~~~~~~~~~~-----~~~f~~~~--l  128 (322)
                      +++|..|++.|..   ||||+||++||++||+||  ...+|.|.|+|+.|..........+...     ..-|.++.  .
T Consensus       253 ~~fCsaCn~~~~F~~~i~CD~Cp~sFH~~CLePPl~~eniP~g~W~C~ec~~k~~in~~~~t~~~~~~~~~i~t~~~~~I  332 (613)
T KOG4299|consen  253 EDFCSACNGSGLFNDIICCDGCPRSFHQTCLEPPLEPENIPPGSWFCPECKIKSVINPKMETLSNRGTVVDIFTQFVSKI  332 (613)
T ss_pred             HHHHHHhCCccccccceeecCCchHHHHhhcCCCCCcccCCCCccccCCCeeeeecccchhhhhhccchHHHHHHHHHhh
Confidence            4599999999976   999999999999999999  5799999999999987765322222111     11122222  2


Q ss_pred             hhhhhhhhhcccccccccccchhhhhhhh
Q 039387          129 ASKLVMQVRHKESSQSFFEKDDVECLAEK  157 (322)
Q Consensus       129 ~~~L~~q~~~~~~~q~ff~~~d~e~l~Ek  157 (322)
                      ....++|..+++.+..+|.++..+.-+.+
T Consensus       333 Ds~np~q~~lPe~i~~~~~~v~~g~~~~~  361 (613)
T KOG4299|consen  333 DSHNPIQKILPENISESFGGVSRGDDGQY  361 (613)
T ss_pred             hccchhhhhCCHHHHhhccccccCCCCcc
Confidence            22334666667777788887665554433

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
1mm2_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 4e-12
1xwh_A66 Nmr Structure Of The First Phd Finger Of Autoimmune 8e-12
1mm3_A61 Solution Structure Of The 2nd Phd Domain From Mi2b 8e-12
2kft_A56 Nmr Solution Structure Of The First Phd Finger Doma 2e-11
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 3e-09
2yql_A56 Solution Structure Of The Phd Domain In Phd Finger 5e-09
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 1e-08
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 2e-08
2puy_A60 Crystal Structure Of The Bhc80 Phd Finger Length = 3e-08
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 4e-08
1f62_A51 Wstf-Phd Length = 51 4e-06
2ro1_A189 Nmr Solution Structures Of Human Kap1 Phd Finger-Br 3e-05
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 1e-04
1fp0_A88 Solution Structure Of The Phd Domain From The Kap-1 4e-04
>pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 38/52 (73%)
Query: 55  IGEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCS 106
           +G D H   C +C +GGELLCCDTCP++YH+ CL PPL ++P G W CP C+
Sbjct: 3   LGSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT 54
>pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 Back     alignment and structure
>pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 Back     alignment and structure
>pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 Back     alignment and structure
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure
>pdb|2RO1|A Chain A, Nmr Solution Structures Of Human Kap1 Phd Finger-Bromodomain Length = 189 Back     alignment and structure
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|1FP0|A Chain A, Solution Structure Of The Phd Domain From The Kap-1 Corepressor Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 1e-22
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 1e-22
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 5e-22
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 9e-22
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-21
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 2e-20
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-18
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 1e-16
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 4e-16
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 3e-15
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 2e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 3e-14
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 7e-05
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 5e-14
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 6e-14
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 8e-14
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 3e-13
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 3e-13
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 4e-13
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 8e-13
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-12
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 3e-12
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-09
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 5e-12
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 2e-10
2k16_A75 Transcription initiation factor TFIID subunit 3; p 9e-10
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 1e-09
2yt5_A66 Metal-response element-binding transcription facto 4e-09
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 7e-09
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 2e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 2e-05
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 4e-05
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 6e-05
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 1e-04
1weu_A91 Inhibitor of growth family, member 4; structural g 2e-04
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 3e-04
1we9_A64 PHD finger family protein; structural genomics, PH 3e-04
1wee_A72 PHD finger family protein; structural genomics, PH 4e-04
3o70_A68 PHD finger protein 13; PHF13, structural genomics 5e-04
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
 Score = 88.2 bits (219), Expect = 1e-22
 Identities = 29/51 (56%), Positives = 37/51 (72%)

Query: 56  GEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCS 106
           G D H   C +C +GGELLCCDTCP++YH+ CL PPL ++P G W CP C+
Sbjct: 4   GSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCT 54
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.6
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.57
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.56
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.56
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.55
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.54
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.54
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.52
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.52
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.43
2yt5_A66 Metal-response element-binding transcription facto 99.4
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.39
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.35
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.35
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.35
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.35
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.28
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.26
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.26
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.22
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.2
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 99.18
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 99.16
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.16
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.15
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.09
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.96
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.95
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.92
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.91
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.9
1weu_A91 Inhibitor of growth family, member 4; structural g 98.86
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.86
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.82
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.68
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.42
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 98.34
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.33
1we9_A64 PHD finger family protein; structural genomics, PH 98.2
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.14
1wil_A89 KIAA1045 protein; ring finger domain, structural g 98.12
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.11
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.1
1wee_A72 PHD finger family protein; structural genomics, PH 98.05
1wem_A76 Death associated transcription factor 1; structura 97.97
1wew_A78 DNA-binding family protein; structural genomics, P 97.91
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.87
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.79
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.74
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.63
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.52
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.43
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.98
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.68
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 96.41
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 96.31
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 96.3
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 96.23
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.07
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 95.43
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 95.17
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 94.7
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 83.72
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
Probab=99.60  E-value=5.9e-16  Score=115.02  Aligned_cols=54  Identities=52%  Similarity=1.288  Sum_probs=49.6

Q ss_pred             CccccccccccccCCceeecccCCCcccccccCCCCCCCCCCCccCccCccccC
Q 039387           57 EDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELED  110 (322)
Q Consensus        57 ~~~~~~~C~vC~~gG~Ll~CD~C~~~fH~~CL~PPL~~~P~g~W~Cp~C~~~~~  110 (322)
                      .+.++.+|.+|+.+|+||+||.|+++||++||+|||..+|.|+|+|+.|.....
T Consensus         5 ~d~~~~~C~vC~~~g~ll~Cd~C~~~fH~~Cl~ppl~~~p~g~W~C~~C~~~~~   58 (61)
T 1mm2_A            5 SDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPAL   58 (61)
T ss_dssp             SCSSCSSCTTTCCCSSCBCCSSSCCCBCSSSSSSCCSSCCSSCCCCTTTTTTCC
T ss_pred             ccCCCCcCCCCCCCCCEEEcCCCCHHHcccccCCCcCcCCCCccCChhhcCchh
Confidence            456778899999999999999999999999999999999999999999987544
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 322
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 1e-16
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 4e-16
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 2e-13
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-11
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 2e-11
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 5e-09
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 2e-08
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 8e-06
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 3e-04
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 4e-04
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Nuclear corepressor KAP-1 (TIF-1beta)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 70.8 bits (173), Expect = 1e-16
 Identities = 21/58 (36%), Positives = 29/58 (50%)

Query: 57  EDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDLEKP 114
            D     C +C   G+L+ C+ C   +HL C  P L+DVP   W C  C  L DL++ 
Sbjct: 3   LDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEE 60
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.45
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.43
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.22
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.8
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.55
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.54
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.53
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.44
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.15
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.92
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.69
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.02
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 87.15
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 85.51
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.45  E-value=3.1e-14  Score=103.64  Aligned_cols=56  Identities=52%  Similarity=1.269  Sum_probs=50.8

Q ss_pred             CCccccccccccccCCceeecccCCCcccccccCCCCCCCCCCCccCccCccccCC
Q 039387           56 GEDGHYYECLICCNGGELLCCDTCPNTYHLQCLTPPLEDVPPGSWKCPSCSELEDL  111 (322)
Q Consensus        56 ~~~~~~~~C~vC~~gG~Ll~CD~C~~~fH~~CL~PPL~~~P~g~W~Cp~C~~~~~~  111 (322)
                      +++.+.++|.+|+.+|+||+||.|+++||+.|+++++..+|.+.|+|+.|......
T Consensus         4 ~~d~~~~~C~~C~~~g~lv~Cd~C~~~~H~~C~~~~~~~~~~~~W~C~~C~~~~~k   59 (61)
T d1mm2a_           4 GSDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALK   59 (61)
T ss_dssp             CSCSSCSSCTTTCCCSSCBCCSSSCCCBCSSSSSSCCSSCCSSCCCCTTTTTTCCT
T ss_pred             CccCCcCCCcCCCCCCeEEEeCCCCccCchhhcCCCcCcCCCCcEECCCCcCcccC
Confidence            46677889999999999999999999999999999999999999999999866543
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure