Citrus Sinensis ID: 039692

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------
WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVSRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCTI
ccccccccccccccccccccccccccccEEEEEEEcccccccccEEEccEEEEEcccccEEEEEcccccEEEEEccccccEEcccEEEEEccccEEEEEEcccccEEEEEccccccccEEccccEEEEcEEEEEEcccccccccccccccccEEEEEEcccccEEEEEcccccccccccccccccEEcccccccEEEEccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccccccccccccccccccccccccEEEEEccccEEEEEEEEEcccEEEEEEEcccccEEEEEEccccccccccEEEEcccccEEEEEEccccEEEEEEccccccccccccEEEccEEEEccccccccEEEccccccccEEEEccccEEEccccccccccccEEEEEEcc
cccccccccccccccccccEcHHHHHHccEEEEEEcccccEccEEEEccEEEEEccccEEEEEEcccccEEEEcccccccccccccEEEccccEEEEEEEcccccEEEEEEcccccccccccccEEEccEEEEEcccccccccccccccccEEEEEEEcccccEEEEEccccccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEEccccccEEEEEEEcccccEEEEEccccccccccccccccccccccEEEEEcccccEEEEEEEcccccEEEEEEcccccEEEEcccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEcccEEEEccccccccccccEEEEEEEc
wlnhggdlnnrrYAYGEVLINPVTVRNLRLRWSfyagkdisatpavangvvyfpswnGYLYAVNAFNGALIWEQNlskltglsgtgIVVNVTVAVVVAVSRsngelvwstqidprprsqitmsgsVYMGAFYVGLSsleealpadqcctfrgslakldvrnGRIIWQtymlpdnggkrggysgaavwgsspaiDVIRRQkqnnqttkpthpdqcissdiyanSIVAldidsgriawakplggydifyftclvpnnpdcppgpnldadfgeapmlltistngrFRDVVVAVQKSGfawafdrdsgdiiwfklagpggregggvwgaatdgrrvytnivnndriiwstadpsnetahgpvtVVNGVLFAGsvsangstvyggvpasygciylgngytvslgkfhptwtpgtslyafcti
wlnhggdlnnrryaygEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVsrsngelvwstqidprprsqiTMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNnqttkpthpdqcissDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFawafdrdsgdIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKfhptwtpgtsLYAFCTI
WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIvvnvtvavvvavSRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLagpggregggvwgaaTDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCTI
********NNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVSRSNGELVWSTQIDPR*RSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVI*****************CISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCT*
WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVSRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCTI
WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVSRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQK**********PDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCTI
****GGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVSRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCTI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAVVVAVSRSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGGVWGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVSANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAFCTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query417 2.2.26 [Sep-21-2011]
P77931639 Polyvinylalcohol dehydrog N/A no 0.769 0.502 0.271 1e-28
Q588Z1654 Polyvinylalcohol dehydrog N/A no 0.762 0.486 0.264 5e-23
Q46444 708 Quinohemoprotein ethanol no no 0.671 0.395 0.229 7e-11
Q8GR64 690 Quinohemoprotein alcohol no no 0.666 0.402 0.229 3e-10
Q934G0 695 Lupanine 17-hydroxylase [ N/A no 0.657 0.394 0.246 7e-10
Q4W6G0 718 Quinohemoprotein alcohol no no 0.666 0.387 0.231 2e-09
O05542 757 Alcohol dehydrogenase [cy yes no 0.671 0.369 0.203 3e-08
P18278 742 Methanol dehydrogenase [c N/A no 0.683 0.384 0.212 5e-08
P28036 738 Alcohol dehydrogenase [cy N/A no 0.669 0.378 0.209 3e-07
Q5NIB1456 Outer membrane protein as yes no 0.410 0.375 0.268 5e-07
>sp|P77931|PVADH_PSESP Polyvinylalcohol dehydrogenase OS=Pseudomonas sp. GN=pvaA PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (320), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 99/364 (27%), Positives = 163/364 (44%), Gaps = 43/364 (11%)

Query: 1   WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGYL 60
           W   G  + N R+     L     V  L+++W+F      +    V    ++  S +G +
Sbjct: 147 WNGWGAGITNARFQPNPGL-TAADVPRLKVKWAFNYPGSKNGQATVVGDRLFVTSMSGAV 205

Query: 61  YAVNAFNGALIWEQNLSKLTGLS------------GTGIVVNVTVAVVVAVSRSNGELVW 108
           YA+NA  G + W  + +  T  S               I  +      VA+    G+ +W
Sbjct: 206 YALNAKTGCVYWRHDAAAATRSSVHVVQLPAGAPAQYAIFFSDWTKAAVALDAQTGKQLW 265

Query: 109 STQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPAD---QCCTFRGSLAKLDVRNGRII 165
            T ID +P  Q+T S + + G  +V +SS  EA   +   +CC FRG+L  LD  +G+++
Sbjct: 266 KTTIDDQPGVQMTGSPTYHEGKLFVPISSGNEAFATNDQWECCKFRGALVALDALSGKVL 325

Query: 166 WQTYM---------LPDNGGKRGGYSGAAVWGSSPAIDVIR---RQKQNNQTTKPTHPDQ 213
           W+TY          L   G +  G +G ++W S+P ID  R       +N  T+  H   
Sbjct: 326 WKTYTTQKEPAPFRLNKLGKQMWGPAGGSIW-SAPTIDPKRGLVYVATSNSYTEVHHEG- 383

Query: 214 CISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPM 273
                  +++++A++I++G++ W   +   D +   C  P   +CP     D   G +P+
Sbjct: 384 -------SDAVMAMEIETGKVRWINQVTKDDNYIIGC--PRAANCPEKVGPDFALGNSPI 434

Query: 274 LLTISTNGRFRDVVVAVQKSGFAWAFDRDS-GDIIWFKLAGPGGREGGGVWGAATDGRRV 332
           L T+      R  +V  QKSG  +A D D+ G++IW +   PG   GG  +G A D   V
Sbjct: 435 LHTLQDG---RQYIVVGQKSGAVYAMDPDNDGELIWMRRVSPGSELGGVEFGMAADAENV 491

Query: 333 YTNI 336
           Y  I
Sbjct: 492 YVGI 495
Catalyzes the oxidation of polyvinyl alcohol (PVA) in the polyvinyl alcohol degradation pathway.
Pseudomonas sp (taxid: 306)
EC: 1EC: .EC: 1EC: .EC: 2EC: .EC: 6
>sp|Q588Z1|PVADH_SPHS1 Polyvinylalcohol dehydrogenase OS=Sphingopyxis sp. (strain 113P3) GN=pvadh PE=1 SV=3 Back     alignment and function description
>sp|Q46444|QHED_COMTE Quinohemoprotein ethanol dehydrogenase type-1 OS=Comamonas testosteroni GN=qheDH PE=1 SV=1 Back     alignment and function description
>sp|Q8GR64|QHED_PSEPU Quinohemoprotein alcohol dehydrogenase ADH IIB OS=Pseudomonas putida GN=qbdA PE=1 SV=1 Back     alignment and function description
>sp|Q934G0|LUH_PSESP Lupanine 17-hydroxylase [cytochrome c] OS=Pseudomonas sp. GN=luh PE=1 SV=1 Back     alignment and function description
>sp|Q4W6G0|QGDA_PSEPU Quinohemoprotein alcohol dehydrogenase ADH-IIG OS=Pseudomonas putida GN=qgdA PE=1 SV=1 Back     alignment and function description
>sp|O05542|DHET_GLUOX Alcohol dehydrogenase [cytochrome c] OS=Gluconobacter oxydans (strain 621H) GN=adhA PE=1 SV=2 Back     alignment and function description
>sp|P18278|DHET_ACEAC Methanol dehydrogenase [cytochrome c] OS=Acetobacter aceti GN=adhA PE=1 SV=1 Back     alignment and function description
>sp|P28036|DHET_ACEPO Alcohol dehydrogenase [cytochrome c] OS=Acetobacter polyoxogenes GN=adhA PE=1 SV=1 Back     alignment and function description
>sp|Q5NIB1|BAMB_FRATT Outer membrane protein assembly factor BamB OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=bamB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
296086409 534 unnamed protein product [Vitis vinifera] 1.0 0.780 0.582 1e-153
296086410 536 unnamed protein product [Vitis vinifera] 0.997 0.776 0.581 1e-151
147816815510 hypothetical protein VITISV_001825 [Viti 0.968 0.792 0.561 1e-142
296082870 565 unnamed protein product [Vitis vinifera] 0.995 0.734 0.524 1e-133
356529945 580 PREDICTED: quinohaemoprotein ethanol deh 0.992 0.713 0.510 1e-125
449459518 538 PREDICTED: polyvinylalcohol dehydrogenas 0.992 0.769 0.499 1e-125
296082871 1752 unnamed protein product [Vitis vinifera] 0.990 0.235 0.496 1e-124
296082872469 unnamed protein product [Vitis vinifera] 0.932 0.829 0.513 1e-123
124360970 539 Quinonprotein alcohol dehydrogenase-like 0.995 0.769 0.5 1e-122
357501727 569 Quinohaemoprotein ethanol dehydrogenase 0.954 0.699 0.498 1e-118
>gi|296086409|emb|CBI31998.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 292/501 (58%), Positives = 349/501 (69%), Gaps = 84/501 (16%)

Query: 1   WLNHGGDLNNRR-YAYGEVLINPVTVRNLRLRWSFYAGKDISATPAVANGVVYFPSWNGY 59
           W NHGGDL+N R  +  E LINP+ +  LRL+W F+ G D +ATPAVA+GVVYFPSWNGY
Sbjct: 34  WFNHGGDLSNSRSRSIEEPLINPLLISKLRLKWKFFTGDDTTATPAVAHGVVYFPSWNGY 93

Query: 60  LYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTV-------------------AVVVAVS 100
           LYAVNAF+GAL+W Q+L +LTGLS  G+VVNVTV                   AVVVA++
Sbjct: 94  LYAVNAFSGALVWRQHLGELTGLSPAGVVVNVTVSRTTPVIAGHLLIIGIYGPAVVVAIN 153

Query: 101 RSNGELVWSTQIDPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVR 160
           R +G LVWST +D RPRSQIT SG+ Y+  FYVG+SSLE  LPA+QCCTFRGS+AKLD++
Sbjct: 154 RFSGALVWSTVLDTRPRSQITTSGTPYLEGFYVGVSSLEVTLPAEQCCTFRGSMAKLDIQ 213

Query: 161 NGRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRR-------------------QKQ 201
            G ++W+TY +PDN GK GGYSGAA+WGSSPAID  R                    Q  
Sbjct: 214 TGAVLWRTYTIPDNAGKLGGYSGAAIWGSSPAIDTKRNLVYIGTGNLYNAPTEVQQCQAN 273

Query: 202 NNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPG 261
            N  T P+ PDQCI+ D++ +SI+AL++DSG+I W +  GGYD+FYF CLVPNNP CP G
Sbjct: 274 RNNQTIPSQPDQCIAPDVHFDSILALELDSGKIRWFRQFGGYDVFYFVCLVPNNPACPTG 333

Query: 262 PNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPGGREGGG 321
           PNLDADFGEAPMLLTI  NG  RDVVVAVQKSGFAWA DRD+GDI+WF LAGPGG EGGG
Sbjct: 334 PNLDADFGEAPMLLTIFPNGTRRDVVVAVQKSGFAWALDRDTGDIVWFNLAGPGGLEGGG 393

Query: 322 VWGAATDGRRVYTNIVNND--------------------------RIIWSTADPSNETAH 355
           VWGAATDG+RVYTNIVNN                            I+WSTA+PSNETAH
Sbjct: 394 VWGAATDGKRVYTNIVNNAGVRFRLAPSNQTTTFGAWVALDANTGEIVWSTANPSNETAH 453

Query: 356 GPVTVVNGVLFAGSVSANG-------------------STVYGGVPASYGCIYLGNGYTV 396
           GPVTV NGV+FAGSV+ +G                   +TVYGG   SYGC++LG+GY+V
Sbjct: 454 GPVTVTNGVVFAGSVAPSGPFYAMDAETGTIIWTYNTNATVYGGASVSYGCVFLGHGYSV 513

Query: 397 SLGKFHPTWTPGTSLYAFCTI 417
           SL +FHPTWT G S++AFCT+
Sbjct: 514 SLARFHPTWTRGNSVFAFCTV 534

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086410|emb|CBI31999.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816815|emb|CAN66558.1| hypothetical protein VITISV_001825 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082870|emb|CBI22171.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356529945|ref|XP_003533546.1| PREDICTED: quinohaemoprotein ethanol dehydrogenase type-1-like [Glycine max] Back     alignment and taxonomy information
>gi|449459518|ref|XP_004147493.1| PREDICTED: polyvinylalcohol dehydrogenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296082871|emb|CBI22172.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082872|emb|CBI22173.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|124360970|gb|ABN08942.1| Quinonprotein alcohol dehydrogenase-like [Medicago truncatula] Back     alignment and taxonomy information
>gi|357501727|ref|XP_003621152.1| Quinohaemoprotein ethanol dehydrogenase type-1 [Medicago truncatula] gi|355496167|gb|AES77370.1| Quinohaemoprotein ethanol dehydrogenase type-1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query417
UNIPROTKB|Q8GR64 690 qbdA "Quinohemoprotein alcohol 0.690 0.417 0.224 1.2e-06
UNIPROTKB|Q0C5Y0 717 adhA "Alcohol dehydrogenase (A 0.390 0.227 0.229 4.4e-06
UNIPROTKB|Q934G0 695 luh "Lupanine 17-hydroxylase [ 0.405 0.243 0.274 4.6e-06
UNIPROTKB|Q4W6G0 718 qgdA "Quinohemoprotein alcohol 0.172 0.100 0.32 2.2e-05
UNIPROTKB|Q8EC35395 bamB "Outer membrane protein a 0.508 0.536 0.244 4.8e-05
TIGR_CMR|SO_3309395 SO_3309 "PQQ enzyme repeat dom 0.508 0.536 0.244 4.8e-05
UNIPROTKB|Q8GR64 qbdA "Quinohemoprotein alcohol dehydrogenase ADH IIB" [Pseudomonas putida (taxid:303)] Back     alignment and assigned GO terms
 Score = 144 (55.7 bits), Expect = 1.2e-06, P = 1.2e-06
 Identities = 76/339 (22%), Positives = 134/339 (39%)

Query:     1 WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAG--KDISATPAVANGVVYFP-SWN 57
             WL+HG     +R++  +  I+   VR+L L W       + + ATP   +GV+Y   SW+
Sbjct:    40 WLSHGRTYAEQRFSPLKQ-IDASNVRSLGLAWYMDLDNTRGLEATPLFHDGVIYTSMSWS 98

Query:    58 GYLYAVNAFNGALIW--EQNLSKL-------------TGLSGTGIXXXXXXXXXXXXSRS 102
               + AV+A +G  +W  +  ++K+               L G  +               
Sbjct:    99 RVI-AVDAASGKELWRYDPEVAKVKARTSCCDAVNRGVALWGDKVYVGTLDGRLIALDAK 157

Query:   103 NGELVWSTQI-DPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRN 161
              G+ +WS Q  DP     IT +  V  G   +G    E  +        RG ++  D   
Sbjct:   158 TGKAIWSQQTTDPAKPYSITGAPRVVKGKVIIGNGGAEYGV--------RGFVSAYDADT 209

Query:   162 GRIIWQTYMLPDNGGKRGGYSGAAVWGSSPAIDVIRRQKQNNQTTKPTHPDQCISSDIYA 221
             G++ W+ Y +P +          A+    P +    +  Q +Q  K         S  Y 
Sbjct:   210 GKLAWRFYTVPGD---------PALPYEHPELREAAKTWQGDQYWKLGGGGTVWDSMAYD 260

Query:   222 NSIVALDIDSGRIA-WAKPL---GGYDIFYFTCLVPNNPDC---------PPGPNLDADF 268
               +  L + +G  + W + +   GG D  Y + ++   PD           PG + D   
Sbjct:   261 PELDLLYVGTGNGSPWNREVRSPGGGDNLYLSSILAIRPDTGKLAWHYQVTPGDSWDFTA 320

Query:   269 GEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDII 307
              +   L  ++ +G+ R V++   K+GF +  DR +G +I
Sbjct:   321 TQQITLAELNIDGKPRKVLMQAPKNGFFYVLDRTNGKLI 359
GO:0005509 "calcium ion binding" evidence=IDA
GO:0009055 "electron carrier activity" evidence=IDA
GO:0016491 "oxidoreductase activity" evidence=IDA
GO:0020037 "heme binding" evidence=IDA
GO:0046872 "metal ion binding" evidence=IDA
UNIPROTKB|Q0C5Y0 adhA "Alcohol dehydrogenase (Acceptor)" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q934G0 luh "Lupanine 17-hydroxylase [cytochrome c]" [Pseudomonas sp. (taxid:306)] Back     alignment and assigned GO terms
UNIPROTKB|Q4W6G0 qgdA "Quinohemoprotein alcohol dehydrogenase ADH-IIG" [Pseudomonas putida (taxid:303)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EC35 bamB "Outer membrane protein assembly factor BamB" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3309 SO_3309 "PQQ enzyme repeat domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037024001
SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (540 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
cd10277 529 cd10277, PQQ_ADH_I, Ethanol dehydrogenase, a bacte 9e-20
TIGR03075526 TIGR03075, PQQ_enz_alc_DH, PQQ-dependent dehydroge 7e-17
cd10279 549 cd10279, PQQ_ADH_II, PQQ_like domain of the quinoh 2e-14
pfam13360234 pfam13360, PQQ_2, PQQ-like domain 9e-14
cd00216434 cd00216, PQQ_DH_like, PQQ-dependent dehydrogenases 4e-12
COG1520370 COG1520, COG1520, FOG: WD40-like repeat [Function 1e-11
cd10278 553 cd10278, PQQ_MDH, Large subunit of methanol dehydr 1e-11
TIGR03300377 TIGR03300, assembly_YfgL, outer membrane assembly 5e-10
cd10276358 cd10276, BamB_YfgL, Beta-barrel assembly machinery 7e-10
TIGR03300377 TIGR03300, assembly_YfgL, outer membrane assembly 4e-09
cd10280 616 cd10280, PQQ_mGDH, Membrane-bound PQQ-dependent gl 8e-09
TIGR03300377 TIGR03300, assembly_YfgL, outer membrane assembly 4e-07
COG1520370 COG1520, COG1520, FOG: WD40-like repeat [Function 3e-06
pfam13360234 pfam13360, PQQ_2, PQQ-like domain 5e-06
pfam1357039 pfam13570, YWTD, YWTD domain 5e-06
TIGR03300377 TIGR03300, assembly_YfgL, outer membrane assembly 9e-06
PRK11138394 PRK11138, PRK11138, outer membrane biogenesis prot 9e-06
PRK11138394 PRK11138, PRK11138, outer membrane biogenesis prot 1e-05
PRK11138394 PRK11138, PRK11138, outer membrane biogenesis prot 5e-05
PRK11138394 PRK11138, PRK11138, outer membrane biogenesis prot 9e-05
cd10276358 cd10276, BamB_YfgL, Beta-barrel assembly machinery 2e-04
COG4993 773 COG4993, Gcd, Glucose dehydrogenase [Carbohydrate 2e-04
smart0056433 smart00564, PQQ, beta-propeller repeat 2e-04
cd10276358 cd10276, BamB_YfgL, Beta-barrel assembly machinery 8e-04
cd00216434 cd00216, PQQ_DH_like, PQQ-dependent dehydrogenases 0.002
cd10280 616 cd10280, PQQ_mGDH, Membrane-bound PQQ-dependent gl 0.002
>gnl|CDD|199835 cd10277, PQQ_ADH_I, Ethanol dehydrogenase, a bacterial quinoprotein (PQQ-dependent type I alcohol dehydrogenase) Back     alignment and domain information 
 Score = 90.8 bits (226), Expect = 9e-20
 Identities = 87/337 (25%), Positives = 146/337 (43%), Gaps = 59/337 (17%)

Query: 1   WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKDI---SATPAVANGVVYFPSWN 57
           WL +G   N +RY+  +  IN   V+NL   WSF  G       + P V +GV+Y  +  
Sbjct: 11  WLTYGRGYNGQRYSPLKQ-INTDNVKNLVPAWSFSFGGKQRGQESQPIVNDGVMYVTTSY 69

Query: 58  GYLYAVNAFNGALIWEQNLSKLTGLSGTGIVVNVTVAV-------------VVAVSRSNG 104
             ++A++A  G  +W+        +     VVN  VA+             +VA+    G
Sbjct: 70  NRVFAIDAKTGKELWKYKHRLPEDIRPCCDVVNRGVALYGDKVYFGTLDAHLVALDAKTG 129

Query: 105 ELVWSTQI-DPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRNGR 163
           ++VW  ++ D +    +T++  V  G   VG+S  E  +        RG +A LD   G+
Sbjct: 130 KVVWKKKVADYKAGYSMTLAPLVVKGKVIVGVSGGEFGV--------RGFIAALDAETGK 181

Query: 164 IIWQTYMLPDNGGKRGGYS---------GAAVW--GS-SPAIDVIRRQKQNNQTTKPTHP 211
            +W+TY +P  G      +         G A W  G+  P  +++     N     P + 
Sbjct: 182 EVWRTYTVPGPGEPGSTDTWPGDAWKTGGGATWLTGTYDPETNLLYWGVGN---PAPWNG 238

Query: 212 DQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEA 271
           D     ++Y +S++ALD D+G+I W         + +T   PN+         D D    
Sbjct: 239 DLRPGDNLYTSSVLALDPDTGKIKWH--------YQYT---PNDT-------WDYDGVNE 280

Query: 272 PMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIW 308
           P+L   + NG+    +V   ++GF +  DR +G +IW
Sbjct: 281 PVLFDYTKNGKPVKALVHADRNGFFYVLDRTNGKLIW 317

This bacterial family of homodimeric ethanol dehydrogenases utilize pyrroloquinoline quinone (PQQ) as a cofactor. It represents proteins whose expression may be induced by ethanol, and which are similar to quinoprotein methanol dehydrogenases, but have higher specificities for ethanol and other primary and secondary alcohols. Dehydrogenases with PQQ cofactors, such as ethanol, methanol, and membrane-bound glucose dehydrogenases, form an 8-bladed beta-propeller. Length = 529
>gnl|CDD|234102 TIGR03075, PQQ_enz_alc_DH, PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>gnl|CDD|199837 cd10279, PQQ_ADH_II, PQQ_like domain of the quinohemoprotein alcohol dehydrogenase (type II) Back     alignment and domain information
>gnl|CDD|222072 pfam13360, PQQ_2, PQQ-like domain Back     alignment and domain information
>gnl|CDD|199833 cd00216, PQQ_DH_like, PQQ-dependent dehydrogenases and related proteins Back     alignment and domain information
>gnl|CDD|224437 COG1520, COG1520, FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>gnl|CDD|199836 cd10278, PQQ_MDH, Large subunit of methanol dehydrogenase (moxF) Back     alignment and domain information
>gnl|CDD|234163 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>gnl|CDD|199834 cd10276, BamB_YfgL, Beta-barrel assembly machinery (Bam) complex component B and related proteins Back     alignment and domain information
>gnl|CDD|234163 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>gnl|CDD|199838 cd10280, PQQ_mGDH, Membrane-bound PQQ-dependent glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|234163 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>gnl|CDD|224437 COG1520, COG1520, FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>gnl|CDD|222072 pfam13360, PQQ_2, PQQ-like domain Back     alignment and domain information
>gnl|CDD|222231 pfam13570, YWTD, YWTD domain Back     alignment and domain information
>gnl|CDD|234163 TIGR03300, assembly_YfgL, outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>gnl|CDD|236857 PRK11138, PRK11138, outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>gnl|CDD|236857 PRK11138, PRK11138, outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>gnl|CDD|236857 PRK11138, PRK11138, outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>gnl|CDD|236857 PRK11138, PRK11138, outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>gnl|CDD|199834 cd10276, BamB_YfgL, Beta-barrel assembly machinery (Bam) complex component B and related proteins Back     alignment and domain information
>gnl|CDD|227326 COG4993, Gcd, Glucose dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|128836 smart00564, PQQ, beta-propeller repeat Back     alignment and domain information
>gnl|CDD|199834 cd10276, BamB_YfgL, Beta-barrel assembly machinery (Bam) complex component B and related proteins Back     alignment and domain information
>gnl|CDD|199833 cd00216, PQQ_DH_like, PQQ-dependent dehydrogenases and related proteins Back     alignment and domain information
>gnl|CDD|199838 cd10280, PQQ_mGDH, Membrane-bound PQQ-dependent glucose dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 417
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 100.0
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 100.0
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 100.0
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 100.0
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 100.0
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 100.0
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 100.0
COG4993 773 Gcd Glucose dehydrogenase [Carbohydrate transport 99.97
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 99.97
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 99.94
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.92
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 99.91
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 99.89
COG1520370 FOG: WD40-like repeat [Function unknown] 99.88
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.87
COG1520370 FOG: WD40-like repeat [Function unknown] 99.8
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 99.71
COG4993773 Gcd Glucose dehydrogenase [Carbohydrate transport 99.53
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 98.6
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 98.41
PF1357040 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A. 98.28
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 97.95
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.93
PF0101138 PQQ: PQQ enzyme repeat family.; InterPro: IPR00237 97.88
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.67
PF05567335 Neisseria_PilC: Neisseria PilC beta-propeller doma 97.55
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 97.53
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 97.43
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.4
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.33
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 97.0
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.9
KOG0316307 consensus Conserved WD40 repeat-containing protein 96.85
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.85
KOG1539 910 consensus WD repeat protein [General function pred 96.79
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 96.78
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 96.73
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.66
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.62
KOG0296399 consensus Angio-associated migratory cell protein 96.6
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.47
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 96.44
COG3419 1036 PilY1 Tfp pilus assembly protein, tip-associated a 96.33
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.31
KOG0296399 consensus Angio-associated migratory cell protein 95.92
PF05567335 Neisseria_PilC: Neisseria PilC beta-propeller doma 95.72
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.7
KOG1539 910 consensus WD repeat protein [General function pred 95.62
PF09910339 DUF2139: Uncharacterized protein conserved in arch 95.16
PTZ00421493 coronin; Provisional 94.71
KOG0275508 consensus Conserved WD40 repeat-containing protein 94.62
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.62
KOG0646 476 consensus WD40 repeat protein [General function pr 94.57
KOG0278334 consensus Serine/threonine kinase receptor-associa 94.33
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.25
KOG2048 691 consensus WD40 repeat protein [General function pr 94.16
KOG0278334 consensus Serine/threonine kinase receptor-associa 93.79
KOG2103 910 consensus Uncharacterized conserved protein [Funct 93.64
KOG2048 691 consensus WD40 repeat protein [General function pr 93.26
PF09910339 DUF2139: Uncharacterized protein conserved in arch 92.35
KOG4693392 consensus Uncharacterized conserved protein, conta 92.06
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 91.22
KOG2103 910 consensus Uncharacterized conserved protein [Funct 90.89
PLN00181793 protein SPA1-RELATED; Provisional 90.81
PHA02713557 hypothetical protein; Provisional 90.62
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 90.45
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 90.42
KOG0316307 consensus Conserved WD40 repeat-containing protein 90.17
COG4946668 Uncharacterized protein related to the periplasmic 89.95
KOG2055514 consensus WD40 repeat protein [General function pr 89.68
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 88.0
KOG1027 903 consensus Serine/threonine protein kinase and endo 87.53
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 87.5
KOG0286343 consensus G-protein beta subunit [General function 87.16
KOG0643327 consensus Translation initiation factor 3, subunit 86.85
COG3823262 Glutamine cyclotransferase [Posttranslational modi 86.77
PLN00181793 protein SPA1-RELATED; Provisional 86.48
KOG0649325 consensus WD40 repeat protein [General function pr 84.93
KOG3881412 consensus Uncharacterized conserved protein [Funct 84.64
PHA02713 557 hypothetical protein; Provisional 83.78
KOG0318 603 consensus WD40 repeat stress protein/actin interac 83.44
COG3419 1036 PilY1 Tfp pilus assembly protein, tip-associated a 83.38
KOG1027 903 consensus Serine/threonine protein kinase and endo 83.35
KOG0295406 consensus WD40 repeat-containing protein [Function 83.28
KOG0646 476 consensus WD40 repeat protein [General function pr 82.98
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 82.39
PTZ00420 568 coronin; Provisional 81.74
PHA02790480 Kelch-like protein; Provisional 81.52
KOG4693 392 consensus Uncharacterized conserved protein, conta 80.91
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 80.47
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 80.47
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information 
Probab=100.00  E-value=1.1e-43  Score=363.42  Aligned_cols=362  Identities=25%  Similarity=0.445  Sum_probs=276.7

Q ss_pred             CCCCCCCCCCCccccCCcccCccccccceeeeEEEeCC--ceeeCcEEECCEEEEeccCCcEEEEECCCCccceEeeccc
Q 039692            1 WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGK--DISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSK   78 (417)
Q Consensus         1 Wp~~~~~~~~~~~~~~~~~i~~~~~~~~~~~W~~~~~~--~~~~~p~~~~g~v~v~~~~g~l~ald~~tG~~~W~~~~~~   78 (417)
                      ||+|++|+.++||++..+ |++.|+.+++++|++.++.  .+.++|++.+++||+++.++.|+|||++||+++|+++...
T Consensus        21 W~~~g~~~~~~r~s~l~q-I~~~nv~~L~~~W~~~~g~~~g~~stPvv~~g~vyv~s~~g~v~AlDa~TGk~lW~~~~~~   99 (527)
T TIGR03075        21 WLTYGGGYAGQRYSPLDQ-INTENVKKLQPAWTFSLGKLRGQESQPLVVDGVMYVTTSYSRVYALDAKTGKELWKYDPKL   99 (527)
T ss_pred             ccccCCCCCCcccCChHh-cChhhhccceEEEEEECCCCCCcccCCEEECCEEEEECCCCcEEEEECCCCceeeEecCCC
Confidence            999999999999999887 9999999999999999975  3689999999999999999999999999999999998753


Q ss_pred             ccCCcc---e-----e-eEEee--e----eeEEEEEecCCCceeeeeecCCCC-CcceeeceeEEcCeEEEEeCCccCcc
Q 039692           79 LTGLSG---T-----G-IVVNV--T----VAVVVAVSRSNGELVWSTQIDPRP-RSQITMSGSVYMGAFYVGLSSLEEAL  142 (417)
Q Consensus        79 ~~~~~p---~-----~-~v~~~--~----v~~l~ald~~tG~~~W~~~~~~~~-~~~~~~sp~v~~~~v~v~~~~~~~~~  142 (417)
                      .....+   +     + .+.++  +    .++|+|||++|||++|++++.... ...+.++|++.+++||++..+.+.. 
T Consensus       100 ~~~~~~~~~~~~~~rg~av~~~~v~v~t~dg~l~ALDa~TGk~~W~~~~~~~~~~~~~tssP~v~~g~Vivg~~~~~~~-  178 (527)
T TIGR03075       100 PDDVIPVMCCDVVNRGVALYDGKVFFGTLDARLVALDAKTGKVVWSKKNGDYKAGYTITAAPLVVKGKVITGISGGEFG-  178 (527)
T ss_pred             CcccccccccccccccceEECCEEEEEcCCCEEEEEECCCCCEEeecccccccccccccCCcEEECCEEEEeecccccC-
Confidence            211111   1     1 12222  1    289999999999999999874322 2347789999999999987653321 


Q ss_pred             ccCcccCCCceEEEEeCCCCceeceeeecCCCCC-----------CCC---------CCCCccccCCCceeecccCcccC
Q 039692          143 PADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGG-----------KRG---------GYSGAAVWGSSPAIDVIRRQKQN  202 (417)
Q Consensus       143 ~~~~~~~~~g~l~ald~~tG~~~W~~~~~~~~~~-----------~~~---------~~~gg~~~~~~pa~d~~~~~~~~  202 (417)
                             .+|.|+|||++||+++|++...+....           .++         ..+|+++|+. +++|++++..+.
T Consensus       179 -------~~G~v~AlD~~TG~~lW~~~~~p~~~~~~~~~~~~~~~~~~~~tw~~~~~~~gg~~~W~~-~s~D~~~~lvy~  250 (527)
T TIGR03075       179 -------VRGYVTAYDAKTGKLVWRRYTVPGDMGYLDKADKPVGGEPGAKTWPGDAWKTGGGATWGT-GSYDPETNLIYF  250 (527)
T ss_pred             -------CCcEEEEEECCCCceeEeccCcCCCcccccccccccccccccCCCCCCccccCCCCccCc-eeEcCCCCeEEE
Confidence                   268999999999999999998654311           111         1367899974 799999986332


Q ss_pred             CC-CCCCCCCCCcccCCCCCCeEEEEECCCCceEEEecCCCCcceeeeccCCCCCCCCCCCCCCCccCCCceEEEEecCC
Q 039692          203 NQ-TTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTISTNG  281 (417)
Q Consensus       203 ~~-~~~p~~~~~~v~~~~~~~~l~ald~~tG~~~W~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~p~v~~~~~~G  281 (417)
                      .. ...|.-.......+.+...|+|||++|||++|.|+..+++.|+                  ++..+.|+|+++..+|
T Consensus       251 ~tGnp~p~~~~~r~gdnl~~~s~vAld~~TG~~~W~~Q~~~~D~wD------------------~d~~~~p~l~d~~~~G  312 (527)
T TIGR03075       251 GTGNPSPWNSHLRPGDNLYTSSIVARDPDTGKIKWHYQTTPHDEWD------------------YDGVNEMILFDLKKDG  312 (527)
T ss_pred             eCCCCCCCCCCCCCCCCccceeEEEEccccCCEEEeeeCCCCCCcc------------------ccCCCCcEEEEeccCC
Confidence            11 1233333444455666789999999999999999999999994                  4556899999998899


Q ss_pred             eeeeEEEEEcccceEEEEECCCCcEE----------EEeecCC-------------------------CCCCCcceec-c
Q 039692          282 RFRDVVVAVQKSGFAWAFDRDSGDII----------WFKLAGP-------------------------GGREGGGVWG-A  325 (417)
Q Consensus       282 ~~~~~v~~~~~~G~l~ald~~tG~~l----------W~~~~~~-------------------------~~~~g~~~~~-~  325 (417)
                      +..++|.+++++|.+|+||++|||++          |...+++                         +...|+..|. +
T Consensus       313 ~~~~~v~~~~K~G~~~vlDr~tG~~i~~~~~~~~~~w~~~~~~~~g~p~~~~~~~~~~~~~~~~~~~~Pg~~Gg~~W~~~  392 (527)
T TIGR03075       313 KPRKLLAHADRNGFFYVLDRTNGKLLSAEPFVDTVNWATGVDLKTGRPIEVPEARSADGKKGKPVGVCPGFLGGKNWQPM  392 (527)
T ss_pred             cEEEEEEEeCCCceEEEEECCCCceeccccccCCcccccccCCCCCCCccChhhCcCCCCCCCeeEECCCCcCCCCCCCc
Confidence            88889999999999999999999997          4322210                         1223444443 2


Q ss_pred             ccc--------------------------------------------CCeEEEEeccCCceeeeecCCCCCCCccceeee
Q 039692          326 ATD--------------------------------------------GRRVYTNIVNNDRIIWSTADPSNETAHGPVTVV  361 (417)
Q Consensus       326 ~~~--------------------------------------------~~~vy~~~~~~~~~~W~~~~~~~~~~~~p~~~~  361 (417)
                      ++|                                            -+.|.+.|..+++++|+.+... ...++|++..
T Consensus       393 A~Dp~~g~~yvp~~~~~~~~~~~~~~~~~g~~~~~~~~~~~p~~~~~~g~l~AiD~~tGk~~W~~~~~~-p~~~~~l~t~  471 (527)
T TIGR03075       393 AYSPKTGLFYVPANEVCMDYEPEKVSYKKGAAYLGAGLTIKPPPDDHMGSLIAWDPITGKIVWEHKEDF-PLWGGVLATA  471 (527)
T ss_pred             eECCCCCEEEEecccccccccccccccCCCCceeccccccCCCCCCCceeEEEEeCCCCceeeEecCCC-CCCCcceEEC
Confidence            222                                            1346677777889999998763 5577888889


Q ss_pred             CCeEEeccCCCC--------CC---------eecccccc--cCCeEEEe
Q 039692          362 NGVLFAGSVSAN--------GS---------TVYGGVPA--SYGCIYLG  391 (417)
Q Consensus       362 ~~~v~~~~~~g~--------g~---------~~~~sp~~--~~g~lyv~  391 (417)
                      +++||+++.+|.        |+         ...++|+.  +||++||.
T Consensus       472 g~lvf~g~~~G~l~a~D~~TGe~lw~~~~g~~~~a~P~ty~~~G~qYv~  520 (527)
T TIGR03075       472 GDLVFYGTLEGYFKAFDAKTGEELWKFKTGSGIVGPPVTYEQDGKQYVA  520 (527)
T ss_pred             CcEEEEECCCCeEEEEECCCCCEeEEEeCCCCceecCEEEEeCCEEEEE
Confidence            999999988877        44         44588997  89999994

This protein family has a phylogenetic distribution very similar to that coenzyme PQQ biosynthesis enzymes, as shown by partial phylogenetic profiling. Genes in this family often are found adjacent to the PQQ biosynthesis genes themselves. An unusual, strained disulfide bond between adjacent Cys residues contributes to PQQ-binding, as does a Trp residue that is part of a PQQ enzyme repeat (see pfam01011). Characterized members include the dehydrogenase subunit of a membrane-anchored, three subunit alcohol (ethanol) dehydrogenase of Gluconobacter suboxydans, a homodimeric ethanol dehydrogenase in Pseudomonas aeruginosa, and the large subunit of an alpha2/beta2 heterotetrameric methanol dehydrogenase in Methylobacterium extorquens.
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG4993 Gcd Glucose dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4993 Gcd Glucose dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>PF13570 PQQ_3: PQQ-like domain; PDB: 3HXJ_B 3Q54_A Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF01011 PQQ: PQQ enzyme repeat family Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PF05567 Neisseria_PilC: Neisseria PilC beta-propeller domain; InterPro: IPR008707 This domain is found in several PilC protein sequences from Neisseria gonorrhoeae and Neisseria meningitidis Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>COG3419 PilY1 Tfp pilus assembly protein, tip-associated adhesin PilY1 [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>PF05567 Neisseria_PilC: Neisseria PilC beta-propeller domain; InterPro: IPR008707 This domain is found in several PilC protein sequences from Neisseria gonorrhoeae and Neisseria meningitidis Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2103 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2103 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>COG3419 PilY1 Tfp pilus assembly protein, tip-associated adhesin PilY1 [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
1kv9_A 668 Structure At 1.9 A Resolution Of A Quinohemoprotein 5e-09
1yiq_A 689 Molecular Cloning And Structural Analysis Of Quinoh 2e-08
1kb0_A 677 Crystal Structure Of Quinohemoprotein Alcohol Dehyd 1e-07
3p1l_A393 Crystal Structure Of Escherichia Coli Bamb, A Lipop 4e-04
3prw_A377 Crystal Structure Of The Lipoprotein Bamb Length = 4e-04
3q7o_A376 The Crystal Structure Of Bamb From The Bam Complex 5e-04
2yh3_A379 The Structure Of Bamb From E. Coli Length = 379 5e-04
3q54_A368 Crystal Structure Of Escherichia Coli Bamb Length = 5e-04
3q7m_A376 The Crystal Structure Of Bamb From The Bam Complex 7e-04
>pdb|1KV9|A Chain A, Structure At 1.9 A Resolution Of A Quinohemoprotein Alcohol Dehydrogenase From Pseudomonas Putida Hk5 Length = 668 Back     alignment and structure 
Iteration: 1

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 134/350 (38%), Gaps = 73/350 (20%)
Query: 1   WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRW--SFYAGKDISATPAVANGVVYFP-SWN 57
           WL+HG     +R++  +  I+   VR+L L W       + + ATP   +GV+Y   SW+
Sbjct: 18  WLSHGRTYAEQRFSPLK-QIDASNVRSLGLAWYMDLDNTRGLEATPLFHDGVIYTSMSWS 76
Query: 58  GYLYAVNAFNGALIWEQN---------------LSKLTGLSGTGIXXXXXXXXXXXXSRS 102
             + AV+A +G  +W  +               +++   L G  +               
Sbjct: 77  -RVIAVDAASGKELWRYDPEVAKVKARTSCCDAVNRGVALWGDKVYVGTLDGRLIALDAK 135
Query: 103 NGELVWSTQI-DPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVRN 161
            G+ +WS Q  DP     IT +  V  G   +G    E  +        RG ++  D   
Sbjct: 136 TGKAIWSQQTTDPAKPYSITGAPRVVKGKVIIGNGGAEYGV--------RGFVSAYDADT 187
Query: 162 GRIIWQTYMLP---------------------DNGGKRGGYSGAAVWGS---SPAIDVIR 197
           G++ W+ Y +P                     D   K GG  G  VW S    P +D++ 
Sbjct: 188 GKLAWRFYTVPGDPALPYEHPELREAAKTWQGDQYWKLGG--GGTVWDSMAYDPELDLLY 245
Query: 198 RQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPD 257
               N               ++Y +SI+A+  D+G++AW                  +  
Sbjct: 246 VGTGNGSPWNREVRSPGGGDNLYLSSILAIRPDTGKLAW------------------HYQ 287
Query: 258 CPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDII 307
             PG + D    +   L  ++ +G+ R V++   K+GF +  DR +G +I
Sbjct: 288 VTPGDSWDFTATQQITLAELNIDGKPRKVLMQAPKNGFFYVLDRTNGKLI 337
>pdb|1YIQ|A Chain A, Molecular Cloning And Structural Analysis Of Quinohemoprotein Alcohol Dehydrogenase Adhiig From Pseudomonas Putida Hk5. Compariison To The Other Quinohemoprotein Alcohol Dehydrogenase Adhiib Found In The Same Microorganism Length = 689 Back     alignment and structure
>pdb|1KB0|A Chain A, Crystal Structure Of Quinohemoprotein Alcohol Dehydrogenase From Comamonas Testosteroni Length = 677 Back     alignment and structure
>pdb|3P1L|A Chain A, Crystal Structure Of Escherichia Coli Bamb, A Lipoprotein Component Of The Beta-Barrel Assembly Machinery Complex, Native Crystals Length = 393 Back     alignment and structure
>pdb|3PRW|A Chain A, Crystal Structure Of The Lipoprotein Bamb Length = 377 Back     alignment and structure
>pdb|3Q7O|A Chain A, The Crystal Structure Of Bamb From The Bam Complex In Spacegroup P213 Length = 376 Back     alignment and structure
>pdb|2YH3|A Chain A, The Structure Of Bamb From E. Coli Length = 379 Back     alignment and structure
>pdb|3Q54|A Chain A, Crystal Structure Of Escherichia Coli Bamb Length = 368 Back     alignment and structure
>pdb|3Q7M|A Chain A, The Crystal Structure Of Bamb From The Bam Complex In Spacegroup I222 Length = 376 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query417
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 2e-27
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 5e-27
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 3e-26
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 3e-26
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 6e-24
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 7e-22
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 7e-21
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 2e-15
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 5e-11
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 2e-15
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 2e-12
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 2e-14
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 4e-11
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 4e-08
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Length = 689 Back     alignment and structure
 Score =  113 bits (285), Expect = 2e-27
 Identities = 77/353 (21%), Positives = 130/353 (36%), Gaps = 72/353 (20%)

Query: 1   WLNHGGDLNNRRYAYGEVL--INPVTVRNLRLRWSFYAGKD--ISATPAVANGVVYFPSW 56
           W++ G   + +RY+    L  I+   V  L L WS+    D  + ATP V +GV+Y    
Sbjct: 22  WMSTGRTYDEQRYS---PLKQISDQNVGQLGLAWSYKLDLDRGVEATPIVVDGVMYTTGP 78

Query: 57  NGYLYAVNAFNGALIW--EQNLSKLTGLSGTGIVVNVTVAV-------------VVAVSR 101
              +YA++A +G LIW  +    +          VN  VAV             + A+  
Sbjct: 79  FSVVYALDARDGRLIWKYDPQSDRHRAGEACCDAVNRGVAVWKGKVYVGVLDGRLEAIDA 138

Query: 102 SNGELVWSTQI--DPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDV 159
             G+  WS     D +    IT +  V  G   +G    E           RG +   D 
Sbjct: 139 KTGQRAWSVDTRADHKRSYTITGAPRVVNGKVVIGNGGAEFG--------VRGYVTAYDA 190

Query: 160 RNGRIIWQTYMLPDNGGKRGGY-------------------SGAAVWGSS---PAIDVIR 197
             G+  W+ Y +P +                           G   W S    P ++++ 
Sbjct: 191 ETGKEAWRFYTVPGDPKLPPEGKGMEIAAKTWFGDAYVEQGGGGTAWDSFAYDPELNLLY 250

Query: 198 RQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPD 257
               N     P    Q    +++ +SIVA++ D+G   W          ++         
Sbjct: 251 IGVGNGSLWDPKWRSQAKGDNLFLSSIVAVNADTGEYVW----------HYQTT------ 294

Query: 258 CPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFK 310
             PG   D    +  +L  +  +G+ R V++   K+GF +  DR +G+++  K
Sbjct: 295 --PGDAWDYTATQHMILAELPIDGKPRKVLMQAPKNGFFYVIDRATGELLSAK 345
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Length = 668 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Length = 677 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Length = 571 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Length = 599 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Length = 582 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A Length = 376 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Length = 369 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Length = 369 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Length = 330 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Length = 330 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 100.0
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 100.0
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 100.0
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 100.0
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 100.0
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 100.0
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 100.0
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.97
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.95
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.95
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.95
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.93
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.93
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.92
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.9
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.88
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.84
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.81
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 99.74
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.72
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.69
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 99.65
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.16
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.08
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.02
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.97
3hx6_A 570 Type 4 fimbrial biogenesis protein PILY1; beta pro 98.6
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.57
3hx6_A 570 Type 4 fimbrial biogenesis protein PILY1; beta pro 98.55
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.55
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.51
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.49
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.48
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.44
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.34
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.26
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.23
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.19
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.19
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.17
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.14
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.11
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.1
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.08
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.08
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.08
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.05
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.04
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.01
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.98
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.98
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.97
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.95
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.93
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.87
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.87
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.86
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.85
2zux_A 591 YESW protein; beta-propeller, lyase, rhamnose comp 97.84
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.83
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.83
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.81
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.81
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.78
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.77
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.77
2zux_A591 YESW protein; beta-propeller, lyase, rhamnose comp 97.74
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.73
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 97.71
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.68
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.65
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.65
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.64
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.63
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.63
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.62
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.61
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 97.58
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 97.57
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.56
2zuy_A 620 YESX protein; beta-propeller, lyase; 1.65A {Bacill 97.55
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.53
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 97.49
2zuy_A620 YESX protein; beta-propeller, lyase; 1.65A {Bacill 97.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.46
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.46
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.46
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.43
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.4
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.37
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.33
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.33
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.22
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.22
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.16
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.13
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 97.12
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.03
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.02
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.94
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.94
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.94
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.89
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.87
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.87
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.86
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.83
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.82
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.81
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.77
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.76
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.75
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.66
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.64
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.63
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.63
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.62
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.58
3v9f_A781 Two-component system sensor histidine kinase/RESP 96.56
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.55
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.51
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.5
3jrp_A379 Fusion protein of protein transport protein SEC13 96.47
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.46
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.44
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.42
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.37
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.35
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 96.35
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 96.35
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 96.29
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.27
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.24
3elq_A571 Arylsulfate sulfotransferase; beta propeller, prot 96.23
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.2
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.2
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.08
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.0
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.94
4a2l_A 795 BT_4663, two-component system sensor histidine kin 95.88
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.86
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.85
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.85
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 95.83
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.75
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.74
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.73
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.65
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 95.49
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 95.46
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.46
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.39
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.34
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 95.3
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.27
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 95.25
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.17
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.11
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 95.08
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 94.93
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.92
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 94.89
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.89
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 94.85
2ymu_A577 WD-40 repeat protein; unknown function, two domain 94.82
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.77
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 94.68
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.64
3jrp_A379 Fusion protein of protein transport protein SEC13 94.59
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 94.58
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.54
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.37
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.34
3elq_A571 Arylsulfate sulfotransferase; beta propeller, prot 94.13
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 94.04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 93.92
3jro_A 753 Fusion protein of protein transport protein SEC13 93.91
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.68
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 93.65
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 93.41
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 93.34
2ymu_A577 WD-40 repeat protein; unknown function, two domain 93.25
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 93.04
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.03
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 92.98
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 92.95
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 92.9
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 92.81
2p4o_A306 Hypothetical protein; putative lactonase, structur 92.66
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 92.6
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 92.36
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 92.05
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.04
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.01
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 91.85
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.75
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.73
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.47
3ott_A758 Two-component system sensor histidine kinase; beta 91.26
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 91.14
2xyi_A430 Probable histone-binding protein CAF1; transcripti 90.98
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 90.84
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 90.72
2ece_A462 462AA long hypothetical selenium-binding protein; 90.25
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 89.95
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.64
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 89.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 89.39
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 88.91
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 88.16
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 88.06
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 88.01
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 87.79
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 87.31
3jro_A 753 Fusion protein of protein transport protein SEC13 87.06
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 87.05
2ece_A462 462AA long hypothetical selenium-binding protein; 86.56
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 86.55
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 86.34
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 86.1
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 86.1
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 85.93
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 85.64
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 85.51
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 85.48
2p4o_A306 Hypothetical protein; putative lactonase, structur 84.59
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 84.33
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 84.24
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 83.83
3ott_A 758 Two-component system sensor histidine kinase; beta 83.77
3v65_B386 Low-density lipoprotein receptor-related protein; 83.41
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 83.13
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 82.92
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 82.68
2qe8_A343 Uncharacterized protein; structural genomics, join 82.37
2xyi_A430 Probable histone-binding protein CAF1; transcripti 81.51
1k32_A 1045 Tricorn protease; protein degradation, substrate g 80.83
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 80.43
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 80.35
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 80.3
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 80.17
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 80.1
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-41  Score=351.16  Aligned_cols=363  Identities=19%  Similarity=0.318  Sum_probs=267.2

Q ss_pred             CCCCCCCCCCCccccCCcccCccccccceeeeEEEeCC--ceeeCcEEECCEEEEecc-CCcEEEEEC-CCCccceEeec
Q 039692            1 WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGK--DISATPAVANGVVYFPSW-NGYLYAVNA-FNGALIWEQNL   76 (417)
Q Consensus         1 Wp~~~~~~~~~~~~~~~~~i~~~~~~~~~~~W~~~~~~--~~~~~p~~~~g~v~v~~~-~g~l~ald~-~tG~~~W~~~~   76 (417)
                      ||||++++.++||++..+ |++.|+.+++++|++.++.  .+.++|++.+++||+++. ++.|+|||+ +||+++|++++
T Consensus        14 W~~~gg~~~~~~~s~l~~-i~~~nv~~l~~~W~~~~g~~~g~~~tP~v~~g~vyv~~~~~~~v~AlD~~~tG~~lW~~~~   92 (599)
T 1w6s_A           14 WVMPGKNYDSNNFSDLKQ-INKGNVKQLRPAWTFSTGLLNGHEGAPLVVDGKMYIHTSFPNNTFALGLDDPGTILWQDKP   92 (599)
T ss_dssp             BCSTTSSTTCCCEECCCS-SCTTTGGGEEEEEEEECSCCSCCCSCCEEETTEEEEECSTTTCEEEEETTCTTSEEEEECC
T ss_pred             CcccCCCCCCCeecchhc-cCccccCCCcEEEEEECCCCCCceeccEEECCEEEEEeCCCCEEEEEeCCCCCcEEEEECC
Confidence            999999999999999887 9999999999999999975  357899999999999998 899999999 99999999998


Q ss_pred             ccccCCcc--------ee-eE--Eeee----e------eEEEEEecCCCceeeeeecCCC-CCcceeeceeEEcCeEEEE
Q 039692           77 SKLTGLSG--------TG-IV--VNVT----V------AVVVAVSRSNGELVWSTQIDPR-PRSQITMSGSVYMGAFYVG  134 (417)
Q Consensus        77 ~~~~~~~p--------~~-~v--~~~~----v------~~l~ald~~tG~~~W~~~~~~~-~~~~~~~sp~v~~~~v~v~  134 (417)
                      .......+        .+ .+  .++.    +      +.|+|||++||+++|++++... ....+.++|++.+++||++
T Consensus        93 ~~~~~~~~~~~~~~~~~g~av~p~~g~~~~rV~v~t~dg~l~AlDa~TG~~~W~~~~~~~~~~~~~~ssP~v~~g~V~vg  172 (599)
T 1w6s_A           93 KQNPAARAVACCDLVNRGLAYWPGDGKTPALILKTQLDGNVAALNAETGETVWKVENSDIKVGSTLTIAPYVVKDKVIIG  172 (599)
T ss_dssp             CCCGGGGGGCSSCSCCCCCEEECCCSSSCCEEEEECTTSEEEEEETTTCCEEEEEECCCGGGTCBCCSCCEEETTEEEEC
T ss_pred             CCCccccccccccccccceEEEecCCcceeEEEEEcCCCEEEEEECCCCCEEEeecCCCCCccceeecCCEEECCEEEEE
Confidence            75321110        01 13  2322    2      8999999999999999997542 1224778999999999998


Q ss_pred             eCCccCccccCcccCCCceEEEEeCCCCceeceeeecCCCCC----C-------------------CC---CCCCccccC
Q 039692          135 LSSLEEALPADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGG----K-------------------RG---GYSGAAVWG  188 (417)
Q Consensus       135 ~~~~~~~~~~~~~~~~~g~l~ald~~tG~~~W~~~~~~~~~~----~-------------------~~---~~~gg~~~~  188 (417)
                      ....+..        .++.|+|||++||+++|+++..+....    .                   .+   ..++++.|+
T Consensus       173 ~~g~e~g--------~~g~v~A~D~~TG~~~W~~~~~~~~~~~~~~p~~~~~~~~~g~~~~g~~tw~g~~~~~gg~~~W~  244 (599)
T 1w6s_A          173 SSGAELG--------VRGYLTAYDVKTGEQVWRAYATGPDKDLLLASDFNIKNPHYGQKGLGTGTWEGDAWKIGGGTNWG  244 (599)
T ss_dssp             CBCGGGT--------CCCEEEEEETTTCCEEEEEESSSCHHHHTBCTTTTTTCGGGCCTTHHHHTSSTTGGGGCCCCCCS
T ss_pred             ecccccC--------CCCeEEEEECCCCcEEEEEcCCCCccccccccccccccccccccccccccCCCcceecCCCcccc
Confidence            7643221        158999999999999999998542200    0                   00   124567786


Q ss_pred             CCceeecccCcccCC-CCCCCCCCCCcccCCCCCCeEEEEECCCCceEEEecCCCCcceeeeccCCCCCCCCCCCCCCCc
Q 039692          189 SSPAIDVIRRQKQNN-QTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDAD  267 (417)
Q Consensus       189 ~~pa~d~~~~~~~~~-~~~~p~~~~~~v~~~~~~~~l~ald~~tG~~~W~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~  267 (417)
                       .+++|++.+..+.. ....|.-.........+.+.|+|||++||+++|+++..+++.|.+                  +
T Consensus       245 -~~a~d~~~g~vy~g~g~~~p~~~~~r~gd~~y~~sv~Ald~~TG~~~W~~q~~~~d~wd~------------------d  305 (599)
T 1w6s_A          245 -WYAYDPGTNLIYFGTGNPAPWNETMRPGDNKWTMTIFGRDADTGEAKFGYQKTPHDEWDY------------------A  305 (599)
T ss_dssp             -CCEEETTTTEEEEECCCCSCSCGGGSCSCCTTSSEEEEEETTTCCEEEEEESSTTCSSCC------------------C
T ss_pred             -ceeEeCCCCEEEEeCCCCccccCcccCCCccccceEEEEeCCCCceeeEeecCCCccccc------------------c
Confidence             47898887743211 111111111111222345789999999999999999999888844                  4


Q ss_pred             cCCCceEEEEe-cCCeeeeEEEEEcccceEEEEECCCCcEEEEeecCCC-------------------------------
Q 039692          268 FGEAPMLLTIS-TNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGPG-------------------------------  315 (417)
Q Consensus       268 ~~~~p~v~~~~-~~G~~~~~v~~~~~~G~l~ald~~tG~~lW~~~~~~~-------------------------------  315 (417)
                      ..++|++.+.. .+|+...+++.++++|.||+||++||+++|+.+..+.                               
T Consensus       306 ~~~~p~l~d~~~~~G~~~~~v~~~~~~G~l~~lD~~tG~~lw~~~~~~~~~~~~~~~~~~g~p~~~~~~~~~~~~~~~~~  385 (599)
T 1w6s_A          306 GVNVMMLSEQKDKDGKARKLLTHPDRNGIVYTLDRTDGALVSANKLDDTVNVFKSVDLKTGQPVRDPEYGTRMDHLAKDI  385 (599)
T ss_dssp             CCCCCEEEEEECTTSCEEEEEEEECTTSEEEEEETTTCCEEEEEESSTTCCSEEEECTTTCCEEECGGGCCCTTCCEEEE
T ss_pred             CCCccEEEeccccCCcEEEEEEEECCCcEEEEEECCCCCEeecccccCCcccccccccCCCceeeccccCCCCCCCccEe
Confidence            45789999876 6776567888899999999999999999999875420                               


Q ss_pred             --CCCCcceec-cc--------------------------------------------c------cCCeEEEEeccCCce
Q 039692          316 --GREGGGVWG-AA--------------------------------------------T------DGRRVYTNIVNNDRI  342 (417)
Q Consensus       316 --~~~g~~~~~-~~--------------------------------------------~------~~~~vy~~~~~~~~~  342 (417)
                        ...|+..+. ++                                            .      ..+.|++.|..++++
T Consensus       386 ~P~~~Gg~~w~~~a~dp~~~~~yv~~~~~~~~~~~~~~~~~~g~~~~g~~~~~~~~p~~~~~~~~~~G~l~A~D~~tG~~  465 (599)
T 1w6s_A          386 CPSAMGYHNQGHDSYDPKRELFFMGINHICMDWEPFMLPYKAGQFFVGATLNMYPGPKGDRQNYEGLGQIKAYNAITGDY  465 (599)
T ss_dssp             SSCTTCSSCSCBCEEETTTTEEEEEEECEEEEEEECCCCCCTTSCCCCEEEEEEECTTSBTTTTBCCEEEEEECTTTCCE
T ss_pred             ccCcccccCCCCccCCCCCCEEEEeccccceeeecccccccCCcceecccceeccCCcCCcccCCCcCeEEEEECCCCCE
Confidence              001111110 00                                            0      236788889999999


Q ss_pred             eeeecCCCCCCCccceeeeCCeEEeccCCCC--------CCeec---------ccccc--cCCeEEEec
Q 039692          343 IWSTADPSNETAHGPVTVVNGVLFAGSVSAN--------GSTVY---------GGVPA--SYGCIYLGN  392 (417)
Q Consensus       343 ~W~~~~~~~~~~~~p~~~~~~~v~~~~~~g~--------g~~~~---------~sp~~--~~g~lyv~~  392 (417)
                      +|+.+... ...++|+++++++||+++.+|.        |+.+|         ++|++  +||++||..
T Consensus       466 ~W~~~~~~-~~~~g~~~tagg~vf~gt~dg~l~A~D~~tG~~lW~~~l~~g~~~~P~~y~~~G~qyv~~  533 (599)
T 1w6s_A          466 KWEKMERF-AVWGGTMATAGDLVFYGTLDGYLKARDSDTGDLLWKFKIPSGAIGYPMTYTHKGTQYVAI  533 (599)
T ss_dssp             EEEEEESS-CCCSBCEEETTTEEEEECTTSEEEEEETTTCCEEEEEECSSCCCSCCEEEEETTEEEEEE
T ss_pred             EeEecCCC-CccCcceEecCCEEEEECCCCeEEEEECCCCCEEEEeeCCCCcEeccEEEEeCCEEEEEE
Confidence            99997653 5567888889999999998876        55554         78888  799999943
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3hx6_A Type 4 fimbrial biogenesis protein PILY1; beta propeller, pilus protein, cell adhesion; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hx6_A Type 4 fimbrial biogenesis protein PILY1; beta propeller, pilus protein, cell adhesion; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2zux_A YESW protein; beta-propeller, lyase, rhamnose complex; HET: RAM; 1.32A {Bacillus subtilis} PDB: 2z8s_A* 2z8r_A* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2zux_A YESW protein; beta-propeller, lyase, rhamnose complex; HET: RAM; 1.32A {Bacillus subtilis} PDB: 2z8s_A* 2z8r_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2zuy_A YESX protein; beta-propeller, lyase; 1.65A {Bacillus subtilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2zuy_A YESX protein; beta-propeller, lyase; 1.65A {Bacillus subtilis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3elq_A Arylsulfate sulfotransferase; beta propeller, protein-substrate complex, periplasm, transesterification, phenol, bacteria; 2.00A {Escherichia coli} PDB: 3ett_A* 3ets_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3elq_A Arylsulfate sulfotransferase; beta propeller, protein-substrate complex, periplasm, transesterification, phenol, bacteria; 2.00A {Escherichia coli} PDB: 3ett_A* 3ets_A* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 417
d2ad6a1 571 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy c 1e-24
d2ad6a1571 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy c 0.002
d1kv9a2 560 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogen 2e-22
d1kv9a2560 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogen 0.002
d1kb0a2 573 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogen 5e-19
d1kb0a2573 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogen 0.004
d1flga_582 b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas a 1e-18
d1flga_582 b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas a 0.003
d1w6sa_ 596 b.70.1.1 (A:) Methanol dehydrogenase, heavy chain 2e-18
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 571 Back     information, alignment and structure

class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: Quinoprotein alcohol dehydrogenase-like
family: Quinoprotein alcohol dehydrogenase-like
domain: Methanol dehydrogenase, heavy chain
species: Methylophilus methylotrophus, w3a1 [TaxId: 17]

 Score =  104 bits (259), Expect = 1e-24
 Identities = 73/463 (15%), Positives = 142/463 (30%), Gaps = 76/463 (16%)

Query: 1   WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAG--KDISATPAVANGVVYFPS-WN 57
           W    G   ++  +     IN   V+N++  WSF  G        P V   ++Y  S + 
Sbjct: 14  WPIATGGYYSQHNSPLA-QINKSNVKNVKAAWSFSTGVLNGHEGAPLVIGDMMYVHSAFP 72

Query: 58  GYLYAVNAFN-GALIWEQNLSKLTGLSGTG---------------IVVNVTVAVVVAVSR 101
              YA+N  + G ++W+    +                       IV       ++A+  
Sbjct: 73  NNTYALNLNDPGKIVWQHKPKQDASTKAVMCCDVVDRGLAYGAGQIVKKQANGHLLALDA 132

Query: 102 SNGELVWSTQI-DPRPRSQITMSGSVYMGAFYVGLSSLEEALPADQCCTFRGSLAKLDVR 160
             G++ W  ++ DP+  S +T +  V      +G S  E           RG++   D++
Sbjct: 133 KTGKINWEVEVCDPKVGSTLTQAPFVAKDTVLMGCSGAE--------LGVRGAVNAFDLK 184

Query: 161 NGRIIWQTYMLPDNGGKRGG--------------------------YSGAAVWGSSPAID 194
            G + W+ +    +   R                              G   WG      
Sbjct: 185 TGELKWRAFATGSDDSVRLAKDFNSANPHYGQFGLGTKTWEGDAWKIGGGTNWGWYAYDP 244

Query: 195 VIRRQKQNNQTTKPTHPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPN 254
            +      +    P +       + +  +I   D+D+G   W      +D +        
Sbjct: 245 KLNLFYYGSGNPAPWNETMRPGDNKWTMTIWGRDLDTGMAKWGYQKTPHDEW-------- 296

Query: 255 NPDCPPGPNLDADFGEAPMLLTISTNGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGP 314
                     D       +L     NG+   ++  + ++G  +  +R++G++I  +   P
Sbjct: 297 ----------DFAGVNQMVLTDQPVNGKMTPLLSHIDRNGILYTLNRENGNLIVAEKVDP 346

Query: 315 GGREGGGV---WGAATDGRRVYTNIVNNDRIIWSTADPSNETAHGPVTVVNGVLFAGSVS 371
                  V    G         T + +    I  +A   +          +  L+AG   
Sbjct: 347 AVNVFKKVDLKTGTPVRDPEFATRMDHKGTNICPSAMGFHNQGVDSYDPESRTLYAGLNH 406

Query: 372 ANGSTVYGGVPASYGCIYLGNGYTVSLGKFHPTWTPGTSLYAF 414
                    +P   G  ++G    +  G   PT      + AF
Sbjct: 407 ICMDWEPFMLPYRAGQFFVGATLAMYPGPNGPTKKEMGQIRAF 449
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 571 Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Length = 560 Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Length = 560 Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Length = 573 Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Length = 573 Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 582 Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 582 Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Length = 596 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query417
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 100.0
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 100.0
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 100.0
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 100.0
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 100.0
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 99.93
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 99.91
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 99.91
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 99.9
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 99.89
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.24
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.06
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.0
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.91
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.9
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.87
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.86
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.85
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.68
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.61
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.55
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.51
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.42
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.37
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.36
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.36
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.29
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.2
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.17
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.99
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 96.91
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.66
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.48
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.45
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.25
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.12
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 96.12
d1tbga_340 beta1-subunit of the signal-transducing G protein 95.86
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.52
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.45
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 95.43
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 95.34
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.24
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 95.09
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.08
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.9
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 94.9
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.74
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 93.93
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 92.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 92.12
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 90.54
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 90.53
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 90.42
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 90.33
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 89.33
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 88.6
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 87.36
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 86.98
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.54
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 85.76
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 83.04
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: Quinoprotein alcohol dehydrogenase-like
family: Quinoprotein alcohol dehydrogenase-like
domain: Quinoprotein alcohol dehydrogenase, N-terminal domain
species: Pseudomonas putida, hk5 [TaxId: 303]

Probab=100.00  E-value=1.1e-42  Score=358.08  Aligned_cols=387  Identities=22%  Similarity=0.370  Sum_probs=289.1

Q ss_pred             CCCCCCCCCCCccccCCcccCccccccceeeeEEEeCCc--eeeCcEEECCEEEEeccCCcEEEEECCCCccceEeeccc
Q 039692            1 WLNHGGDLNNRRYAYGEVLINPVTVRNLRLRWSFYAGKD--ISATPAVANGVVYFPSWNGYLYAVNAFNGALIWEQNLSK   78 (417)
Q Consensus         1 Wp~~~~~~~~~~~~~~~~~i~~~~~~~~~~~W~~~~~~~--~~~~p~~~~g~v~v~~~~g~l~ald~~tG~~~W~~~~~~   78 (417)
                      ||+|++|+.++||++.++ |++.|+.+++++|++.++..  +.++|++.+|+||+++.+++|+|||++||+++|+++...
T Consensus        18 W~~~~g~~~~~r~s~~~~-I~~~nv~~L~~aW~~~~~~~~~~~stPiv~~g~vyv~t~~~~v~AlDa~tG~~lW~~~~~~   96 (560)
T d1kv9a2          18 WLSHGRTYAEQRFSPLKQ-IDASNVRSLGLAWYMDLDNTRGLEATPLFHDGVIYTSMSWSRVIAVDAASGKELWRYDPEV   96 (560)
T ss_dssp             BCBTTBSTTCCCEECCCS-SCTTTGGGEEEEEEEECSCCSCCCCCCEEETTEEEEEEGGGEEEEEETTTCCEEEEECCCC
T ss_pred             chhhCCCCccCccCchhh-cChhHhhcceEEEEEECCCCCCcEeCCEEECCEEEEECCCCeEEEEeCCCCCEEEEECCCC
Confidence            999999999999999987 99999999999999999864  579999999999999999999999999999999986542


Q ss_pred             cc---CCcce-----ee-EEee-e-----eeEEEEEecCCCceeeeeecCCC-CCcceeeceeEEcCeEEEEeCCccCcc
Q 039692           79 LT---GLSGT-----GI-VVNV-T-----VAVVVAVSRSNGELVWSTQIDPR-PRSQITMSGSVYMGAFYVGLSSLEEAL  142 (417)
Q Consensus        79 ~~---~~~p~-----~~-v~~~-~-----v~~l~ald~~tG~~~W~~~~~~~-~~~~~~~sp~v~~~~v~v~~~~~~~~~  142 (417)
                      ..   ....+     ++ +..+ .     .++|+|||++||+++|+...... ....+.++|++.++.|+++...     
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~g~l~Alda~tG~~~w~~~~~~~~~~~~~~~~p~v~~~~vivg~~~-----  171 (560)
T d1kv9a2          97 AKVKARTSCCDAVNRGVALWGDKVYVGTLDGRLIALDAKTGKAIWSQQTTDPAKPYSITGAPRVVKGKVIIGNGG-----  171 (560)
T ss_dssp             CGGGGGGCTTCSCCCCCEEEBTEEEEECTTSEEEEEETTTCCEEEEEECSCTTSSCBCCSCCEEETTEEEECCBC-----
T ss_pred             CccccccccccccccCcceeCCeEEEEeCCCEEEEEECCCCcEEeccCccCcccceeeeeeeeeecCcccccccc-----
Confidence            10   00111     11 1222 1     19999999999999999986443 3345778999999999998764     


Q ss_pred             ccCcccCCCceEEEEeCCCCceeceeeecCCCCCCCC-------------------CCCCccccCCCceeecccCccc--
Q 039692          143 PADQCCTFRGSLAKLDVRNGRIIWQTYMLPDNGGKRG-------------------GYSGAAVWGSSPAIDVIRRQKQ--  201 (417)
Q Consensus       143 ~~~~~~~~~g~l~ald~~tG~~~W~~~~~~~~~~~~~-------------------~~~gg~~~~~~pa~d~~~~~~~--  201 (417)
                         .++...|.|+|||++||+++|++.+.+.....+.                   ...|+.+|. .+++|++++..+  
T Consensus       172 ---~~~~~~G~v~a~D~~TG~~~W~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~~W~-~~s~D~~~~l~y~~  247 (560)
T d1kv9a2         172 ---AEYGVRGFVSAYDADTGKLAWRFYTVPGDPALPYEHPELREAAKTWQGDQYWKLGGGGTVWD-SMAYDPELDLLYVG  247 (560)
T ss_dssp             ---TTTCCBCEEEEEETTTCCEEEEEESSCCCTTSCCSSHHHHHHHTTCCSSCHHHHCEECCCCS-CEEEETTTTEEEEE
T ss_pred             ---eeccccceEEEEECCCceEEeeeeeccccccCCccccccccccccccccccccccCCCCccc-ccccccccCeeeec
Confidence               2455579999999999999999998654432211                   024778896 489999998632  


Q ss_pred             -CCCCCCCC-CCCCcccCCCCCCeEEEEECCCCceEEEecCCCCcceeeeccCCCCCCCCCCCCCCCccCCCceEEEEec
Q 039692          202 -NNQTTKPT-HPDQCISSDIYANSIVALDIDSGRIAWAKPLGGYDIFYFTCLVPNNPDCPPGPNLDADFGEAPMLLTIST  279 (417)
Q Consensus       202 -~~~~~~p~-~~~~~v~~~~~~~~l~ald~~tG~~~W~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~p~v~~~~~  279 (417)
                       .+....+. ..........+...++|||++||+++|.++...++.|.+.+                  ...|++.++..
T Consensus       248 tgn~~~~~~~~~~~~~g~n~~s~sivAld~~tG~~~W~~Q~~~~D~wd~d~------------------~~~~~l~~~~~  309 (560)
T d1kv9a2         248 TGNGSPWNREVRSPGGGDNLYLSSILAIRPDTGKLAWHYQVTPGDSWDFTA------------------TQQITLAELNI  309 (560)
T ss_dssp             CCCEESSCHHHHSTTCCCCTTTTEEEEECTTTCCEEEEEESSTTCCSCCCC------------------CSCEEEEEEEE
T ss_pred             CCCCcccccccccccCCccccceeeEEecCCccceeEEEeccccccccccc------------------cceeeeeeeec
Confidence             22111110 00111233445788999999999999999999999986543                  47889999999


Q ss_pred             CCeeeeEEEEEcccceEEEEECCCCcEEEEeecCC------------------------------CCCCCcceeccc-cc
Q 039692          280 NGRFRDVVVAVQKSGFAWAFDRDSGDIIWFKLAGP------------------------------GGREGGGVWGAA-TD  328 (417)
Q Consensus       280 ~G~~~~~v~~~~~~G~l~ald~~tG~~lW~~~~~~------------------------------~~~~g~~~~~~~-~~  328 (417)
                      +|+..+++++++++|.+|+||++||+++|..+..+                              +...|+..+.++ ++
T Consensus       310 ~g~~~~~v~~~~k~G~~~~lDr~tG~~i~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~p~~~Gg~~w~~~a~d  389 (560)
T d1kv9a2         310 DGKPRKVLMQAPKNGFFYVLDRTNGKLISAEKFGKVTWAEKVDLATGRPVEAPGVRYEKEPIVMWPSPFGAHNWHSMSFN  389 (560)
T ss_dssp             TTEEEEEEEECCTTSEEEEEETTTCCEEEEEESSCCCSEEEECTTTCCEEECTTTTCSSSCEEESSCTTCSSCSSCCEEE
T ss_pred             CCceeeeeeecCccceEEEEecCCCcccccccccccccccccChhhccccccccccccccceeeeecccccccccccccc
Confidence            99888899999999999999999999999887542                              112333333221 11


Q ss_pred             --C---------------------------------------------CeEEEEeccCCceeeeecCCCCCCCccceeee
Q 039692          329 --G---------------------------------------------RRVYTNIVNNDRIIWSTADPSNETAHGPVTVV  361 (417)
Q Consensus       329 --~---------------------------------------------~~vy~~~~~~~~~~W~~~~~~~~~~~~p~~~~  361 (417)
                        .                                             +.+.+.|..+++++|+++.+. ...+++++++
T Consensus       390 p~~~~~yvp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~G~l~A~D~~tGk~~W~~~~~~-~~~gg~l~Ta  468 (560)
T d1kv9a2         390 PGTGLVYIPYQEVPGVYRNEGKDFVTRKAFNTAAGFADATDVPAAVVSGALLAWDPVKQKAAWKVPYPT-HWNGGTLSTA  468 (560)
T ss_dssp             TTTTEEEEEEEECCEEECCCGGGCCCCSSCCCSSCGGGCCCCCGGGCEEEEEEEETTTTEEEEEEEESS-SCCCCEEEET
T ss_pred             CCCCeeecccccccceeeccccccccccccccccCcccccCCCCcccccceEEEeCCCCeEeeeccCCC-CCCCceeEEC
Confidence              1                                             346667778889999998764 6677888899


Q ss_pred             CCeEEeccCCCC--------CCeec---------ccccc--cCCeEEEe--cCeeee------ccCCCCCCCCCCEEEEE
Q 039692          362 NGVLFAGSVSAN--------GSTVY---------GGVPA--SYGCIYLG--NGYTVS------LGKFHPTWTPGTSLYAF  414 (417)
Q Consensus       362 ~~~v~~~~~~g~--------g~~~~---------~sp~~--~~g~lyv~--~~~~~~------~~~~~~~~~~~~~~~~~  414 (417)
                      +++||+|+.+|.        |+++|         ++|+.  +||+.||.  .|.+..      .........+++.|++|
T Consensus       469 gglVF~G~~dg~l~A~Da~tGe~LW~~~l~~~~~~~P~ty~~dGkqyv~v~aG~g~~~~~~~~~~~~~~~~~~g~~l~~F  548 (560)
T d1kv9a2         469 GNLVFQGTAAGQMHAYSADKGEALWQFEAQSGIVAAPMTFELAGRQYVAIMAGWGGVATLTGGESMNLPGMKNRSRLLVF  548 (560)
T ss_dssp             TTEEEEECTTSEEEEEETTTCCEEEEEECSSCCCSCCEEEEETTEEEEEEEECCCSHHHHHCCGGGGSTTCCCCCEEEEE
T ss_pred             CCEEEEECCCCcEEEEECCCCcEeEEEECCCCccccCEEEEECCEEEEEEEeCCCcccccccccccccccCCCCCEEEEE
Confidence            999999999887        66666         77776  79999882  232211      11223345778999999


Q ss_pred             Ee
Q 039692          415 CT  416 (417)
Q Consensus       415 ~~  416 (417)
                      .|
T Consensus       549 ~L  550 (560)
T d1kv9a2         549 AL  550 (560)
T ss_dssp             EE
T ss_pred             Ee
Confidence            87
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure